Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.268.842ON53953925360.0
YML115C (VAN1)8.842ON53553323780.0
Suva_13.288.842ON53053323420.0
Smik_13.198.842ON53652322460.0
KAFR0A028308.842ON50740418260.0
KNAG0G034208.842ON51143118210.0
ZYRO0G14234g8.842ON50940817850.0
NCAS0B003008.842ON52340717730.0
NDAI0E002908.842ON52245117560.0
SAKL0D01430g8.842ON44742717440.0
TDEL0B005608.842ON50942817430.0
Kpol_541.158.842ON49840217250.0
TBLA0B032708.842ON52039716560.0
KLTH0C03828g8.842ON40440616420.0
KLLA0D01529g8.842ON50140516220.0
CAGL0B02321g8.842ON51240116170.0
Ecym_46138.842ON52440715720.0
ABL124W8.842ON48540715430.0
TPHA0C047808.842ON52540915430.0
Kwal_27.102468.842ON33933814310.0
Ecym_35731.479ON44736210251e-134
CAGL0L01331g1.479ON44736210131e-132
NCAS0G041101.479ON49436210061e-131
SAKL0D11792g1.479ON48336410041e-130
KLTH0C03432g1.479ON48936710031e-130
Kwal_27.101571.479ON47636710021e-130
NDAI0G003401.479ON50435310001e-130
KAFR0I027701.479ON4553649921e-129
YEL036C (ANP1)1.479ON5003549961e-129
KNAG0I003001.479ON4573649911e-129
Smik_5.571.479ON4913539881e-128
Suva_5.331.479ON4953539871e-128
TBLA0B021701.479ON5723629931e-128
Skud_5.541.479ON4913539851e-128
AFR357W1.479ON4343689801e-128
NDAI0B012501.479ON4463659781e-127
KLLA0E22155g1.479ON4503689761e-127
Kpol_370.51.479ON6453539871e-126
TDEL0C026001.479ON4623629591e-124
TPHA0O004301.479ON5483539631e-123
ZYRO0F05170g1.479ON6083549591e-122
KLLA0E12849g8.500ON3923565013e-57
TPHA0L013708.500ON3923705013e-57
KLTH0E11616g8.500ON3943704971e-56
ZYRO0F08492g8.500ON3963574796e-54
TDEL0B013708.500ON3963734771e-53
Suva_16.2658.500ON3953564752e-53
TBLA0H033408.500ON3933704742e-53
KNAG0A021508.500ON3963564743e-53
Smik_16.1868.500ON3953564743e-53
CAGL0L12804g8.500ON3933514709e-53
YPL050C (MNN9)8.500ON3953564701e-52
SAKL0H11110g8.500ON3933704701e-52
Skud_16.2328.500ON3953564647e-52
NCAS0C023308.500ON3933674639e-52
Kpol_1031.788.500ON3923694594e-51
NDAI0E030208.500ON3963464533e-50
KAFR0H013908.500ON3983554516e-50
Ecym_25508.500ON3903454436e-49
AGL259C8.500ON3893454411e-48
Kwal_27.118648.500ON4533464353e-47
NCAS0B024408.500ON4003644034e-43
NDAI0C052508.500ON4023433912e-41
KNAG0A039908.500ON3571782403e-21
SAKL0H20438gsingletonON5652101812e-13
KLTH0G10626g2.296ON30359860.047
Suva_14.3142.296ON28162800.31
YNL032W (SIW14)2.296ON28157790.36
Smik_14.2982.296ON28157790.37
Kpol_1003.452.296ON28059780.54
Skud_38.1singletonON28157760.77
TPHA0C034702.296ON26457741.5
ZYRO0G12540g3.295ON95087751.8
Kwal_55.206524.26ON69467723.7
Agos_YGOB_Anc_6.3476.347ON469138714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.26
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   981   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   920   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   906   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   869   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   707   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   706   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   692   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   687   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   681   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   676   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   676   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   669   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   642   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   637   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   629   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   627   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   610   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   598   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   598   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   555   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   399   e-134
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   394   e-132
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    392   e-131
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   391   e-130
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   390   e-130
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   390   e-130
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   389   e-130
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   386   e-129
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   388   e-129
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   386   e-129
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   385   e-128
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   384   e-128
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   387   e-128
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   384   e-128
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   382   e-128
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   381   e-127
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   380   e-127
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   384   e-126
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   374   e-124
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   375   e-123
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   374   e-122
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   197   3e-57
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   197   3e-57
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   196   1e-56
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   189   6e-54
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   188   1e-53
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   187   2e-53
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   187   2e-53
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   187   3e-53
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   187   3e-53
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   185   9e-53
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   185   1e-52
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   185   1e-52
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   183   7e-52
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   182   9e-52
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   181   4e-51
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   179   3e-50
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   178   6e-50
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   175   6e-49
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   174   1e-48
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   172   3e-47
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   159   4e-43
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   155   2e-41
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    97   3e-21
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    74   2e-13
KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar...    38   0.047
Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W...    35   0.31 
YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyros...    35   0.36 
Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W...    35   0.37 
Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON} (10663...    35   0.54 
Skud_38.1 Chr38 (502..1347) [846 bp, 281 aa] {ON} YNL032W (REAL)       34   0.77 
TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.29...    33   1.5  
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    33   1.8  
Kwal_55.20652 s55 complement(505826..507910) [2085 bp, 694 aa] {...    32   3.7  
Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, ...    32   4.7  

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/539 (92%), Positives = 500/539 (92%)

Query: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKX 60
           MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSK 
Sbjct: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKL 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXRLAGLNVNVSLRDGKSLLSPSESSENYKTIXXXXXXXX 120
                                 RLAGLNVNVSLRDGKSLLSPSESSENYKTI        
Sbjct: 61  QLSVSFISIIIITVLSLYLLISRLAGLNVNVSLRDGKSLLSPSESSENYKTIDLEDEEYY 120

Query: 121 XXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180
                   PEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF
Sbjct: 121 NYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300
           ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420
           DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD
Sbjct: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRREENQDES 539
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRREENQDES
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRREENQDES 539

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/533 (82%), Positives = 472/533 (88%)

Query: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKX 60
           MG+F NLRS+IK+KAMDNGL LPISRNGSSNNIK+KRS+H+  SLKGKYRYQ RST SK 
Sbjct: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXRLAGLNVNVSLRDGKSLLSPSESSENYKTIXXXXXXXX 120
                                  L+G+ + VS ++G+SLL  S+SSENYKTI        
Sbjct: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYY 120

Query: 121 XXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180
                   PEVISKFD G QHYLISQFGSEVL P+++E+YQ+ELNML DSTVE+YDLS+F
Sbjct: 121 DYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300
           ALIAYSR LQNGTLSQIFQ+IDA+IDSQTKGTDKLYLKYMDE YINRVHQAFSPPFH+NY
Sbjct: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420
           DADVELCPGSVI+DLMSKNYDV+VPNVWRPLPTFL +EQ YDLNSWMES+EAL LAKTLD
Sbjct: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEG+PNE VDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRE 533
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA+REREKRR+
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/533 (82%), Positives = 468/533 (87%), Gaps = 4/533 (0%)

Query: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKX 60
           MGLFLNLRS+IKEKAMDNGL LPISRNGSSNN K+KRS H+ KSLKGKY YQ RS+ SK 
Sbjct: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXRLAGLNVNVSLRDGKSLLSPSESSENYKTIXXXXXXXX 120
                                  L+ + + +S+++G  LL     SENYKTI        
Sbjct: 61  QLAVNVISLVIIIVLSLYLMILFLSEMKLGISIQNGNPLLG----SENYKTIDLEDEEYY 116

Query: 121 XXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180
                   PEV+SKFD G QHYLI+QFGSEVL P + E+YQ+E++MLLDSTVEKYDL++F
Sbjct: 117 NYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNF 176

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD
Sbjct: 177 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 236

Query: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300
           ALIAYSRQLQNGTLS+IFQ+IDA+IDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY
Sbjct: 237 ALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356

Query: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420
           DADVELCPGSVI+DLMSKNYDV+VPNVWRPLPTFLNSEQ YDLNSWMES EAL+LAKTLD
Sbjct: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDA G+PNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT
Sbjct: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRE 533
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR+
Sbjct: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/523 (79%), Positives = 456/523 (87%)

Query: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKX 60
           MGLFLNLRS+ K+K++DNGL LPISRNGSSN+IK+KR+ H+ KS K KY YQ RS  SK 
Sbjct: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXRLAGLNVNVSLRDGKSLLSPSESSENYKTIXXXXXXXX 120
                                  L G+++ V +++G+ LL  S+SS+NYKTI        
Sbjct: 61  QMTVNAISLIIITILSLYLSISFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIDLEDEEYY 120

Query: 121 XXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180
                   PEV+SKFD G +HYLISQFGS+VL P+++E+YQ EL+MLLDSTVEKYDLS F
Sbjct: 121 DYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180

Query: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240
           EGA NG+ETRDHILLC+PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE DTTLD
Sbjct: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240

Query: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300
           ALIAYSRQLQNGTLSQIFQ+IDA+IDSQTKGTDKLYL+YMD++YINRV QAFSPPFH+NY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420
           DADVELCPGS+I+DLMSKNYDV+VPNVWRPLPTFL SEQ YDLNSWMES+E LELAKTLD
Sbjct: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEG+PNEV+DLDGVGGVSILAKAK+FRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/404 (79%), Positives = 365/404 (90%)

