Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.258.843ON53753727440.0
Smik_13.188.843ON54553622690.0
YML116W (ATR1)8.843ON54253922410.0
Suva_13.278.843ON55353022260.0
NDAI0E002808.843ON54953217890.0
CAGL0B02343g8.843ON53752317300.0
NCAS0B002908.843ON54251717000.0
KNAG0G034308.843ON54251116930.0
SAKL0D01386g8.843ON52152216710.0
KNAG0J002608.843ON55052416040.0
NCAS0A02540singletonON53951415960.0
Kpol_541.168.843ON52852715780.0
Suva_13.4678.843ON54353515770.0
YMR279C8.843ON54053615750.0
Kwal_27.102458.843ON51550215600.0
KAFR0B03930singletonON55553515540.0
Skud_13.4518.843ON53950015480.0
NDAI0K004008.843ON55353315490.0
NCAS0C004008.843ON51750315360.0
TDEL0B005508.843ON53752715350.0
Smik_13.4928.843ON54350215270.0
CAGL0M03003g8.843ON55854515250.0
KLTH0C03806g8.843ON52550415210.0
TBLA0D032708.843ON55051914930.0
TBLA0D03280singletonON58052114860.0
KAFR0A028408.843ON52052414750.0
TPHA0C047908.843ON55652714750.0
KAFR0B039408.843ON54753614710.0
TBLA0C01160singletonON60049912021e-159
Smik_15.560na 1ON5165168521e-107
Skud_15.545na 1ON5165088391e-105
Suva_8.435na 1ON5155178331e-104
YOR378Wna 1ON5155178301e-104
KLTH0C10560gna 1ON5155118291e-104
Kwal_23.6547na 1ON5115108261e-103
TDEL0G04950singletonON5125077633e-94
KLLA0B00352gna 1ON4984697597e-94
KNAG0D00130na 1ON5655405842e-67
SAKL0C06116gsingletonON1851904678e-55
KAFR0C04860na 1ON5345414809e-53
CAGL0L02519gna 1ON5294524324e-46
NCAS0A05720na 1ON5635343922e-40
NDAI0K02730singletonON6045723661e-36
SAKL0F00440gsingletonON5441331295e-07
Kwal_34.15746na 2ON5182451285e-07
Suva_10.11singletonON5405141278e-07
KLLA0C18931gna 2ON5531491261e-06
Skud_6.16na 3ON5494811223e-06
Smik_6.24na 3ON5444831205e-06
ZYRO0C01430g8.272ON5902871171e-05
NCAS0C03460na 4ON6302141117e-05
Skud_13.2442.473ON5621181091e-04
KLTH0H16214gsingletonON5511291082e-04
Smik_13.2722.473ON5611781053e-04
YKR105C (VBA5)singletonON5824091045e-04
Kwal_56.237548.272ON5894181045e-04
AGR076C8.272ON6863501046e-04
YMR088C (VBA1)2.473ON5621181037e-04
TDEL0D06610singletonON497901037e-04
Suva_13.2652.473ON5611191029e-04
NCAS0A078102.473ON5681331029e-04
NDAI0D010202.242ON592175990.002
NDAI0H022002.473ON571174970.004
KLTH0C10142gsingletonON573132930.010
KLLA0A04631g8.272ON57989930.010
Kpol_543.448.272ON643294930.011
TDEL0F039908.272ON63180930.011
KLLA0F13684g2.473ON571103930.012
TDEL0A024902.473ON55479930.012
Skud_18.3singletonON590410920.014
NCAS0G029902.242ON581175910.018
SAKL0A08228gsingletonON569147900.021
NDAI0A02050singletonON617247900.023
Smik_11.368singletonON580409900.028
CAGL0J01375g2.473ON564132890.031
SAKL0E02992g2.473ON57098890.034
KLLA0F03311g2.242ON542252880.037
KAFR0J009302.242ON566243880.040
KLLA0E24113g8.570ON57592870.051
CAGL0J09944g2.242ON592251870.054
Kpol_1039.192.242ON573200870.063
KLTH0C10120gsingletonON651132870.063
Ecym_73992.473ON563131860.082
Kwal_23.48242.242ON553242850.090
TPHA0A017508.272ON63673850.11
Smik_16.81na 4ON625228840.12
Kpol_467.242.473ON370130830.12
TDEL0C045802.241ON557237840.13
NCAS0A065805.284ON528260840.13
KLLA0F17776gna 5ON553178830.14
YPR198W (SGE1)singletonON543132830.16
Smik_17.11singletonON544127830.17
SAKL0H16808g8.272ON65748830.19
Skud_8.1075.284ON522268820.23
KLTH0D16962gsingletonON571147810.26
TDEL0G03260singletonON612146810.27
KNAG0E025602.473ON57883810.27
KLTH0G13464g8.272ON593412810.27
Skud_16.503singletonON543147810.29
TBLA0G025502.242ON613210810.29
SAKL0C05588gsingletonON677149810.33
Skud_2.423na 6ON560247800.35
TBLA0B00840singletonON637243800.36
Skud_14.2672.242ON562241800.36
YGR224W (AZR1)na 4ON613145800.42
YHR048W (YHK8)5.284ON514258790.55
ZYRO0A00330gsingletonON576143780.58
KAFR0D015508.783ON517136780.59
YNL065W (AQR1)2.242ON586145780.73
KLTH0G09504gna 7ON62429770.79
KAFR0D00790singletonON561238770.79
Suva_26.1singletonON534183770.83
ZYRO0G03234g2.473ON56279770.92
Smik_8.1175.284ON514253770.96
Suva_9.712.241ON561248770.96
NDAI0B037702.242ON571267770.97
Smik_14.2622.242ON561243770.99
Skud_7.560na 4ON642145761.0
Klac_YGOB_Anc_2.2412.241ON602189761.1
SAKL0C02178gsingletonON565119761.2
TBLA0F030408.272ON906115761.3
TDEL0C045902.242ON529232751.4
KLTH0B00594gsingletonON618146751.5
KLTH0D05434g2.473ON57684751.6
YIL120W (QDR1)2.242ON563266741.7
KLTH0B00132gsingletonON568145742.0
TPHA0G031502.473ON60044742.0
SAKL0H09328g8.570ON596291742.2
Suva_14.2762.242ON562230732.7
Suva_13.174na 8ON541114732.8
Skud_15.4748.783ON522276723.3
TBLA0B046406.155ON482143723.5
SAKL0E08756g2.242ON565109723.7
Kpol_416.6singletonON597239714.4
SAKL0E04246gna 5ON56577714.6
TBLA0E038002.242ON608253705.3
Kwal_14.728singletonON568397705.8
KLTH0G09372g2.242ON551113705.9
TDEL0C00120singletonON569212706.1
Suva_4.2753.245ON683163706.3
SAKL0A00726gsingletonON598206697.6
TBLA0E037902.241ON550263698.4
SAKL0D04510gna 9ON531125698.7
Smik_2.434na 6ON474154688.7
KAFR0B055508.261ON5551066810.0
YMR011W (HXT2)na 8ON5411146810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.25
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...  1061   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   878   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   867   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   862   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      693   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   671   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      659   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   656   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   648   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   622   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   619   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   612   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   612   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   611   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   605   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   603   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   600   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               601   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      596   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   595   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   592   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   592   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   590   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   579   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   577   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   572   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   572   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   571   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   467   e-159
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   332   e-107
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   327   e-105
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   325   e-104
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   324   e-104
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   323   e-104
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   322   e-103
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   298   3e-94
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   296   7e-94
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   229   2e-67
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   184   8e-55
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     189   9e-53
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   171   4e-46
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            155   2e-40
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   145   1e-36
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    54   5e-07
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    54   5e-07
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    54   8e-07
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    53   1e-06
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    52   3e-06
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    51   5e-06
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    50   1e-05
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    47   7e-05
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    47   1e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    46   2e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    45   3e-04
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    45   5e-04
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    45   5e-04
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    45   6e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    44   7e-04
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    44   7e-04
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    44   9e-04
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    44   9e-04
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    43   0.002
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    42   0.004
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.010
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    40   0.010
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    40   0.011
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.011
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    40   0.012
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    40   0.012
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    40   0.014
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    40   0.018
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    39   0.021
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    39   0.023
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    39   0.028
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    39   0.031
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    39   0.034
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    39   0.037
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    39   0.040
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    38   0.051
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    38   0.054
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    38   0.063
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    38   0.063
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    38   0.082
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    37   0.090
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    37   0.11 
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    37   0.12 
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    37   0.12 
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    37   0.13 
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    37   0.13 
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    37   0.14 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    37   0.16 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    37   0.17 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    37   0.19 
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    36   0.23 
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    36   0.26 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               36   0.27 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    36   0.27 
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    36   0.27 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    36   0.29 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    36   0.29 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    36   0.33 
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    35   0.35 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    35   0.36 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    35   0.36 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    35   0.42 
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    35   0.55 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    35   0.58 
KAFR0D01550 Chr4 complement(307032..308585) [1554 bp, 517 aa] {O...    35   0.59 
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    35   0.73 
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    34   0.79 
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               34   0.79 
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        34   0.83 
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    34   0.92 
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    34   0.96 
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    34   0.96 
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    34   0.97 
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    34   0.99 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    34   1.0  
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    34   1.1  
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    34   1.2  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    34   1.3  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    33   1.4  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    33   1.5  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   1.6  
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    33   1.7  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    33   2.0  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    33   2.0  
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    33   2.2  
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    33   2.7  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    33   2.8  
Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {...    32   3.3  
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    32   3.5  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    32   3.7  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    32   4.4  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    32   4.6  
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    32   5.3  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    32   5.8  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    32   5.9  
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         32   6.1  
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    32   6.3  
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    31   7.6  
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    31   8.4  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    31   8.7  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    31   8.7  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...    31   10.0 
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    31   10.0 

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/537 (96%), Positives = 520/537 (96%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60
           MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP
Sbjct: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60

Query: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
           NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG
Sbjct: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120

Query: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180
           SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL
Sbjct: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180

Query: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240
           PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI
Sbjct: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240

Query: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXX 300
           TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAY   
Sbjct: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIV 300

Query: 301 XXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360
                         YENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ
Sbjct: 301 LLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360

Query: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420
           LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP
Sbjct: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420

Query: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480
           VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG
Sbjct: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480

Query: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
           MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR
Sbjct: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/536 (79%), Positives = 465/536 (86%), Gaps = 2/536 (0%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETV--TISTDHGEEMTVDKQRWQ 58
           M+   LV+S E   D  E ENE+V   KKSSR +G+EET+  T  T+  +EM    Q+WQ
Sbjct: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ 60

Query: 59  NPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLV 118
           NP YFK +W EYLFIFTCMISQLLNQAGTTQTLSIMNI+++SFGS  NS++WLMASFPLV
Sbjct: 61  NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120

Query: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAF 178
           SGSFILISGRLGDIYGLKKML +GYV++IIWSLICG+T YSGSDTFFII RAFQGLGIAF
Sbjct: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF 180

Query: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAY 238
           VLPNVLGIIGNIYV GTFRKNIVIS VGAMAP+GATLGCLFAGLIGT+NP QWPWAFYA+
Sbjct: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240

Query: 239 TITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYX 298
           +I S+IN  LS+Y+IPNNIPTNI HFSMDWIGS LGVIGL+L+NFVWNQAPISGW QAY 
Sbjct: 241 SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYI 300

Query: 299 XXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQ 358
                           YE  FAKSPLLP AV+KD HMIQIMLALFFGWGSFGIFTFYYFQ
Sbjct: 301 IVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ 360

Query: 359 FQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASV 418
           FQLNIRHY+A+WAGGTYFMFLIWGIIAALLVG  IK VSPSV+LF SM+AFN+GSIMASV
Sbjct: 361 FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420

Query: 419 TPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 478
           TPVHETYFRTQLGTMIILSFGMD SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC
Sbjct: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480

Query: 479 LGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKA 534
           LGMGATVET +DPDGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE  I DHKAKA
Sbjct: 481 LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKA 536

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/539 (78%), Positives = 463/539 (85%), Gaps = 5/539 (0%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHD--GNEETVTISTDHGEEMTVDKQRWQ 58
           M  +SLV   ES+    E ENE+   VKKSSR +  G   T T  T   +EM    Q+WQ
Sbjct: 1   MGNQSLVVLTESKG---EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQ 57

Query: 59  NPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLV 118
           NPNYFK +W EYLFIFTCMISQLLNQAGTTQTLSIMNI+++SFGS  NS++WLMASFPLV
Sbjct: 58  NPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 117

Query: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAF 178
           SGSFILISGRLGDIYGLKKML +GYV++IIWSLICG+TKYSGSDTFFIISRAFQGLGIAF
Sbjct: 118 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAF 177