Query: 129 PEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLE 188
           P VI KFD G QHYLISQFG++VL PE++E Y++E+NML DST+E YDL DF G PNG E
Sbjct: 104 PTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAE 163

Query: 189 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 248
            RDH+LLCIPLR+A+ VLPLMF+HLMNLTYPHELIDLAFLVSDCSE D TLDALI +S+ 
Sbjct: 164 NRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKN 223

Query: 249 LQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQ 308
           LQNGTLSQ+  +IDA    +T     L+LKYMD +Y+ RV +AFSPPFH++YDKPFRSVQ
Sbjct: 224 LQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQ 283

Query: 309 IFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCP 368
           IF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCP
Sbjct: 284 IFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCP 343

Query: 369 GSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEG 428
           GSVIEDLM+K+YDV+VPNVWRPLP FL+ EQ YDLNSW ES EAL+LA+TLDEDDVIVEG
Sbjct: 344 GSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEG 403

Query: 429 YAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETE 488
           YAEYPTWRVHLAYIRD +GNP+EVVD+DGVGGVSILAKAK+FR+GVQFPAFTFENHAETE
Sbjct: 404 YAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETE 463

Query: 489 AFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 532
           AFGKMAKKMGY+VGGLPHYT+WHIYEPSDDDLKE+A +ERE+RR
Sbjct: 464 AFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 381/431 (88%), Gaps = 3/431 (0%)

Query: 106 SENYKTIXXXXXXXXXXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELN 165
           + NYKT+                P VI KFD G QHYLIS+FG++VL P+++E Y+ E+ 
Sbjct: 81  NHNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVK 140

Query: 166 MLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDL 225
            L DSTV++YDL++F G+P+G   RDH+L+C+PLR+A +VLPLMFKHLMNLTYPHELID+
Sbjct: 141 QLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDV 200

Query: 226 AFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIID---SQTKGTDKLYLKYMDE 282
           AFLVSDCS+ D TL+ALIAYSRQLQNGTLSQIF ++DA+ D   ++ +  +KLYLKYM +
Sbjct: 201 AFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQ 260

Query: 283 DYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 342
           +Y+N+V +AF+PP+H+NYDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+R
Sbjct: 261 EYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSR 320

Query: 343 NWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYD 402
           NWLTANALKPYHSWVYWRDAD+ELCPGSVI+D+M+K+YDV+VPNVWRPLP FLN EQ YD
Sbjct: 321 NWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYD 380

Query: 403 LNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVS 462
           LNSWMES EALELA+TLDEDDVIVEGYAEYPTWRVHLAYIRD EG+P+EVVDLDGVGGVS
Sbjct: 381 LNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVS 440

Query: 463 ILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKE 522
           ILA+AK+FRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL+E
Sbjct: 441 ILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLRE 500

Query: 523 IATREREKRRE 533
           IA +EREKRRE
Sbjct: 501 IANKEREKRRE 511

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/408 (78%), Positives = 361/408 (88%), Gaps = 3/408 (0%)

Query: 129 PEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLE 188
           P+VI KFDGG QHYLI+QFG++VL P++ E +++E  MLL STVE YDLS F G+ NG  
Sbjct: 102 PKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAA 161

Query: 189 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 248
             +H+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+E D TLDALIAYSRQ
Sbjct: 162 NGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQ 221

Query: 249 LQNGTLSQIFQDIDAIIDSQ---TKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 305
           LQ+GTLSQ+F D+D         +KGT+KLYLKYM+ DY+  V ++FSPPFH+NYDKPFR
Sbjct: 222 LQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFR 281

Query: 306 SVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 365
           SVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE
Sbjct: 282 SVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 341

Query: 366 LCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVI 425
           LCPGSVIEDLMSK+YDV VPNVWRPLP FL+ EQ YDLNSWMES EAL LAKTLDEDDVI
Sbjct: 342 LCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVI 401

Query: 426 VEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 485
           VEGYAEYPT+RVHLAYIRD   +PNE++DLDGVGGVSILAKA++FR G+QFPAFTFENHA
Sbjct: 402 VEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHA 461

Query: 486 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRE 533
           ETE FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL+EIA +ERE RRE
Sbjct: 462 ETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRRE 509

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/407 (77%), Positives = 357/407 (87%), Gaps = 3/407 (0%)

Query: 129 PEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLE 188
           P V+ KFD G QHYLISQ+G++VL P + E Y KEL M+LD++VEKYDLS F G+ NG  
Sbjct: 116 PAVVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGAT 175

Query: 189 TRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQ 248
            RDH+LLC+PLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD TLDAL+AYS+ 
Sbjct: 176 NRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKH 235

Query: 249 LQNGTLSQIFQDIDAI---IDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 305
           LQNGTLSQ+F ++D        ++KGT  L+LKYM+ DY+  V  +F    H NYDKPFR
Sbjct: 236 LQNGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFR 295

Query: 306 SVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 365
           S+Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+E
Sbjct: 296 SIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIE 355

Query: 366 LCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVI 425
           LCPGSVIEDLMSK+YDV+VPNVWRPLP FL+ EQ YDLNSW+ES EAL+LAKTLDEDDVI
Sbjct: 356 LCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVI 415

Query: 426 VEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 485
           VEGYAEYPTWRVHLAYIRDA G+PNEVVDLDGVGGVSILAKAKIFR+GVQFPAFTFENHA
Sbjct: 416 VEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHA 475

Query: 486 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 532
           ETEAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL EIA +ER+ +R
Sbjct: 476 ETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/451 (70%), Positives = 377/451 (83%), Gaps = 6/451 (1%)

Query: 90  NVSLRDGKSLLSPSES---SENYKTIXXXXXXXXXXXXXXXXPEVISKFDGGEQHYLISQ 146
           N S R GK  L  +++   S +YKT                  +V+ KF+ G QHYLIS+
Sbjct: 72  NTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISE 131

Query: 147 FGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVL 206
           FG++VL P+++E+Y+KEL MLLD++VEKYDL  F+G+ NG E RDH+LLC+PLR+A  VL
Sbjct: 132 FGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVL 191

Query: 207 PLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAII- 265
           PLMFKHLMN+TYPHELIDLAFLVSDCS+GD TL+AL+ YSR LQNGTLSQ+FQD+D    
Sbjct: 192 PLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQY 251

Query: 266 --DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFS 323
                T+GT  L+LKYM+++Y+  V  AF+ P H+NYDKPFRSVQIF+KDFGQVIGQGFS
Sbjct: 252 EHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFS 311

Query: 324 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVV 383
           DRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG+++ED+M+ +YDV+
Sbjct: 312 DRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVL 371

Query: 384 VPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIR 443
           VPNVWRPLP FL+SEQ YDLNSW+ES EAL+LAKTL EDDVIVEGYAEYPTWRVHLAYIR
Sbjct: 372 VPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIR 431

Query: 444 DAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGG 503
           +A+G+P  VVDLDGVGGVSILAKAK+FR+GV FPAFTFENHAETE FGKMAK+MGYRVGG
Sbjct: 432 EAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGG 491

Query: 504 LPHYTIWHIYEPSDDDLKEIATREREKRREE 534
           LPHYTIWHIYEPSDDDLKEIA +ER+ R +E
Sbjct: 492 LPHYTIWHIYEPSDDDLKEIANKERQSRHKE 522

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/427 (74%), Positives = 359/427 (84%), Gaps = 1/427 (0%)

Query: 108 NYKTIXXXXXXXXXXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNML 167
           NYKT                  ++I K+D G +H+LISQ G+EVL PE+ E Y+KE+ ML
Sbjct: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80

Query: 168 LDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227
           L +TV+ YDLS +EG+ NG E RDH+LLC+PLRNA +VLPLMFKHLMNLTYPHELIDLAF
Sbjct: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140

Query: 228 LVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAII-DSQTKGTDKLYLKYMDEDYIN 286
           LVSDCSE D TLDALIAYS++LQNGTLS++F + D +   +  KG+  LYLKYM++DY+N
Sbjct: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200

Query: 287 RVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346
            V  AF PPFH +YDKPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWLT
Sbjct: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260

Query: 347 ANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSW 406
           ANALKPYHSWVYWRD D+ELCPGSVIEDLMS N DV VPNVWRPLP FL  EQAYDLNSW
Sbjct: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320

Query: 407 MESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAK 466
           +ES EAL+LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + NP E++DLDGVGGVSILAK
Sbjct: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380

Query: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATR 526
           AK+FR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDDDLKEIA +
Sbjct: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKK 440

Query: 527 EREKRRE 533
           EREKRR+
Sbjct: 441 EREKRRD 447

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/428 (73%), Positives = 364/428 (85%)

Query: 106 SENYKTIXXXXXXXXXXXXXXXXPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELN 165
           +++Y TI                P+VI KFD G  +Y I+QFG E +  E   ++++E++
Sbjct: 82  TKSYDTITLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVS 141

Query: 166 MLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDL 225
           MLLDSTVEKYD+  F G  N  E ++H+LLC+PLR+A +VLPLMFKHLMN+TYPHELIDL
Sbjct: 142 MLLDSTVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDL 201

Query: 226 AFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYI 285
           AFLVSDCSEGD TLDALIAYSRQLQNGTLSQ+F +++     + KG + LYL+YMD+DY+
Sbjct: 202 AFLVSDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYL 261