Query: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAY 238
           VLPNVLGIIGNIYV GTFRKNIVIS VGAMAP+GATLGCLFAGLIGT++PKQWPWAFYAY
Sbjct: 178 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAY 237

Query: 239 TITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYX 298
           +I + IN  LS+Y+IP+ IPTNI HFSMDWIGS LGVIGL+L+NFVWNQAPISGW+QAY 
Sbjct: 238 SIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYI 297

Query: 299 XXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQ 358
                           YE RFAK+PLLPRAV+KDRHMIQIMLALFFGWGSFGIFTFYYFQ
Sbjct: 298 IVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQ 357

Query: 359 FQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASV 418
           FQLNIR Y+A+WAGGTYFMFLIWGIIAALLVG  IK VSPSVFLF SM+AFN+GSIMASV
Sbjct: 358 FQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASV 417

Query: 419 TPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 478
           TPVHETYFRTQLGTMIILSFGMD SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC
Sbjct: 418 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 477

Query: 479 LGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
           LGMGATVET V+ DGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE  IK  +A+A   
Sbjct: 478 LGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/530 (78%), Positives = 458/530 (86%), Gaps = 2/530 (0%)

Query: 7   VKSAESRQDSFEAENESVSAVKKSSRHDGNEETVT--ISTDHGEEMTVDKQRWQNPNYFK 64
           VK+A   +D  E ENE     + SS  +  E  +T  + T+  +E+   KQ+WQNPNYFK
Sbjct: 15  VKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFK 74

Query: 65  NSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFIL 124
             W EYLFIFTCMISQLLNQ+GTTQTLSIMNI+A+SFGS+ NSR+WLMASFPLVSGSFIL
Sbjct: 75  YPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFIL 134

Query: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184
           ISGR+GDI+GLK ML IGYV+IIIWSLICGLTKYSGSDTFFI+SRAFQGLGIAFVLPNVL
Sbjct: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194

Query: 185 GIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSII 244
           GIIGN+YV GTFRKNIVIS +GAMAP+GATLGC FAGLIGT NP QWPWAFYAYTIT++I
Sbjct: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVI 254

Query: 245 NLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXX 304
           NL LS+Y+IPNNIPTN+  FSMDWIGS LGVIGLVL+N VWNQAPISGW+QAY       
Sbjct: 255 NLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLII 314

Query: 305 XXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 364
                     YE  FAKSPLLP+AV+KDRHMIQIML+LFFGWGSFGIFTFYYFQFQLNIR
Sbjct: 315 SVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIR 374

Query: 365 HYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHET 424
           HY+ +WAGG+YFMFLIWGIIAALLVG  IK+VSPSVFLF +M+AFN+GSIMASVTPVHET
Sbjct: 375 HYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHET 434

Query: 425 YFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 484
           YFR Q+GTMIILSFGMD SFPASSIIFSD LPMEYQGMAGSLVNTVVNYSMSLCLGMGAT
Sbjct: 435 YFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 494

Query: 485 VETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKA 534
           VE  +DPDGKH+LKGYRGAQYLGIGLASLACIISGLYMVE  IKDH+AKA
Sbjct: 495 VEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKA 544

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/532 (62%), Positives = 404/532 (75%), Gaps = 1/532 (0%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPN 61
           N K++ +  E  Q +     E  S++ K   ++ +E+ +  S++  +    D  +WQNP+
Sbjct: 9   NSKNVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELP-SSEQEDNTIGDHSKWQNPD 67

Query: 62  YFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGS 121
           YF+N W EYLFIF+CM+SQLLNQA T QTLSIMNII +SF S     TWL+ASFPLVSGS
Sbjct: 68  YFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGS 127

Query: 122 FILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLP 181
           FILISGR+GDIYGLKK L  GY+  IIWSLI G T YS +D FFIISRAFQGLGIAF+LP
Sbjct: 128 FILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILP 187

Query: 182 NVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTIT 241
           NV+GI+GNIY   T RKNIVIS++GA AP+GA +G LFAGLIGT+NPKQWPWAFYA+ I 
Sbjct: 188 NVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIA 247

Query: 242 SIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXX 301
           S INLA+S+YSIPNNIPTNI  F+MDWIGS + VIGL+L+NFVWNQ PI GW +AY    
Sbjct: 248 SAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVL 307

Query: 302 XXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL 361
                        YE ++AKSP+LP  V K+RH+I I+ ALF GWGSFGIF+FYYF F L
Sbjct: 308 LIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLL 367

Query: 362 NIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPV 421
           N+RHYSA+WAG TYFMF IWG +AA++VG +IK++S SV LF SM+AFNIG IM SVTPV
Sbjct: 368 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPV 427

Query: 422 HETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 481
            +TYFR  LGTMIILSFGMD SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGM
Sbjct: 428 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 487

Query: 482 GATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAK 533
           G TVE  ++  GK +LKGYR A+YLG+GLA L  +ISG+YM E +    K +
Sbjct: 488 GTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKER 539

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 398/523 (76%), Gaps = 5/523 (0%)

Query: 11  ESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVD-KQRWQNPNYFKNSWHE 69
           +S  DS + E  S S+   S + D N+    +     +   +D  Q+WQNP YF ++  E
Sbjct: 6   KSGTDSVQQETLSSSSSGSSFKQDNND---IVDEKQCDTQAIDGNQKWQNPEYFDSTLKE 62

Query: 70  YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRL 129
           YLF+ +C +SQLLNQAG  QT  IMNI+A+S  S    + WLMA+FPL+SGSFILISGR+
Sbjct: 63  YLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRI 122

Query: 130 GDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 189
           GDIYGLKK L +GY+ +I+WSLICGLTKY+ SD+FFI+SRAFQGLGI+ +LPN+LGI+G+
Sbjct: 123 GDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGS 182

Query: 190 IYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALS 249
           IY++G+ RKN+VISL+G MAP+GATLG +F+GLIGT++  QWPWAFY+Y IT+ IN  LS
Sbjct: 183 IYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLS 242

Query: 250 VYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXX 309
           ++ IPN IPTN+    MDWIGS LGV+GL+++NFVWNQAPI GWD AY            
Sbjct: 243 IWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLL 302

Query: 310 XXXXXYENRFAK-SPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368
                YE  F   +PLLP+ VLK    I ++ ALFFGWGSFGIF+FYYF FQLN+RHY+ 
Sbjct: 303 IAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTP 362

Query: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428
           +WAGGTYFMFLIWGI+AAL+VG  IKKV PS+ LFLSM+AFN GSI+ SVTP+H+TYFR 
Sbjct: 363 LWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRN 422

Query: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488
            LG MIILSFGMD SFPASSI+ SD LP++YQGMAGSLVNT+VNYSMS CLG+   VE H
Sbjct: 423 HLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQH 482

Query: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531
           V+  GK VLKGYRGA YLGIGLAS+ACIISG  M+  II+  K
Sbjct: 483 VNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRK 525

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/517 (62%), Positives = 390/517 (75%)

Query: 8   KSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSW 67
           + +   ++  E+   S++      +H   EE         E   ++  +WQNP+YF+N W
Sbjct: 7   RKSHRSEEIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQW 66

Query: 68  HEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISG 127
            EYLFIF+CM+SQLLNQA T QTLSIMNII +SF S     TWL+ASFPLVSGSFILISG
Sbjct: 67  QEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISG 126

Query: 128 RLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGII 187
           R+GDIYGLKK L  GY+  IIWS+I GLTKYS SDTFFI+SRAFQGL IAF+LPNV+GI+
Sbjct: 127 RIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIV 186

Query: 188 GNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLA 247
           GNIY   + RKNIVIS++GA AP+GA  G LFAGLIGT++P QWPWAFYA+ I S  NLA
Sbjct: 187 GNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLA 246

Query: 248 LSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXX 307
           +S+YSIPN++PTN+  F+MDWIGS L VIGL+L+NFVWNQ PI GW  AY          
Sbjct: 247 ISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVF 306

Query: 308 XXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYS 367
                  YE ++A+SPLLP  V K+RH+I I+ ALF GWGSFGIF+FYYF F LN+RHYS
Sbjct: 307 FLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYS 366

Query: 368 AVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFR 427
           A+WAG TYFMF IWG +AA++VG +IKK+S +  LF+SM+AFNIG IM SVTPV +TYFR
Sbjct: 367 ALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFR 426

Query: 428 TQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVET 487
             LGTMIILSFGMD SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGMG TVE 
Sbjct: 427 MNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVER 486

Query: 488 HVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVE 524
            ++  G  +LKGYRGA+YLGIGLA L  II+ +Y+ E
Sbjct: 487 QINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGE 523

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/511 (61%), Positives = 388/511 (75%), Gaps = 6/511 (1%)

Query: 23  SVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLL 82
           +V          GNE +  ++T      T    +WQ+  YF+N W EY+F+ TCM+SQLL
Sbjct: 28  TVENTDSDKLGSGNETSTHVAT------TDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLL 81

Query: 83  NQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIG 142
           NQA   QTLS+MNI+  SF SN  ++TWLMASFPLVSGSFILISGR+GDIYGLK  L  G
Sbjct: 82  NQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGG 141

Query: 143 YVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVI 202
            +  IIW+LI G T Y+ SDTFFI+SR+FQGLG+AF+LPNV+G +GNIY   TFRKNIVI
Sbjct: 142 NIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVI 201

Query: 203 SLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQ 262
           SL+GA APVGA +G  FAGLIGTKNP  WPW+FYA  I S + L  ++YSIPN+IPTN+ 
Sbjct: 202 SLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVH 261

Query: 263 HFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKS 322
            FSMDWIGS L V+GL+L+NFVWNQ PI GW +AY                 YE  +A S
Sbjct: 262 GFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAAS 321

Query: 323 PLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWG 382
           PLLPR + ++RHM+ I++ALF GWGSFGIF+FYYF F LN+RHYS VWAGGTYFMF IWG
Sbjct: 322 PLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWG 381

Query: 383 IIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDF 442
           ++A+++VG+ I+K+S S+ LF SM+AF++G IM SVTPV +TYFR  LGTMIILSFGMD 
Sbjct: 382 VVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDM 441

Query: 443 SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRG 502
           SFPA++II SD+LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE+ ++ +GK +LKGYR 
Sbjct: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRA 501

Query: 503 AQYLGIGLASLACIISGLYMVERIIKDHKAK 533
           A+YLGIG+ASLA I+S +YM ER+  D K +
Sbjct: 502 AEYLGIGIASLAVILSLIYMCERLWIDRKER 532

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/522 (59%), Positives = 398/522 (76%), Gaps = 9/522 (1%)

Query: 17  FEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRW---QNPNYFKNSWHEYLFI 73
           F+  NESVS+  K    +   ++ T  T+H  ++ VD ++W   Q+P YF   W EYLFI
Sbjct: 3   FKRSNESVSSQSK----ELGTQSATAFTEH-SDVQVDDKKWPSIQDPTYFSAPWKEYLFI 57

Query: 74  FTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIY 133
           F  M+SQLLNQAGTTQTLS++NI++ +F S+ + +TWLMASFPLVSGSFIL+SG++GDIY
Sbjct: 58  FASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIY 117

Query: 134 GLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS 193
           GLKK L +GYVV IIWSLICGLT Y+ S  FFIISRAFQGLGIAF+LPN++GI+GNIYV+
Sbjct: 118 GLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVA 177

Query: 194 GTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI 253
           GT RKN+VISL+GA AP+GAT+G LF+GLIGT + ++W W FYAYTIT+ IN+ LS++ I
Sbjct: 178 GTTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVI 236

Query: 254 PNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXX 313
           PN IPTN++  SMDWIGS +G++G++L NFVWNQ PI GWD AY                
Sbjct: 237 PNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFF 296

Query: 314 XYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGG 373
            YE ++A  PL+PR  + +  ++  +LA+FFGWGSFGI+TFYYF F LN+R Y+ +WAGG
Sbjct: 297 LYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGG 356

Query: 374 TYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTM 433
           +YFMFLIWGIIAA+ VG  IK++ PS+ LFLSM+AF+ G IM SVTPV +TYFR  LG M
Sbjct: 357 SYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMM 416

Query: 434 IILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDG 493
           IILSFGMD SFPASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE  ++ +G
Sbjct: 417 IILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNG 476

Query: 494 KHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535
             +LKGYR A YLGIGLASL   IS L+M+E  ++  +   +
Sbjct: 477 DDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVK 518

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/524 (56%), Positives = 373/524 (71%), Gaps = 1/524 (0%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGE-EMTVDKQRWQNP 60
           +E    K+      +   E E     + +     N  T + +    E E T +   WQNP
Sbjct: 6   SESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNP 65