Query: 286 NRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 345
            RV  +FSPPFH+NYDK FRSVQIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWL
Sbjct: 262 QRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWL 321

Query: 346 TANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNS 405
           TANALKPYHSWVYWRDADVELCPGSVI+DLM+K+YDV+VPNVWRPLP FL+ +Q YDLNS
Sbjct: 322 TANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNS 381

Query: 406 WMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILA 465
           W+ESREAL+LAKTLDEDDVIVEGYAEYPTWR HLAY RDA G+PNEVV+LDGVGGVSILA
Sbjct: 382 WIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILA 441

Query: 466 KAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT 525
           +A++FR G+ FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDLKEI  
Sbjct: 442 RARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGN 501

Query: 526 REREKRRE 533
           +EREKRRE
Sbjct: 502 KEREKRRE 509

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/402 (75%), Positives = 358/402 (89%), Gaps = 2/402 (0%)

Query: 131 VISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETR 190
           ++ KFD G +HYLIS++GSEVL PE++  Y++EL  LL +TV+ YDLS + G  NG++ R
Sbjct: 98  LVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNR 157

Query: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 250
           +H+LLC+PLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+EGD TL++LIAYSR LQ
Sbjct: 158 EHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQ 217

Query: 251 NGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIF 310
           +GTL+ +FQ++D   D   K ++KLYLKYM++DY+  V  A+SPPFH++Y+KPFRSVQIF
Sbjct: 218 DGTLAGLFQEMDK--DDSKKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIF 275

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           QKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+
Sbjct: 276 QKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGT 335

Query: 371 VIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYA 430
           VIEDLMSKN+DV+VPNVWRPLP FLNSEQ YDLNSWMES EAL+LAK LDEDDVIVEGYA
Sbjct: 336 VIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYA 395

Query: 431 EYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHLAYIR+  GNPN+VVDLDGVGGVSIL KAK+FR+G+ FPAFTFENHAETEAF
Sbjct: 396 EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAF 455

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 532
           GKMAKKMG+RVGGLPHYT+WHIYEPSDDDL EIA++ERE  R
Sbjct: 456 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNR 497

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/397 (74%), Positives = 343/397 (86%), Gaps = 3/397 (0%)

Query: 135 FDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETRDHIL 194
           FD GEQHYLI+Q+G +V+  +++E Y +E+  LL S+V+KYDLS FEG  NG E R+H+L
Sbjct: 118 FDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLL 177

Query: 195 LCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTL 254
              PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDCSEGD TLD LI ++R LQ+GTL
Sbjct: 178 YLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTL 237

Query: 255 SQIFQDIDAII---DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQ 311
             IF+D+DA I   + + +  +K YLK+MD++YI     +F+ P H+ Y+KPFRSVQIFQ
Sbjct: 238 VDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQ 297

Query: 312 KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 371
           KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV
Sbjct: 298 KDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 357

Query: 372 IEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAE 431
           I+DLMSKNYDV+VPNVWRPLP FLN EQ YDLNSWMES EALELAKTLDEDDVIVEGYAE
Sbjct: 358 IQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAE 417

Query: 432 YPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFG 491
           YPTWRVHLAY+RD  G+PN+ +D+DGVGGVSILAKAK+FR+GV FPAFTFENHAETEAFG
Sbjct: 418 YPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFG 477

Query: 492 KMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATRER 528
           KMAKKMGY VGGLP+Y +WHIYEPSDDDLK++A  ER
Sbjct: 478 KMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/406 (73%), Positives = 343/406 (84%), Gaps = 7/406 (1%)

Query: 131 VISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETR 190
           ++ KFD G +HYLIS+ G E+L   ++E Y++E+  LLDSTVE YDL DFEG+  G   R
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 250
           +H+LL +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL+ Y ++LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 251 NGTLSQIF----QDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRS 306
           +GTLS +F     D + I   + KGT  L+LKYM   Y+  V  A+SPPFH  YDKPFRS
Sbjct: 121 SGTLSDVFAAHSSDEELI---KEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRS 177

Query: 307 VQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 366
           VQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL
Sbjct: 178 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 237

Query: 367 CPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIV 426
           CPGSVI+DLMS ++DV VPNVWRPLP FL  EQ YDLNSW+ES  AL+LA+TLDEDDVIV
Sbjct: 238 CPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIV 297

Query: 427 EGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAE 486
           EGYAEYPTWRVHLAY+RD + NP ++++LDGVGGVSILAKAK+FRNGV FPAFTFENHAE
Sbjct: 298 EGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAE 357

Query: 487 TEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 532
           TEAFGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +IA REREK+R
Sbjct: 358 TEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/405 (70%), Positives = 344/405 (84%), Gaps = 1/405 (0%)

Query: 130 EVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLET 189
           + I K+D G  HY+IS+ G E L  E++E +++E +MLL ST + YDLS + GA NG   
Sbjct: 97  DTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAAN 156

Query: 190 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 249
           RDH+LLC+PLR+AA +LP++FK+LMNLTYPHELID+AFLVSDC++   T+ +L+ +S++L
Sbjct: 157 RDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKEL 216

Query: 250 QNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQI 309
           QNGTLS+  QD +A  D +    ++LYLKYM +DY+  V  AF+PPFHD+YDKPFRS+QI
Sbjct: 217 QNGTLSKTLQDFEADKD-KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQI 275

Query: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369
           F+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG
Sbjct: 276 FEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPG 335

Query: 370 SVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGY 429
           +VIEDLM  +YDV+VPNVWRPLPTFL   QAYDLNSW+ES EA++LAKTLDEDDVIVEGY
Sbjct: 336 TVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGY 395

Query: 430 AEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 489
           AEYPTWRVHL Y+R   GNP++++DLDGVGGVSILA+A++FR G+ FPAFTFENHAETEA
Sbjct: 396 AEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEA 455

Query: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRREE 534
           FGKMAKKMG++VGGL HYT+WHIYEPSDDDL+EIA  ERE RR +
Sbjct: 456 FGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRNQ 500

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/401 (73%), Positives = 341/401 (85%), Gaps = 2/401 (0%)

Query: 130 EVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLET 189
           +++SKFD G  +YLIS++G+E     +  EY   L MLLDSTVEKYDL +F+G+ +G E 
Sbjct: 114 DIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQ 173

Query: 190 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 249
           ++HIL+C+PLR+A +VLPLMFK+LMNLTYPHELIDLAFLVSDCSEGD TL+AL  YS+ L
Sbjct: 174 QEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLL 233

Query: 250 QNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQI 309
           Q G L  I  D+D    ++ K  + ++LKYM+ DY+ RV  A+ PPFH NY KPFRSVQI
Sbjct: 234 QEGILPDILADMDNY--NKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQI 291

Query: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369
           FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELCPG
Sbjct: 292 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPG 351

Query: 370 SVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGY 429
           SVIEDLM ++YDV+VPNVWRPLP FLNS Q YDLNSWMES EAL+LAKTLDEDDVIVEGY
Sbjct: 352 SVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGY 411

Query: 430 AEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 489
           AEYPT+RVHLAYIR+ +G+P +VVDLDGVGGVSILA+A++FR GV F AFTFENHAETEA
Sbjct: 412 AEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEA 471

Query: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 530
           FGKMAKK+G+RVGGLPHYT+WHIYEPSDDDL  +A  E+ K
Sbjct: 472 FGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/407 (71%), Positives = 334/407 (82%), Gaps = 6/407 (1%)

Query: 130 EVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLET 189
           + + ++D G +H LI Q G+  L    EE +++ L+MLL +TVE YDLS + G  NG E 
Sbjct: 119 DTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAEN 176

Query: 190 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 249
           R+H+L+C+PLRNA +VLPLMF+HLMNLTYPHELIDLAFLVSDCS+ D T+D+LI+Y+ +L
Sbjct: 177 REHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEEL 236

Query: 250 QNGTLSQIFQDIDAI-IDSQTKGTDK---LYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 305
           Q GTLS+  +  DA  +  ++K  +K   L+LKYM++DY+N V  A   PFH NYDKPFR
Sbjct: 237 QKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDYLNMVENALKEPFHKNYDKPFR 296

Query: 306 SVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 365
           SVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWLTANALKPYHSWVYWRDADVE
Sbjct: 297 SVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADVE 356

Query: 366 LCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVI 425
           LCPGSVIEDLMS  YDV+VPNVWRPLP FL SEQ YDLNSW+ES  AL LAKTLDEDDVI
Sbjct: 357 LCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDVI 416

Query: 426 VEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 485
           VEGYAEY TWR HLA  RD +GN  +V+DLDGVGGVSILAKAK+FRNGV F AF FENHA
Sbjct: 417 VEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHFAAFAFENHA 476

Query: 486 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 532
           ETEAFGKMAKKMGYRVGGL HYT+WHIYEPS+DDL EIA +ER  RR
Sbjct: 477 ETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRR 523

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/407 (68%), Positives = 330/407 (81%), Gaps = 7/407 (1%)

Query: 130 EVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLET 189
           E ++K+D G +HY +++ G       ++ E+++++  L+ +TVE+YDL ++EG PNG E 
Sbjct: 81  ERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAEN 137

Query: 190 RDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQL 249
           R+H+L+CIPLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCSE D TL +L+ Y+  L
Sbjct: 138 REHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYL 197