Query: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
            YF N W EY FI TCM++QLLNQAG  Q  + MNI+A++F S+   +TWLMASFPLVSG
Sbjct: 66  TYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSG 125

Query: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180
           SFIL+SGR+GDIYGLKK L  GY+V++IWSLICG   Y+ +D FFI+ RAFQGLGIAF+L
Sbjct: 126 SFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFIL 185

Query: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240
           PNV+G+IGNIY + T RKN VIS VG  AP+GA LG +++GLI  +NPKQWPW FYAY I
Sbjct: 186 PNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAI 245

Query: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXX 300
              IN+ +++YSIP+ +PTNI  F MDW GSA+GV+G++L NFVWNQ PI GW++ Y   
Sbjct: 246 VVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIA 305

Query: 301 XXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360
                         YE +FAKSPLLP  V+K+RH+  I+LA+F GWGSFGI+TFYY+ FQ
Sbjct: 306 LLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQ 365

Query: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420
           LN+RHYSAVWAGGT+FMF+IWG IAA LV + IK+V PSV L  SM  F +G IM SVTP
Sbjct: 366 LNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTP 425

Query: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480
           VH++Y++  LG  IILSFGMD SFPASSII SD LP +YQGMAGSLVNT+VNYS SLCLG
Sbjct: 426 VHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLG 485

Query: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVE 524
           +G+T E  V+ +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 486 VGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/514 (57%), Positives = 374/514 (72%), Gaps = 4/514 (0%)

Query: 5   SLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFK 64
           SL    ++  D+F +   S     K+  H+  +E  + STD   +   D   WQNPNYF 
Sbjct: 2   SLPSILQTDSDNFSSSTVSFPNEDKNISHN-EKEVYSNSTDSVLD---DDSPWQNPNYFS 57

Query: 65  NSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFIL 124
           + + EY FIFTCM++ LLNQAG TQ LS MN+I+ SF S+   +TWLMASFPLVSGSFIL
Sbjct: 58  SKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFIL 117

Query: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184
           ISGR+GDIYGLKK +  GY+ +IIWSL+CG   ++ +DTFFI+ RAFQGLGI+F+LPNV+
Sbjct: 118 ISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVM 177

Query: 185 GIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSII 244
           G+IGNIY  GT RKNIVIS++G  AP GA +G L+ GLI T+N KQWPW FYAY +T ++
Sbjct: 178 GLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLV 237

Query: 245 NLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXX 304
           NL +++YS+PN IPTN+ +F+MDWIGS +GV+GL+L NFVWNQ P++GWD+AY       
Sbjct: 238 NLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLII 297

Query: 305 XXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 364
                     YE ++  SPLLP  V K+  ++ I+  LF GWG+FGI+TFYYF FQLN+R
Sbjct: 298 SVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLR 357

Query: 365 HYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHET 424
            YS VW GGTYFMF+IWG IAAL+V   IKKV P++ LF S + F +GS+M SVTP+H+ 
Sbjct: 358 DYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQM 417

Query: 425 YFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 484
           Y+R  LG  IIL FGMD SFPASSII SD+LPM+YQGMAGSLVNTV+NY+ SLCLGMG T
Sbjct: 418 YWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTT 477

Query: 485 VETHVDPDGKHVLKGYRGAQYLGIGLASLACIIS 518
           VE  ++  G+ +LKGYR A YL +GL  L   I+
Sbjct: 478 VERQINKSGEDLLKGYRSALYLAVGLGGLGSCIA 511

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/527 (55%), Positives = 381/527 (72%), Gaps = 8/527 (1%)

Query: 9   SAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWH 68
             + ++ + E  +       +S   D N+E+          M +     +NP+YF ++  
Sbjct: 2   DTDLKKKNIEVSSYIAEETIRSDCSDANDES--------PSMELKNSSLRNPDYFNSTTQ 53

Query: 69  EYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGR 128
           EY FIF+CM+SQLLN AGTTQTLSIMN++     S+++ + WL+ASFPLVSGSFIL+SGR
Sbjct: 54  EYAFIFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGR 113

Query: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 188
           LGDIYGLKKML +GYV+++IWSLI GL+ YS S  FFII+RAFQGLGI+ VLPNVLG+IG
Sbjct: 114 LGDIYGLKKMLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIG 173

Query: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLAL 248
            IY  GT +KN+VIS+VGAM+P+GATLG LF+GL+ T++   WPWAFYAYT+ + IN  +
Sbjct: 174 MIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFI 233

Query: 249 SVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXX 308
           S YSIPNNIPTN+   SMDWIGS  GV+GL+L NFVWNQAP  GW+ AY           
Sbjct: 234 SYYSIPNNIPTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIA 293

Query: 309 XXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368
                 YE R+A++PLLP  ++++R +I I+ A+ FGWGSFGI+TFYYF F LN+R+YS 
Sbjct: 294 LIAFGIYELRYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSP 353

Query: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428
           +WAGG+YF+F+I G I A+  G  +KK+ P+V L  SM+ FN+G I+ SVTPVH+TYFR 
Sbjct: 354 LWAGGSYFIFVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRN 413

Query: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488
            LGTMIIL  GMD SFPASSII SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE H
Sbjct: 414 ILGTMIILPLGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQH 473

Query: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535
            + +G  +L+GYRGA Y GI  + +A +I+GLYMVE I   +K +  
Sbjct: 474 CNKNGTDLLRGYRGALYFGIACSGVAVLIAGLYMVETIFDSYKDRKE 520

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/535 (56%), Positives = 384/535 (71%), Gaps = 4/535 (0%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60
           + EK  V+S    +DS   +  S+ A  K      +E+  T+++ +      +   WQ+P
Sbjct: 5   IEEKVNVQS----KDSPVIDKISMKAEDKVVVSSEDEDVTTVASSNKSTQVSNDSPWQDP 60

Query: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
            YF +   E +FI TCM++QLLNQAG T  L+IMN+++ SF S  + + WLMASFPLV+G
Sbjct: 61  TYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAG 120

Query: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180
           SFILISGRLGDIYGLKKML IGYV II+WSLICGL+KYS +D FFI  RAFQGLGIAF+L
Sbjct: 121 SFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFIL 180

Query: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240
           PNV+G++G++Y  G+ RKN+VIS +GA AP G   G LF GLI  ++ +QWPW FYA+ I
Sbjct: 181 PNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAI 240

Query: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXX 300
              +N+ L+ YSIPNNIPTN+  FSMDW GS L VIGL+L NFVWNQAP +GW  AY   
Sbjct: 241 AFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIA 300

Query: 301 XXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360
                         YE ++AK PLLP AV K+RHMI I+LA+F GWGSFGI+TFYY  FQ
Sbjct: 301 LLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQ 360

Query: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420
           LN+RHYS VW GGTYF+F+I+G IAA +V + IK+V P+  L  +++AF++GSIM SV P
Sbjct: 361 LNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLP 420

Query: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480
           V +++++   G   IL FGMD SFPASSII SD LPMEYQGMAGSLVNTV+NYS SLCLG
Sbjct: 421 VKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLG 480

Query: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535
           MGATVE  ++ +GK +LKGYRGA YLG+GLASL  +IS  YM+E    + + + +
Sbjct: 481 MGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQK 535

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/536 (55%), Positives = 382/536 (71%), Gaps = 5/536 (0%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPN 61
            +K+ V+  +S  D    E  +V A  K      +EE  TI +        +   WQ+P 
Sbjct: 6   KKKTSVQGTDSEID----EKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPT 61

Query: 62  YFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGS 121
           YF +   E +FI TCM++QLLNQAG T  L IMN+++ SF S  N++ WLMASFPL +GS
Sbjct: 62  YFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGS 121

Query: 122 FILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLP 181
           FILISGRLGDIYGLKKML +GYV++I+WS+I GL+KYS SD FFI SRAFQG+GIAF+LP
Sbjct: 122 FILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILP 181

Query: 182 NVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTIT 241
           N++G++G++Y  G+FRKNIVIS +GA AP G   G LF GLI T++P QWPW FYA+ I 
Sbjct: 182 NIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIA 241

Query: 242 SIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXX 301
           + ++L ++ YSIPNN+PTNI   SMDW GSAL +IGL+L NFVWNQAPI GWD+ Y    
Sbjct: 242 TFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVL 301

Query: 302 XXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL 361
                        YE+++A+ PLLPRA+ K+RHMI I+LA+F GWGSFGI+TFYY  FQL
Sbjct: 302 LIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQL 361

Query: 362 NIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPV 421
           N+RHYS VW GGTYF+F+I+G +AA  V   IK++ P++ L  S+MAF+ GSIM SV PV
Sbjct: 362 NLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPV 421

Query: 422 HETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 481
            ++Y++       IL FGMD SFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGM
Sbjct: 422 EQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGM 481

Query: 482 GATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
           G TVE  ++  G  +LKGYR A YLG+GLASL  +IS  YM+E +   H+ K+  R
Sbjct: 482 GGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHR-KSEDR 536

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/502 (58%), Positives = 371/502 (73%), Gaps = 7/502 (1%)

Query: 29  KSSRHDGNEETVTISTDHGEEMTVD------KQRWQNPNYFKNSWHEYLFIFTCMISQLL 82
           K +  + N E +  S+  GEE          K R QNP+YF   W EY+F+ + M+SQLL
Sbjct: 4   KENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLL 63

Query: 83  NQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIG 142
           NQA TTQT  + ++++    +  + + WLMASFPLVSGSFIL+SG++GDIYGLKK L  G
Sbjct: 64  NQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123

Query: 143 YVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVI 202
           YVV++IWSLICGL+ Y+ +  FF+++R+FQGLGIAFVLPNV+GI+GNIY   T  KN+V 
Sbjct: 124 YVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVF 183

Query: 203 SLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQ 262
           SL+GA AP+GATLGC+F+GLIG +    W W FYAY IT+ +N  ++++ IPNNIPTN+ 
Sbjct: 184 SLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVN 242

Query: 263 HFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKS 322
            + MDWIGSA+GV GL+L NFVWNQAPI+GW  AY                 YE RFAK 
Sbjct: 243 EYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQ 302

Query: 323 PLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWG 382
           PLLP +VL +R ++ I+ +LFFGWGSFGI+TFYY  F LN+RHYS +WAGGTYFMF IWG
Sbjct: 303 PLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWG 362

Query: 383 IIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDF 442
           I+A+LLVG  I K  P+V LFLSM+AF+ G IM +VTPVH+TYFR  LG MIILSFGMD 
Sbjct: 363 IVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDL 422

Query: 443 SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRG 502
           SFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E  V+ +G  +LKGY+ 
Sbjct: 423 SFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQA 482

Query: 503 AQYLGIGLASLACIISGLYMVE 524
           A Y+GIGLASL  +ISG +M+E
Sbjct: 483 ALYVGIGLASLGVVISGAFMIE 504

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/535 (56%), Positives = 379/535 (70%), Gaps = 11/535 (2%)

Query: 9   SAESRQDSFE-AENESVSAVKKSSRHDGNEETVTISTDHG-----EEMTVDKQRWQNPNY 62
           S E +Q+    A   +++ +   S    +E+T  IS   G     E+ + +   WQNP+Y
Sbjct: 15  SGEQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSY 74

Query: 63  FKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSF 122
           F + W EYLFI TCM+S LLNQAG TQ  S MN+I ++F ++ +S+TWLMASFPLVSGSF
Sbjct: 75  FSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSF 134

Query: 123 ILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPN 182
           IL+SGR+GDIYGLK+ +  G +V+IIWSLICG   YS S TFFII RAFQGLGIAFVLPN
Sbjct: 135 ILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPN 194

Query: 183 VLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITS 242
           V+G++GNIY  G+ RKNIVIS +G  AP GA  G  +AGLI TK  KQWPW FYAY    
Sbjct: 195 VMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAG 254

Query: 243 IINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXX 302
           I+NL L++YSIP+ +P N+  FSMDW GS +GVIGL+L NFVWN+API GW++AY     
Sbjct: 255 ILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLL 314

Query: 303 XXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLN 362
                       YE +FAKSPLLP+AV  + ++I I+ A+F GWGSFGI+TFYY+ F LN
Sbjct: 315 IFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLN 374

Query: 363 IRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVH 422
           +R Y+ + AG ++ MF++WG IAA  V   IK+V PSV LF SM+AF +GSIM S+TPVH
Sbjct: 375 LRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVH 434

Query: 423 ETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMG 482
           +TY++   G  IIL+FGMD SFPASSII SD LPMEYQGMAGSLVNT+VNYS SLCLGMG
Sbjct: 435 QTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMG 494