Query: 250 QNGTLSQIFQ----DIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 305
           Q GTL+ +      +I  +      G   LYLKYMD++Y+  V  AFSPP+H+NY+KPFR
Sbjct: 198 QKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFR 257

Query: 306 SVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 365
           SVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVE
Sbjct: 258 SVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVE 317

Query: 366 LCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVI 425
           LCPGSVIEDLMS  YDV+VPNVWRPLP FL  +Q YDLNSW+ES +AL LAK L+EDDVI
Sbjct: 318 LCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVI 377

Query: 426 VEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 485
           VEGYAEY TWR HL   R+A+GNP EV+DLDGVGGVSILAKAK+FR G  F AF FENHA
Sbjct: 378 VEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHA 437

Query: 486 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 532
           ETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+ +IA RERE RR
Sbjct: 438 ETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRR 484

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/409 (69%), Positives = 345/409 (84%), Gaps = 8/409 (1%)

Query: 130 EVISKFDGGEQHYLISQFGSE---VLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNG 186
           + ISK+D G + YL+  + ++    L  + +E Y  EL  LL S+V+ YD+ DF G  +G
Sbjct: 115 DTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHG 174

Query: 187 LETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYS 246
           + +R+H+LLCIPLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++L+ Y+
Sbjct: 175 VSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYT 234

Query: 247 RQLQNGTLSQIFQDIDAI---IDSQTKGTD--KLYLKYMDEDYINRVHQAFSPPFHDNYD 301
           R LQNGTL  +F+++D +    D   +  D  KLYLKYM ++Y+ RV +AF  PFH+NYD
Sbjct: 235 RFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYD 294

Query: 302 KPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRD 361
           KPFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRD
Sbjct: 295 KPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRD 354

Query: 362 ADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDE 421
           ADVELCPG+VIEDLMSK++DV+VPNVWRPLP F+NSEQ YDLNSWMESREA++LAK L E
Sbjct: 355 ADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHE 414

Query: 422 DDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTF 481
           D+VIVEGYAEYPTWRVHLAY+R+ +G+PN+VVD+DGVGGVSILA+A++FR GV FPAFTF
Sbjct: 415 DEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTF 474

Query: 482 ENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 530
           ENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  IAT+E+E+
Sbjct: 475 ENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/338 (76%), Positives = 292/338 (86%), Gaps = 1/338 (0%)

Query: 197 IPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQ 256
           +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D T +AL+ Y+++LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 257 IFQDIDAIIDS-QTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFG 315
           +F   ++  +  + +G+  L+LKYM   Y+  V  AF+PPFH NYDKPFRSVQIFQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 316 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 375
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 376 MSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTW 435
           M+  YDV VPNVWRPLP FL+ EQAYDLNSW+ES  AL+LAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 436 RVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 495
           RVHL YIR+ +G+P   +DLDGVGGVSILAKA++FRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 496 KMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRE 533
           KMGY V GLPHYT+WHIYEPSDDDL ++  RERE +R+
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  399 bits (1025), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/362 (53%), Positives = 243/362 (67%), Gaps = 47/362 (12%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V+ YDLS+++G  +G +  D +L C+PLR+AA+ LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            +  D T+  L+     LQ                SQ  GT                   
Sbjct: 110 ST--DDTMGVLLNSLHDLQ----------------SQADGT------------------- 132

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F  ++IFQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 133 ----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIK 182

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + D++VPNVWRPLP +LN  Q YDLNSW+ES  
Sbjct: 183 PYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEG 242

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA +L EDDVIVEGY EY TWRVHLAY+RD  G+P   ++LDG+GGVSIL+KAK+FR
Sbjct: 243 GLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFR 302

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 531
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDLK +A    E++
Sbjct: 303 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQ 362

Query: 532 RE 533
           R+
Sbjct: 363 RK 364

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/362 (53%), Positives = 243/362 (67%), Gaps = 49/362 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+D+ G P+G +  D IL C+PLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+ + +Q Q                      DK                 
Sbjct: 114 SS--DNTMGVLMHHLQQAQK---------------------DK----------------- 133

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                    +K F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 134 ---------NKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 184

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE+ P S++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW+ES  
Sbjct: 185 PYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 244

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA TL ED VIVEGY EY TWR HLAY+RD  GNP + + LDG+GGVSIL+KA++FR
Sbjct: 245 GLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFR 304

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 531
            G  FPAF+F+ HAETEAFGK++++MG+ V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 305 AGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEK 364

Query: 532 RE 533
           R+
Sbjct: 365 RK 366

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 242/362 (66%), Gaps = 47/362 (12%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  D IL C+PLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L++    LQN    Q                                   
Sbjct: 142 SS--DNTMGVLLS---NLQNAQSQQ----------------------------------- 161

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  +  K F +++IF+KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL + A+K
Sbjct: 162 -------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIK 214

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 274

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA +LDED VIVEGY EY TWR HLAY+RD  GNP + ++L+G+GGVSIL+KAK+FR
Sbjct: 275 GLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFR 334

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 531
           +G  FPAF+FE HAETEAFGK++++M + V GLPHY IWHIYEPS +DLK +A    E++
Sbjct: 335 SGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEK 394

Query: 532 RE 533
           R+
Sbjct: 395 RK 396

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  391 bits (1004), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 192/364 (52%), Positives = 244/364 (67%), Gaps = 48/364 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL++++G  +G +  D +L C+PLR+AA+ LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L++  ++ Q+                             ++D   R    
Sbjct: 142 SS--DDTMGVLLSSLKKAQS-----------------------------NQDKSQR---- 166

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 167 ------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 214

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  N DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 274

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA +L+ED VIVEGY EY TWR HLAY+RD  G+P   ++LDG+GGVSIL+KAK+FR
Sbjct: 275 GLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFR 334

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-TREREK 530
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDLK +A   E EK
Sbjct: 335 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEK 394

Query: 531 RREE 534
           R+ E
Sbjct: 395 RKVE 398

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  390 bits (1003), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 246/367 (67%), Gaps = 49/367 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V+ YDL +++G  +G +  DH+L  +PLR+AA+ LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVSD 112

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+ Y ++ Q                S+   T +                 
Sbjct: 113 SS--DDTMGVLLEYLQKAQ----------------SKPDRTQR----------------- 137

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++I++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 138 ------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 186 PYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA++LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSIL+KAK+FR
Sbjct: 246 GLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVFR 305

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 531
            G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 532 R--EENQ 536
           R  EEN+
Sbjct: 366 RKIEENK 372

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  390 bits (1002), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 245/367 (66%), Gaps = 49/367 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  D +L  +PLR+AA+ LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+ + ++ Q+ T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  +  K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 133 -------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 186 PYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            ++LA++LDED VIVEGY EY TWR HLAY+RD  GNP + ++LDG+GGVSIL+KAK+FR
Sbjct: 246 GMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFR 305

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 531
            G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDLK +A    E++
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 532 R--EENQ 536
           R  EEN+
Sbjct: 366 RKVEENK 372

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  389 bits (1000), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/353 (54%), Positives = 236/353 (66%), Gaps = 47/353 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL++++G  +G +  D IL C+PLR+AA+ LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L++    LQN    Q                DK                 
Sbjct: 147 SS--DDTMGVLLS---NLQNAQSQQ----------------DK----------------- 168

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 169 ---------SKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 219

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 220 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 279

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA TL EDDVIVEGY EY TWR HLAY+RD  GNP + ++LDG+GGVSILAKAK+FR
Sbjct: 280 GLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 339

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFGK+++KM Y V GLPHY IWHIYEPS +DLK +A
Sbjct: 340 TGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  386 bits (992), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 192/364 (52%), Positives = 243/364 (66%), Gaps = 48/364 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  D IL C+PLR+AA+ LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+++ +  Q+                            MD+         
Sbjct: 122 SS--DDTMGVLLSHLQSAQSQ---------------------------MDKS-------- 144

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 254

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA+ L+ED VIVEGY EY TWR HLAY+RD  G+P E ++LDG+GGVSIL+KAK+FR
Sbjct: 255 GLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-TREREK 530
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS +DLK +A   E EK
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEK 374

Query: 531 RREE 534
           RR E
Sbjct: 375 RRLE 378

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  388 bits (996), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/354 (53%), Positives = 236/354 (66%), Gaps = 47/354 (13%)

Query: 171 TVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           +VE YDL +++G  +G +  D IL C+PLR+A++ LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 231 DCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQ 290
           D S  D T+  L      L N  ++Q  QD                              
Sbjct: 121 DSS--DNTMGVL------LSNLQMAQSQQD------------------------------ 142

Query: 291 AFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                      K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 143 ---------KSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 351 KPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESR 410
           KPYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 411 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIF 470
             L+LA +LDED VIVEGY EY TWR HLAY+RD  GNP + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
           R G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  386 bits (991), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 189/364 (51%), Positives = 240/364 (65%), Gaps = 47/364 (12%)

Query: 170 STVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229
           +  E YDL ++ G  NG +T D IL C+PLR+AA+ LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 230 SDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVH 289
           SD    D T+  L++                     + QT  + K               
Sbjct: 125 SDSK--DDTMGVLLS---------------------NLQTAQSQK--------------- 146