Query: 483 ATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
            T E  V+ +G  +LKGYR A Y+GIGL  +  II+ L++ E +      + RGR
Sbjct: 495 TTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESL-----RQKRGR 544

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/500 (57%), Positives = 370/500 (74%)

Query: 36  NEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMN 95
           +EE  T+++        +   WQ+P YF +   E +FI TCM++QLLNQAG T  L IMN
Sbjct: 35  DEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMN 94

Query: 96  IIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGL 155
           +++ SFGS  N++ WLMASFPL +GSFILISGRLGDIYGLKKML IGYV+II+WS+I GL
Sbjct: 95  VLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGL 154

Query: 156 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATL 215
           +KYS +D+FFI  RAFQG+GIAF+LPN++G++G++Y  G+ RKN+VIS++GA  P GA  
Sbjct: 155 SKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALF 214

Query: 216 GCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGV 275
           G +F GLI T++P QWPW FYA+ I + I++ ++ YSIPNN+PTN+   SMDW GS L V
Sbjct: 215 GGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAV 274

Query: 276 IGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHM 335
           IGL+L NFVWN+API+GWD+AY                 YE ++A+ PLLP AV K+RHM
Sbjct: 275 IGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHM 334

Query: 336 IQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKK 395
           I I+LA+F GWGSFGI+TFYY  FQLN+RHYS VW GGTYF+F I+G IAA  V   IK+
Sbjct: 335 IMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKR 394

Query: 396 VSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNL 455
           + P++ L  ++MAF+ GSIM SV PV ++Y++       +L FGMD SFPASSII SD L
Sbjct: 395 LGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGL 454

Query: 456 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLAC 515
           PM+YQGMAGSLVNTV+NYS SLCLGMGATVE  ++  GK+VL+GYR A YLGIGLASL  
Sbjct: 455 PMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGV 514

Query: 516 IISGLYMVERIIKDHKAKAR 535
           +IS  YM+E +  + K   R
Sbjct: 515 LISVTYMLETVWNERKKCQR 534

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/533 (56%), Positives = 387/533 (72%), Gaps = 7/533 (1%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60
           +NE +L++S +S  D   +E ++  A+K+     G++ T T S+   E    +   WQNP
Sbjct: 14  VNEANLLES-QSTIDCTSSERKT--AIKEQDDEIGSDSTTTSSSSLQE----NNSSWQNP 66

Query: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
           +YF +S+ EY+F+ TCMI+ LLNQAG +Q LS MN+I++SF S+   +TWLMASFPLVSG
Sbjct: 67  DYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSG 126

Query: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180
           SFILISGRLGDIYGLK+M+  G++ +IIWSLICG T Y+ SDTFFI++RAFQGLGI+F+L
Sbjct: 127 SFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFIL 186

Query: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240
           PNV+G++GNIY  GT RKN+VISL+G MAP G+  G L+ GLI T+NPKQWPW FYAY +
Sbjct: 187 PNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAV 246

Query: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXX 300
            + + L +  Y++P+NIPTN+  F+MDWIGS LGVIGL+L NFVWNQ PI GW++AY   
Sbjct: 247 AAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIV 306

Query: 301 XXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360
                         YE ++AK PLLP+AV ++ H++ I+  LF GWGSFGI+TFYYF FQ
Sbjct: 307 LLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQ 366

Query: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420
           LN+R YS VW+GGT+F+F+I+G +AA  V + IKKV P++ LF S + F  GSI+ SVTP
Sbjct: 367 LNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTP 426

Query: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480
           VH+TY+R   G  IIL FGMD  FPASSII SD LPM+YQGMA SLVNT+VNYS SLCLG
Sbjct: 427 VHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLG 486

Query: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAK 533
           MG TVE  ++  G  +LKGYR A Y G+G+A L   I+ L +   I     AK
Sbjct: 487 MGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAK 539

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/503 (54%), Positives = 369/503 (73%), Gaps = 6/503 (1%)

Query: 36  NEETVTISTDHGEEMTVDK-----QRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQT 90
           N+E + +S+   + ++ D        WQN  YF++   EY FIFTCM + LLNQAG TQ 
Sbjct: 3   NKEPI-VSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61

Query: 91  LSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           LS MN+I+ SF S+  ++TWLMASFPLVSGSFILISGR+GDIYGLKK +  GY+ +IIW+
Sbjct: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121

Query: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210
           L+CG   Y+ SDTFFI+ RAFQGLGI+F+LPN++G++GNIY  GT RKNIVISL+G  AP
Sbjct: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181

Query: 211 VGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIG 270
            GA +G L+ GLI T++ +QWPW FYAY + + +NL +++YS+P N+PTN+ +F+MDW+G
Sbjct: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241

Query: 271 SALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVL 330
           + +GV+GL+L NFVWNQ P++GW + Y                 YE +F  SPLLPR V 
Sbjct: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVT 301

Query: 331 KDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVG 390
           K+  ++ I+  LF GWGSFGI+TFYY+ FQLN+R+YS +WAG T+FMF+IWG IAA +VG
Sbjct: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361

Query: 391 IYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSII 450
             I +V P+V LF S + F +GS+M SVTP+H+TY+R  +G  IILSFGMD SFPASSII
Sbjct: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421

Query: 451 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGL 510
            SD+LPM+YQGMAGSLVNT++NYS SLCLGMG TVE  ++  G+ +L+GYR A YL +GL
Sbjct: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGL 481

Query: 511 ASLACIISGLYMVERIIKDHKAK 533
             L   ++ L +   + +  K++
Sbjct: 482 GGLGACVAFLNLCYDLWRKRKSR 504

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/527 (55%), Positives = 373/527 (70%), Gaps = 6/527 (1%)

Query: 15  DSFEAENESVSAVKKSSRHD----GNEETVTISTDHGEEMTVDKQR--WQNPNYFKNSWH 68
           D        V+A+K S  ++     + E   ++T+    + V++    WQ+PNYFK  W 
Sbjct: 3   DRAAVNGGQVTALKSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWD 62

Query: 69  EYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGR 128
           E LF+ +CM+ QLLNQAG+T TLS M ++     S+    +WLMASFPLVSGSFILISGR
Sbjct: 63  EVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGR 122

Query: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 188
           LGDIYGLKKML +GY+ + IWSLICGL+ +S +DTFFI SRAFQGLGI+FVLPN+LGI+G
Sbjct: 123 LGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVG 182

Query: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLAL 248
           NIY  GT RKNIVISL+G  AP+GAT G LFAG++  +    WPWAFYAYTI + +   +
Sbjct: 183 NIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTII 242