Query: 290 QAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349
                    +  K F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 147 ---------DRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 350 LKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMES 409
           +KPYHSWVYWRD DVE  P +++EDLM    DV+VPNVWRPLP +L + Q YDLNSW ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 410 REALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKI 469
              LELA +LD+D VIVEGY EY TWR HLAY+RD  G+P   ++LDG+GGVSIL+KA++
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATRERE 529
           FR+G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DLK +A    E
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 377

Query: 530 KRRE 533
           ++R+
Sbjct: 378 EQRK 381

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  385 bits (988), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 235/353 (66%), Gaps = 47/353 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  D IL C+PLR+A++ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L++                                           +H+A
Sbjct: 122 SS--DNTMGVLLS------------------------------------------NLHKA 137

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
            S     +  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 138 QS---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA  L+ED VIVEGY EY TWR HLAY+RD  GNP + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  384 bits (987), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 234/353 (66%), Gaps = 47/353 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  D IL C+PLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L++                             KL +    +D   R    
Sbjct: 122 SS--DNTMGVLLS-----------------------------KLQMAQSQQDKTKR---- 146

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 147 ------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA  LDED VIVEGY EY TWR HLAY+RD  GNP + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  387 bits (993), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/362 (51%), Positives = 237/362 (65%), Gaps = 47/362 (12%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V  YDL+++ G  +G +  D IL C+PLR+AA  LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
               D T+  L+++ +  Q+                                        
Sbjct: 132 SK--DDTMGVLLSHLQTAQS---------------------------------------- 149

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  N  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 150 -----QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 204

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE CP +++EDLM    DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 205 PYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 264

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA +LDED VIVEGY EY TWR HLAY+RD  G+P E ++LDG+GGVSIL+KAK+FR
Sbjct: 265 GLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 324

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKR 531
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK +A    E++
Sbjct: 325 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEK 384

Query: 532 RE 533
           R+
Sbjct: 385 RK 386

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  384 bits (985), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/353 (53%), Positives = 234/353 (66%), Gaps = 47/353 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  D IL C+PLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L++    LQ     Q                DK                 
Sbjct: 122 SS--DNTMGVLLS---SLQTAQSQQ----------------DK----------------- 143

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 144 ---------SKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DV+  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 195 PYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA  LDED VIVEGY EY TWR HLAY+RD  GNP + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  382 bits (980), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 194/368 (52%), Positives = 237/368 (64%), Gaps = 50/368 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE +DLS   G  +G    D +L C+PLR+AA+ LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
               D T+  L  + R+LQ                SQ                       
Sbjct: 102 SK--DETMSVLRQHVRELQ----------------SQPDNA------------------- 124

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     + F +++IFQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 125 ----------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 174

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE  P ++IEDLM  + DV+VPNVWRPLP +L   Q YDLNSW+ES  
Sbjct: 175 PYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEG 234

Query: 412 ALELAK-TLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIF 470
            L+LA  T DED VIVEGY EY TWRVHLAY+RD  G+P   ++LDG+GGVSIL++A++F
Sbjct: 235 GLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVF 294

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA--TRER 528
           R+G  FPAF+F+ HAETE FGK+++ MGY V GLPHY IWHIYEPS DDLK +A    E 
Sbjct: 295 RSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 354

Query: 529 EKRREENQ 536
           ++R EE Q
Sbjct: 355 QRRLEEAQ 362

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 243/365 (66%), Gaps = 47/365 (12%)

Query: 171 TVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           +VE YD+S+++G  +G    + IL+C+PL++A++ LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 231 DCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQ 290
           D S  D T+  L+   ++LQ              ID  T G                   
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ--------------IDGGTSGK------------------ 139

Query: 291 AFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                        F +++I++KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL   A+
Sbjct: 140 -------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAI 186

Query: 351 KPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESR 410
           KPYHSWVYWRD DVE+ P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES 
Sbjct: 187 KPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 246

Query: 411 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIF 470
             L L+ +L ED VIVEGY EY TWR HLAY+RD  G+P   ++LDGVGGVSIL+KA +F
Sbjct: 247 AGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVF 306

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 530
           R+G  FPAF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +DL+ +A  E ++
Sbjct: 307 RSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKE 366

Query: 531 RREEN 535
           R + N
Sbjct: 367 RLKRN 371

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  380 bits (976), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 239/368 (64%), Gaps = 52/368 (14%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  NG +T D ++ C+PLR+AA  L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+++ R+ Q+                                        
Sbjct: 117 SS--DDTMKTLLSHLRRAQS---------------------------------------- 134

Query: 292 FSPPFHDNYDKP--FRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349
                  N DK   F +++IF+KDFGQ +GQ FSDRH    QG RRK M RARNWL + A
Sbjct: 135 -------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAA 187

Query: 350 LKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMES 409
           LKPYHS+VYWRD DV+  P +++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW+ES
Sbjct: 188 LKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVES 247

Query: 410 REALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKI 469
              L+LA +LDED  IVEGY EY TWR HLAY+RD  G+P   ++LDG+GGVSIL+KAK+
Sbjct: 248 EGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKV 307

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA-TRER 528
           FR G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS DDLK +A   E 
Sbjct: 308 FRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEE 367

Query: 529 EKRREENQ 536
           EKRR E Q
Sbjct: 368 EKRRVEEQ 375

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  384 bits (987), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 183/353 (51%), Positives = 237/353 (67%), Gaps = 47/353 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDLS+++G  +G +  D IL CIPLR+AA  LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+++ + +Q+                Q K                     
Sbjct: 126 SS--DDTMGVLLSHLQTVQS---------------QQDKS-------------------- 148

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL + ALK
Sbjct: 149 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALK 198

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD D+E  P +++EDLM  + D++VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 199 PYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 258

Query: 412 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFR 471
            L+LA  LDE+ VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSIL+KAK+FR
Sbjct: 259 GLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFR 318

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK +A
Sbjct: 319 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  374 bits (959), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 237/362 (65%), Gaps = 48/362 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G  +G +  + IL  +PLR+AA  LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+  L+ +   LQ             I  SQ                       
Sbjct: 117 SS--DDTMGELLHH---LQ-------------IAQSQK---------------------- 136

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  + +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +  LK
Sbjct: 137 -------DRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLK 189

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
           PYHSWVYWRD DVE+ P S++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 190 PYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 249

Query: 412 ALELAKTL-DEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIF 470
            ++LA TL DED VIVEGY E+ TWR HLAY+RD  GNP + ++LDG+GGVSILAKAK+F
Sbjct: 250 GIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 309

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 530
           R G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS +DLK +A    E+
Sbjct: 310 RTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 369

Query: 531 RR 532
           +R
Sbjct: 370 KR 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  375 bits (963), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/353 (51%), Positives = 231/353 (65%), Gaps = 47/353 (13%)

Query: 171 TVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            VE YDL +++G  +G +  D I+ C+PLR+AA  LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 231 DCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQ 290
           D S  D T+  L++  +  Q                SQ   +                  
Sbjct: 124 DSS--DDTMGVLLSNLQTAQ----------------SQRDKS------------------ 147

Query: 291 AFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                      K F +++I++KDFGQVIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 148 -----------KRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 351 KPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESR 410
           KPYHSWVYWRD D+E  P +++EDLM  + D++VPNVWRPLP +L + Q YDLNSW ES 
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 411 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIF 470
             L+LA  L+ED VIVEGY EY TWR HLAY+RD  G+P   ++LDG+GGVSIL+KA +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523
           R+G  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DLK +
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  374 bits (959), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/354 (51%), Positives = 235/354 (66%), Gaps = 48/354 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL +++G P+G +  + IL  +PLR+AA+ LP  F H+  +TYPH LID +FLVSD
Sbjct: 63  VEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSD 122

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            S  D T+ AL+++  + Q+                             ++D   R    
Sbjct: 123 SS--DDTMGALLSHLEKAQS-----------------------------NKDKTRR---- 147

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++I++KDFGQ IGQ FSDRH    QG RRKLM RARNWL   ALK
Sbjct: 148 ------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALK 195

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESRE 411
            YHSWVYWRD DVELCP S++EDLM  + DV+VPNVWRPLP +L + Q YDLNSW ES  
Sbjct: 196 AYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEV 255

Query: 412 ALELAKTLDEDD-VIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIF 470
            ++LA +L +DD VIVEGY +Y TWR HLAY+RD  GNP + ++LDG+GGVSIL+K K+F
Sbjct: 256 GVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVF 315

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524
           R G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DL+ +A
Sbjct: 316 RTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  197 bits (501), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 183/356 (51%), Gaps = 58/356 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ +  +  YDL+  +   N L  ++ +L+  P++         + +L++LTYP  LI+
Sbjct: 89  DLIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIE 145

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F++   + GD  L  L +  R++Q G   + F  I  I+   ++  D+L         
Sbjct: 146 LGFIIPRTASGDAALQKLESAVREVQTGKQDKRFAKI-TILRQASQSFDRL--------- 195

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                               G  DRHA++VQ  RR  M  ARN 
Sbjct: 196 ------------------------------------GEKDRHALEVQKERRAAMALARNE 219

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  + + P+ SW+ W DAD+   P +VI+DL S N  V+  NV++    F + +Q     
Sbjct: 220 LLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESI 276

Query: 401 --YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGV 458
             YD N+W ES   L+LA+ L ++++IVEGY+E  T+R  +A+  DA G  N +++LDGV
Sbjct: 277 RPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGV 336

Query: 459 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           GG   L KA++ R+G  F  F F +  ETEAF KMAK++GY V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  197 bits (501), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 185/370 (50%), Gaps = 67/370 (18%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L +  VE          YDL+      + ++ ++H+L+  P++   D     +
Sbjct: 75  YKKKSNWLSNDFVEDIIPEGHIAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---W 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
            +L+ ++YP  L++L F++     GD TL  L A  + +Q G +   F  I  I+   ++
Sbjct: 132 SNLLKMSYPRSLLELGFIIPRTPTGDETLKKLEAAVKNVQTGKVEDRFAKI-TILRQDSQ 190

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL                                             G  +RH++ V
Sbjct: 191 SFDKL---------------------------------------------GEKERHSLAV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  +++ P  SWV W DAD+   P +VI+D+ + N  V+  NV++ 
Sbjct: 206 QKERRSAMALARNELLFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ- 264

Query: 391 LPTFL------NSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              F       NS + YD N+W ES + LE+AK ++ED++IVEGYAE  T+R  +A+  D
Sbjct: 265 --RFFDKEKNENSIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYD 322

Query: 445 AEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
             G  + ++ LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y + GL
Sbjct: 323 KAGKIDALMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGL 382

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  196 bits (497), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 184/370 (49%), Gaps = 67/370 (18%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L   TVE          YDL+           ++ +L+  P++   D     +
Sbjct: 75  YKKKSNWLFSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---W 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
            +L+ LTYP +LI+L F++   + GDT L  L A  ++ Q G                  
Sbjct: 132 DNLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQLG------------------ 173

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
                                         D+ F  + I ++D          +RHA+KV
Sbjct: 174 ----------------------------KKDQRFSKITILRQDSQSFDSLQEKERHALKV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SW+ W DAD+   P S+I+D+ + N  V+  NV++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ- 264

Query: 391 LPTFLN------SEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              ++N      +E+ YD N+W +S +AL++A  + +D+V+ EGYAE PT+R  +A++ D
Sbjct: 265 --KYMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYD 322

Query: 445 AEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
           A G+    + LDGVGG   L KA++ R+G  FP+F F +  ETE F KMA+++ Y + GL
Sbjct: 323 ASGSQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGL 382

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 383 PNYLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  189 bits (479), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 116/357 (32%), Positives = 176/357 (49%), Gaps = 60/357 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ ++ +  YDL+           ++H+L+  P++         + +L+ LTYP E  +
Sbjct: 90  DIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YWDNLLQLTYPREFTE 146

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F++   S GD  L  L A  +++Q    +Q F  I  I+   + G DKL  K      
Sbjct: 147 LGFILPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKI-TILRQNSAGFDKLMEK------ 199

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  +RHA++VQ  RR  M  ARN 
Sbjct: 200 ---------------------------------------ERHALEVQKERRSAMASARNE 220

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  ++L P  SWV W DAD+   P ++I+D+ S N  V+  NV++        +QA    
Sbjct: 221 LLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKY----YDDQAKKVQ 276

Query: 401 ---YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDG 457
              YD N+W ES  ALELAK + +D+++VEGY +  T+R  +AY  DA G  N  ++LDG
Sbjct: 277 IRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDG 336

Query: 458 VGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           VGG   L KA + R+G  FP F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 337 VGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  188 bits (477), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 181/373 (48%), Gaps = 67/373 (17%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L +  VE          YDL+           ++ +L+  P++   +     +
Sbjct: 76  YKKKSNWLFNDRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YW 132

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
            +L+ LTYP ELI+L F+V     GD  L  L    +++Q    +Q F  +  I+   +K
Sbjct: 133 DNLLQLTYPRELIELGFIVPRTQSGDVALAKLEEAVKKVQTDKKNQRFVKV-TILRQDSK 191

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA+ V
Sbjct: 192 SFDKLQEK---------------------------------------------ERHALAV 206

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P ++I+D+ + N  V+  NV++ 
Sbjct: 207 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQ- 265

Query: 391 LPTFLNSEQ------AYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              + + E+      AYD N+W ES   LELA  + ED++IVEGY+E  T+R  +AY  D
Sbjct: 266 --RYYDEEKKESSIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYD 323

Query: 445 AEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
           A G+P   + LDGVGG   L +A + R+G  FP F F +  ETE F KMAK++ + V GL
Sbjct: 324 ANGSPGAEMALDGVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGL 383

Query: 505 PHYTIWHIYEPSD 517
           P+Y ++HI E +D
Sbjct: 384 PNYLVYHIEEWND 396

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 177/356 (49%), Gaps = 58/356 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ +  +  YDL+     P+    ++HIL+  P++         + +L+ L YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIE 145

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F+    + GD+ L  L +  +++Q    +Q F  I  I+   ++  DKL  K      
Sbjct: 146 LGFITPRTATGDSALKKLESAIKKVQTDKKTQRFSKI-TILRQNSQSFDKLMEK------ 198

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  +RHA++VQ  RR  M  ARN 
Sbjct: 199 ---------------------------------------ERHALEVQKERRAAMALARNE 219

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  + + P+ SWV W DAD+   P S+I+D+   N  V+  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASI 276

Query: 401 --YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGV 458
             YD N+W ES   L++A  + +D++IVEGYAE  T+R  +A+  DA    NE + LDGV
Sbjct: 277 RPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGV 336

Query: 459 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           GG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 185/370 (50%), Gaps = 67/370 (18%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L +  VE          YDL+      +    ++ +L+  P++   D     +
Sbjct: 73  YKKKTNWLFNRHVEDIIPENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---W 129

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
           ++L+ LTYP ELI+L F++     GD  L AL A  +++Q    +Q F  I  I+   ++
Sbjct: 130 QNLLQLTYPRELIELGFILPRSDSGDAALKALEAAVKKVQTDKKNQRFSKI-TILRQDSQ 188

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
           G                                          FGQ++ +   +RHA+ V
Sbjct: 189 G------------------------------------------FGQLMEK---ERHALHV 203

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P +VI+D+ + +  V+  NV++ 
Sbjct: 204 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ- 262

Query: 391 LPTFLNSEQ------AYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              + + E+      AYD N+W ES   L++A  +++D++IVEGY+E  T+R  +A+  D
Sbjct: 263 --RYFDEEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYD 320

Query: 445 AEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
              + N  + LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++ Y V GL
Sbjct: 321 PTASVNSEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGL 380

Query: 505 PHYTIWHIYE 514
           P+Y ++H+ E
Sbjct: 381 PNYLVYHMEE 390

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 116/356 (32%), Positives = 178/356 (50%), Gaps = 58/356 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ ++ +  YDL+           ++ +L+  P++   +     + +++++TYP ELI+
Sbjct: 90  DIIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIE 146

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F+      GD  L  L A  +++Q+G  ++ F  I  I+  +++  D L  K      
Sbjct: 147 LGFIAPRTPTGDAALKKLEAAIKKIQSGKKNERFAKI-IILRQESQSFDMLAEK------ 199

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  DRHA+ VQ  RR  M  ARN 
Sbjct: 200 ---------------------------------------DRHALAVQKQRRSAMALARNE 220

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSE------ 398
           L  + L P+ SWV W DAD+   P +VI+DL + +  V+  NV++    F N E      
Sbjct: 221 LLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADI 277

Query: 399 QAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGV 458
           + YD N+W ES   LELA +L  D++IVEGYAE  T+R  +A+  D     +E + LDGV
Sbjct: 278 RPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGV 337

Query: 459 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           GG   L KA++ R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 338 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 113/356 (31%), Positives = 176/356 (49%), Gaps = 58/356 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ +  +  YDL+     P+    ++H+L+  P++         + +L+ LTYP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQ---YWDNLLQLTYPRELIE 145

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F+    + GD  L  L    +++Q    +Q F  I  I+   ++  DKL  K      
Sbjct: 146 LGFITPRTATGDLALKKLENAVKKVQADKKAQRFSKI-TIMRQNSQSFDKLMEK------ 198

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  +RHA+ VQ  RR  M  ARN 
Sbjct: 199 ---------------------------------------ERHALDVQKERRAAMALARNE 219

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  + + P+ SWV W DAD+   P ++I+D+   N  V+  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSI 276

Query: 401 --YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGV 458
             YD N+W ES   LE+A  +D+D++IVEGYAE  T+R  +A+   A   P++ + LDGV
Sbjct: 277 RPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGV 336

Query: 459 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           GG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  185 bits (470), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 114/351 (32%), Positives = 175/351 (49%), Gaps = 56/351 (15%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V KYDL+      +    ++ +L+  P++         + +L+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            + GD  L  L A  ++ Q    +  F  +  I+   +KG DKL  K             
Sbjct: 151 SASGDAALKQLEAAVKRAQTDKKNNRFGKV-TILRQDSKGFDKLQEK------------- 196

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 197 --------------------------------ERHALAVQKERRSAMALARNELLFSTIG 224

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSE-----QAYDLNSW 406
           P+ SWV W DAD+     S+I+D+ + N  V+  NV++    F  +E     + YD N+W
Sbjct: 225 PHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRY--FDEAENKPSIRPYDFNNW 282

Query: 407 MESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAK 466
            +S+ A EL   + +D++IVEGYAE  T+R  +A+    +G PNE++ LDGVGG   L K
Sbjct: 283 ADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVK 342

Query: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 517
           A++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E +D
Sbjct: 343 AEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  185 bits (470), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 173/356 (48%), Gaps = 58/356 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ +  +  YDL+           ++HIL+  P++         + +L+ L YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIE 145

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F+    + GD  L  L    +++Q    +Q F  I  I+   ++  DKL  K      
Sbjct: 146 LGFITPRTATGDLALKKLENAIKKVQTDKKTQRFSKI-TILRQNSQSFDKLMEK------ 198

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  +RHA+ VQ  RR  M  ARN 
Sbjct: 199 ---------------------------------------ERHALDVQKERRAAMALARNE 219

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  + + P+ SWV W DAD+   P S+I+D+   N  ++  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSI 276

Query: 401 --YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGV 458
             YD N+W ES   LE+A  + +D++IVEGYAE  T+R  +A+  DA G P E + LDGV
Sbjct: 277 RPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGV 336

Query: 459 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           GG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  185 bits (470), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 177/370 (47%), Gaps = 67/370 (18%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L +  +E          YDL+      N    ++ +L+  P++N        +
Sbjct: 74  YKKKSNWLFNDKIEDVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YW 130

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
            +L+ LTYP ELI+L F+V     G+  L+ L A  +++Q G     F  I  I+   ++
Sbjct: 131 DNLLQLTYPRELIELGFIVPRTGSGNVALEQLEAAVKKVQTGKKEDRFGKI-TILRQASQ 189

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RHA++V
Sbjct: 190 SFDKLLEK---------------------------------------------ERHALEV 204

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  + + PY SW+ W DAD+   P SVIED+ + N  V+  NV++ 
Sbjct: 205 QKERRAAMALARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ- 263

Query: 391 LPTFLNSEQA------YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRD 444
              + + EQ       YD N+W ES   L+LA  +  D+++VEGY E  T+R  +A+  +
Sbjct: 264 --RYYDQEQKKESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYE 321

Query: 445 AEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGL 504
                   ++LDGVGG   L KA + R+G  FP F F +  ETE F KMAK++GY V GL
Sbjct: 322 DSAPATVEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGL 381

Query: 505 PHYTIWHIYE 514
           P+Y ++HI E
Sbjct: 382 PNYLVYHIDE 391

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  183 bits (464), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 112/356 (31%), Positives = 176/356 (49%), Gaps = 58/356 (16%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ +  +  YDL+      +    ++H+L+  P++         + +L+ L+YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIE 145

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F+    + GD  L  L    +++Q    +Q F  I  I+   ++  DKL  K      
Sbjct: 146 LGFITPRTATGDLALKNLENAIKKVQTDKKTQRFSKI-TILRQNSQSFDKLMEK------ 198

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  +RHA+ VQ  RR  M  ARN 
Sbjct: 199 ---------------------------------------ERHALDVQKERRAAMALARNE 219

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  + + P+ SW+ W DAD+   P S+I+D+   +  V+  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSI 276

Query: 401 --YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGV 458
             YD N+W ES   LE+A  + +D++IVEGYAE  T+R  +A+  +A+G PNE + LDGV
Sbjct: 277 RPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGV 336

Query: 459 GGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           GG   L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  182 bits (463), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 180/367 (49%), Gaps = 61/367 (16%)

Query: 160 YQKELNMLLDSTVEK---------YDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+ E N + D  V++         YDL+      +    ++ IL+  P++         +
Sbjct: 73  YKNEHNWMFDDHVDEIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YW 129

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
           ++L+ LTYP ELI+L F+      GD  L AL A   ++Q+   +Q F  +  I+   + 
Sbjct: 130 ENLLQLTYPRELIELGFIAPRTPTGDQALAALEAAVDKVQSDKKNQRFSKV-TILRQDSV 188

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
           G +KL  K                                             +RHA++V
Sbjct: 189 GFNKLTEK---------------------------------------------ERHALEV 203

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  + + P+ SWV W DAD+   P S+I+D+ + +  V+  NV++ 
Sbjct: 204 QKERRASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQR 263

Query: 391 LPTFLNSEQA---YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEG 447
                  ++A   YD N+W ES   LELA  + +D++IVEGYAE  T+R  +AY  D + 
Sbjct: 264 YYDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDN 323

Query: 448 NPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHY 507
           +  E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y
Sbjct: 324 SVAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNY 383

Query: 508 TIWHIYE 514
            ++HI E
Sbjct: 384 LVYHIEE 390

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  181 bits (459), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 180/369 (48%), Gaps = 65/369 (17%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L +  VE          YDL+      + +  ++H+L+  P++   +     +
Sbjct: 75  YKKKFNWLFNDRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YW 131

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
           ++L+ L+YP ELI+L F++     GD  L  L    + +Q+   +  F  I  I+  +++
Sbjct: 132 ENLLKLSYPRELIELGFIIPRSDAGDAALKKLETAVKNVQSDKKNNRFSKI-TILRQESQ 190

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
             DKL  K                                             +RH++ V
Sbjct: 191 SFDKLEEK---------------------------------------------ERHSLAV 205

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
           Q  RR  M  ARN L  + L P+ SWV W D+D+   P +VIE +   +  V+  NV++ 
Sbjct: 206 QKERRAAMALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQR 265

Query: 391 LPTFLNSEQ-----AYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA 445
              F N +Q      YD N+W ES   L+LA  + +D++IVEGYAE  T+R  +A+  + 
Sbjct: 266 F--FDNDKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNP 323

Query: 446 EGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLP 505
            G+  E + LDGVGG   L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP
Sbjct: 324 SGDVGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLP 383

Query: 506 HYTIWHIYE 514
           ++ ++HI E
Sbjct: 384 NFLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  179 bits (453), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/346 (30%), Positives = 172/346 (49%), Gaps = 52/346 (15%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           + ++DL+      +    ++ +L+  PL+         +++++ L+YP ELI+L F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPR 153

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
              GD  L +L                    A+  +QT                      
Sbjct: 154 TQTGDLALQSLE------------------KAVEKTQT---------------------- 173

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 D  ++ F  V I ++D          +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 174 ------DKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFSTIG 227

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPL---PTFLNSEQAYDLNSWME 408
           P+ SWV W DAD+   P ++I+D+ + +  V+  NV++         ++ + YD N+W E
Sbjct: 228 PHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQE 287

Query: 409 SREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAK 468
           S   LELA  +++D++IVEGY+E  T+R  +AY  D     +E + LDGVGG   L KA+
Sbjct: 288 SEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAE 347

Query: 469 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           + R+G  FP+F F +  ETE F KMAK++GY + GLP+Y ++HI E
Sbjct: 348 VHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  178 bits (451), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 177/355 (49%), Gaps = 56/355 (15%)

Query: 165 NMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELID 224
           +++ +  +  YDL+           ++ +L+  P++         +++L+ LTYP ELI+
Sbjct: 92  DIIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIE 148

Query: 225 LAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDY 284
           L F++     G+  L  L    +++Q+   +Q F  I  I+   ++  D+L  K      
Sbjct: 149 LGFIIPRTKTGENALKELEIAIKKVQSDKKNQRFAKI-TILRQDSQSFDQLAEK------ 201

Query: 285 INRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
                                                  DRH++ VQ  RR  M  ARN 
Sbjct: 202 ---------------------------------------DRHSILVQKERRAAMALARNE 222

Query: 345 LTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA---- 400
           L  + L P+ +WV W DAD+   P +VI+D+ S +  V+  NV++    F N E+     
Sbjct: 223 LLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIR 280

Query: 401 -YDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVG 459
            YD N+W ES   LE+A  +DE+++IVEGY+E  T+R  +A+  +A+G   + ++LDGVG
Sbjct: 281 PYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVG 340

Query: 460 GVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           G   L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  175 bits (443), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 172/345 (49%), Gaps = 51/345 (14%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           + KYD++      + L  ++ +L+  P++   D     +++L++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
              GD  +  L    +++Q+G  +Q F  I  I+   ++  +KL     DE         
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSGKENQRFLKI-TILRQDSQSFNKL-----DE--------- 196

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA  VQ  RR  M  ARN L  + + 
Sbjct: 197 -------------------------------KERHAFNVQKERRAAMALARNELVFSTIG 225

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSE--QAYDLNSWMES 409
           P  SW+ W DAD+   P +VI+D+ + +  ++  NV++      N E  + YD N+W ES
Sbjct: 226 PSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQES 285

Query: 410 REALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKI 469
           +  LE+A ++ +D++IVE Y E  T+R  +A + D  G+P+  + LDGVGG   L KA++
Sbjct: 286 QTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQV 345

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            R+G  FP F F +  ETE F  MAK++ Y V GLP+Y ++H  E
Sbjct: 346 HRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  174 bits (441), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/345 (31%), Positives = 166/345 (48%), Gaps = 51/345 (14%)

Query: 169 DSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           D  + +YDL+  +         + +L+  P++         + +L+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 229 VSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRV 288
           +   S G+T L  L    R++Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTGP----------------------------------- 172

Query: 289 HQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                       D+ F  + I ++DF        S RH   VQ  RR  M  ARN L  +
Sbjct: 173 -----------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 349 ALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVW-RPLPTFLNSEQAYDLNSWM 407
            + PY SWV W D+D+   P ++IED+ S N  ++  NV+ R +     + +AYDLN+W 
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVENGEPAIRAYDLNNWA 281

Query: 408 ESREALELAKTLDEDDVIVEGYA-EYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAK 466
           ES   L++A  L ED +IVEGY  E+ T+R  +A++   +   +E++ LDGVGG   L K
Sbjct: 282 ESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLVK 341

Query: 467 AKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
           A++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++H
Sbjct: 342 AEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  172 bits (435), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 170/346 (49%), Gaps = 52/346 (15%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL+      N    ++ +L+  P++   +     + +L+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
            + GD  L  L A                  A+  +Q    D+ +LK             
Sbjct: 212 TTSGDNALRKLEA------------------AVKKTQLSKKDQRFLK------------- 240

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                          + I ++D          DRHA++VQ  RR  M  ARN L  + + 
Sbjct: 241 ---------------ITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTIG 285

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWR---PLPTFLNSEQAYDLNSWME 408
           PY SWV W DAD+   P ++I+D+ + +  V+  NV++      T   ++  YD N+W +
Sbjct: 286 PYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWAD 345

Query: 409 SREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAK 468
           S  AL++A ++ +D V+ EGY E  T+R  +A+      +P+  + LDGVGG   L KA+
Sbjct: 346 SDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKAE 405

Query: 469 IFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           + R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 406 VHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  159 bits (403), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 176/364 (48%), Gaps = 60/364 (16%)

Query: 160 YQKELNMLLDSTVE---------KYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMF 210
           Y+K+ N L +   E          YDL+  + + N  E ++H+L+  PL++        +
Sbjct: 82  YKKKTNWLFNDRAEDTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YW 138

Query: 211 KHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTK 270
            +L+ L+YP + I+L F++    +GD +L  L +  +++Q       F  I  I+   +K
Sbjct: 139 DNLLKLSYPRDAIELGFIIPRTKKGDHSLKKLESAIKKVQTAKQGDKFSKI-TILRQNSK 197

Query: 271 GTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKV 330
           G + +     ++  ++ +           Y+K  R+                        
Sbjct: 198 GFETV----PEKKEVSEI----------EYEKQIRAE----------------------- 220

Query: 331 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRP 390
                  M  ARN L A+ L P  +W+ W D+D+   P S+I+D+   +  V+  NV+  
Sbjct: 221 -------MALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYER 273

Query: 391 LPTFLNSE---QAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEG 447
                + E   + YD  +W+ES EAL+LA  + ED++IVEG A   T R  + +    +G
Sbjct: 274 YKDRESGELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDG 333

Query: 448 NPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHY 507
           +P+  + LDGVG   +L K+++ R+G  FP F F +  E+E F KMAK++ Y V GLP+Y
Sbjct: 334 SPSSEISLDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNY 393

Query: 508 TIWH 511
            ++H
Sbjct: 394 LVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  155 bits (391), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/343 (29%), Positives = 178/343 (51%), Gaps = 48/343 (13%)

Query: 172 VEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL+    + N LE ++H+L+  PL++  +     +++L+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
             +GD  L       +QL+N    +  Q ID  + S  K      L+  D  +    H+ 
Sbjct: 159 TKKGDQIL-------KQLENAV--KNVQGIDKKLGSN-KFAKITILRQKDSGF----HK- 203

Query: 292 FSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
               F+D  DK                     + + ++++  +R  M  ARN L ++ L 
Sbjct: 204 ----FNDRKDK--------------------KEMNDIELEKEKRAEMALARNELLSSTLS 239

Query: 352 PYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQA----YDLNSWM 407
              +W+ W D++V   P ++I+D+   +  V+  NV+  +    + ++A    YD  +W+
Sbjct: 240 HSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVY--MKDSNDKDKANIRPYDFRNWI 297

Query: 408 ESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKA 467
           ES  AL+LA  + ED++IVEG A   T R  +    +++G+P E + LDG+G    L K+
Sbjct: 298 ESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKS 357

Query: 468 KIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIW 510
           ++ R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++
Sbjct: 358 EVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 91/178 (51%), Gaps = 9/178 (5%)

Query: 335 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTF 394
           RK +   +N L  + L PY SWV W D+ +   P ++++DL +    ++  ++      F
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------F 236

Query: 395 LNSEQAYD---LNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNE 451
            NS+ + D   LN+W+ S     LA  +    V++EG +   T R  +    DA  +   
Sbjct: 237 NNSDGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLT 296

Query: 452 VVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTI 509
            ++LD V     L KA++ R+G  FP F F +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 297 EMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 153 PPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKH 212
           P   E +Y+     +    +  Y+L++   +P+     +HIL+ IPL N        F++
Sbjct: 60  PFTKEYQYKDNRGAVETGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFEN 116

Query: 213 LMNLTYPHELIDLAFLVSDCSEGDTTLDAL 242
           L  LTYP +LIDL  +V D       L AL
Sbjct: 117 LFALTYPKQLIDLGVIVPDSKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 90/210 (42%), Gaps = 35/210 (16%)

Query: 324 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVV 383
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    +++
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 384 VPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGYAEYPTWRVH--LAY 441
           VP + R     + S++ YD N+W+  R       T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGER-------TKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 442 IRDA----------EGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTF---------- 481
           ++D           E   + VV+LD VGG  +    KIF  G+QFP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 482 ENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
            +  ETE     AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 303

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQ 290
           C+ G      L+   R+LQN +L+ IF +       + +  D+ +++  DED I R+ Q
Sbjct: 236 CNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDEDKIKRIAQ 294

>Suva_14.314 Chr14 (556505..557350) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQA 291
           C+ G      LI   R+LQN +L+ IF +       + +  D+ +++  D+D I R+ + 
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRIARG 273

Query: 292 FS 293
            S
Sbjct: 274 NS 275

>YNL032W Chr14 (574506..575351) [846 bp, 281 aa] {ON}  SIW14Tyrosine
           phosphatase that plays a role in actin filament
           organization and endocytosis; localized to the cytoplasm
          Length = 281

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRV 288
           C+ G      LI   R+LQN +L+ IF +       + +  D+ +++  D+D I R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>Smik_14.298 Chr14 (537057..537902) [846 bp, 281 aa] {ON} YNL032W
           (REAL)
          Length = 281

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRV 288
           C+ G      LI   R+LQN +L+ IF +       + +  D+ +++  D+D I R+
Sbjct: 214 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON}
           (106636..107478) [843 nt, 281 aa]
          Length = 280

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQ 290
           C+ G      LI   R+LQN +L+ IF +       + +  D+ +++  D+ YI +V +
Sbjct: 213 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIELYDDIYIKKVAE 271

>Skud_38.1 Chr38 (502..1347) [846 bp, 281 aa] {ON} YNL032W (REAL)
          Length = 281

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRV 288
           C+ G      L+   R+LQN +L+ IF +       + +  D+ +++  D+D I R+
Sbjct: 214 CNRGKHRTGCLMGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDEIKRI 270

>TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.296
           YNL032W
          Length = 264

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 232 CSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRV 288
           C+ G      LI   R+LQN +L+ IF +       + +  D+ +++  D+ YI  V
Sbjct: 197 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFSFPKARALDQQFIELYDDKYIKEV 253

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 14/87 (16%)

Query: 428 GYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAET 487
            + E+P W   + Y+ + EG         G+GG     KA +FR      A  ++N  ++
Sbjct: 202 AFMEHP-WSKLVHYVINLEGT--------GIGG-----KAVLFRTSDVSTAKIYQNAVKS 247

Query: 488 EAFGKMAKKMGYRVGGLPHYTIWHIYE 514
             FG    + G+  GG+   T + IYE
Sbjct: 248 NPFGNSLFQQGFYEGGVGSETDYRIYE 274

>Kwal_55.20652 s55 complement(505826..507910) [2085 bp, 694 aa] {ON}
           YLL032C - Hypothetical ORF [contig 142] FULL
          Length = 694

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 366 LCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVI 425
           +CP         +N +++  N+W+PLP  L+  Q +D++   E +EA+ L      D+V+
Sbjct: 8   ICPLRTTIFFKPENSELISQNLWQPLP--LDQAQQFDIDG--EQKEAIGLVP----DNVV 59

Query: 426 VEGYAEY 432
           +  + ++
Sbjct: 60  IHSFEKF 66

>Agos_YGOB_Anc_6.347 Chr5 complement(1133115..1134524) [1410 bp, 469
           aa] {ON} ANNOTATED BY YGOB -
          Length = 469

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 54/138 (39%), Gaps = 32/138 (23%)

Query: 235 GDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKL------YLKYMDEDYINRV 288
           GD TL+ +I   +   N  L+++   I  ++   T  +  L      Y  ++ E Y    
Sbjct: 237 GDVTLEQVINSCKLEVNAVLNELSIRIPELLVGTTHSSVTLAKVNDFYNSFITEYYNYTY 296

Query: 289 HQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT-- 346
           HQ+ S       DK   ++ + Q   G V             + IRRKLMG A   L+  
Sbjct: 297 HQSRS-------DKIIHTLAVSQNTSGSV------------ARIIRRKLMGFATLILSLL 337

Query: 347 -----ANALKPYHSWVYW 359
                    K  HSWV+W
Sbjct: 338 VALLEVTPAKFAHSWVFW 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,527,084
Number of extensions: 2445436
Number of successful extensions: 7802
Number of sequences better than 10.0: 81
Number of HSP's gapped: 7908
Number of HSP's successfully gapped: 124
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)