Query: 249 SVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXX 308
           S + IPN+IP N+  F+MDWIGSALGV GLVL NFVWNQ+ + GW   Y           
Sbjct: 243 SYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFL 302

Query: 309 XXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368
                 +E ++AK PLLP+ V + R +I I+ +L  GWGSFGI+ FYYFQF L +R+YS 
Sbjct: 303 IALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSP 362

Query: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428
           VWAGGT+FM  I G IAAL VG  IK+V P+V LF SM+AF  GSI+ SVTPVHETYFR+
Sbjct: 363 VWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRS 422

Query: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488
            LG M+ILSFGMD SFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E  
Sbjct: 423 CLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQ 482

Query: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535
           ++  G  +L+G+R A Y  IG+ SL  +ISG++++++ +   K++  
Sbjct: 483 INKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQKELMRSKSRKE 529

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/502 (57%), Positives = 370/502 (73%)

Query: 36  NEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMN 95
           +EE  T+++ +      +   WQ+P YF +   E +FI TCM++QLLNQAG T  L IMN
Sbjct: 36  DEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMN 95

Query: 96  IIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGL 155
           +++ SF S  N++ WLMASFPL +GSFILISGRLGDIYGLKKML IGYV+IIIWS+I GL
Sbjct: 96  VLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGL 155

Query: 156 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATL 215
           +KYS SD FFI  RAFQGLGIAF+LPN++G++G++Y  G+ RKN+VIS++GA AP G   
Sbjct: 156 SKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMF 215

Query: 216 GCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGV 275
           G +F GLI T++P+QWPW FYA++I + I+L ++ YSIPNN+PTN+   SMDW GS L V
Sbjct: 216 GGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAV 275

Query: 276 IGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHM 335
           +GL+L NFVWNQAPI+GW +AY                 YE ++A+ PLLP AV K+RHM
Sbjct: 276 LGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHM 335

Query: 336 IQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKK 395
           I I+LA+F GWGSFGI+TFYY  FQLN+RHYS VW GGTYF+F+I+G IAA  V   IK+
Sbjct: 336 IMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKR 395

Query: 396 VSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNL 455
           + P++ L  ++MAF+ GSIM SV PV ++Y++       IL FGMD SFPASSII SD L
Sbjct: 396 LGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGL 455

Query: 456 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLAC 515
           PM+YQGMAGSLVNTV+NYS SLCLGMG TVE  ++  G+++LKGYR A YLGIGLASL  
Sbjct: 456 PMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGL 515

Query: 516 IISGLYMVERIIKDHKAKARGR 537
           +IS  YM+E     HK   + R
Sbjct: 516 LISVTYMLENFWNKHKESEKKR 537

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/545 (55%), Positives = 397/545 (72%), Gaps = 10/545 (1%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHD---GNEETVTISTDHGEEMTVDKQR-- 56
           +EK+  KS ++  D    ++ +    ++ S  D    N + +++ T  G   +VD     
Sbjct: 11  SEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDECQSNSDQLSV-TSKGCICSVDDCHEN 69

Query: 57  ---WQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMA 113
              +QNP YF+  + E +FI +CM++QLLNQAG TQ+LS MN++A+ F SN + + WLMA
Sbjct: 70  DSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMA 129

Query: 114 SFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQG 173
           SFPLVSGSFILISGRLGDIYGLKK L++GY+++ +WS+ICGL KY+ SD FFI+ R+FQG
Sbjct: 130 SFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQG 189

Query: 174 LGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPW 233
           LGIAF+LPN++G++GNIY  GT RKNIVIS +G MAP GA LG LF GLI T++ +QWPW
Sbjct: 190 LGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPW 249

Query: 234 AFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGW 293
            FYA+ I S +N+ L++YSIPNN+PTN+ + +MDWIGS LGV GL+L+N VWNQAPI GW
Sbjct: 250 VFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGW 309

Query: 294 DQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFT 353
            +AY                 YE ++A SPLLP +VL+++ ++ I+ ALFFGWGSFGI+T
Sbjct: 310 GEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWT 369

Query: 354 FYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGS 413
           +YY+ FQLN+R Y+ +WAGGT+FMF+IWG +AA +V + IKKV P+V L  SM+AF+ GS
Sbjct: 370 YYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGS 429

Query: 414 IMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNY 473
           IM SVTPVH+TY+R  +G  IILSFGMD SFPASSII SD LPM+YQGMAGSLVNTVVNY
Sbjct: 430 IMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNY 489

Query: 474 SMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERII-KDHKA 532
           S SLCLGMG TVE   +  G  +LKGYR A YL IGLAS    +S +++V  II K H+ 
Sbjct: 490 STSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRK 549

Query: 533 KARGR 537
           +    
Sbjct: 550 RIESE 554

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/504 (55%), Positives = 359/504 (71%), Gaps = 1/504 (0%)

Query: 21  NESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQ 80
           N   + V K          V  + +  + +   + R QNP+YF   W EYLF+ + M+SQ
Sbjct: 2   NSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQ 61

Query: 81  LLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLT 140
           LLNQA   Q   + ++++    +  + + WLMASFPLVSGSFIL+SG++GDIYGLKK L 
Sbjct: 62  LLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121

Query: 141 IGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNI 200
            GY V++IWSLICGL+ Y+ +  FFI++R+FQGLGIAFVLPNV GI+GNIY   T  KN+
Sbjct: 122 GGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM 181

Query: 201 VISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTN 260
           V S++GA AP+GATLGCLF+GLIGT++ + W W FYAYTI + +N  ++ Y IP+NIPTN
Sbjct: 182 VFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240

Query: 261 IQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFA 320
           +  F MDW+GS LGV GL++ NFVWNQAP  GWD AY                 +E RFA
Sbjct: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFA 300

Query: 321 KSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLI 380
           K PLLPRAVL +R ++ I+ +LF GWGSFGI+T+YY  F LN+RHY+ +WAGG+YFMF I
Sbjct: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360

Query: 381 WGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGM 440
           +G IAA LVG  I K  P++ L  S++AF++G IM SVTPV +TYFR  LGTM+ILSFGM
Sbjct: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420

Query: 441 DFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGY 500
           D SFPASSII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E  V+ DG  +LKGY
Sbjct: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480

Query: 501 RGAQYLGIGLASLACIISGLYMVE 524
           R A Y+GIGLAS+   +SG Y +E
Sbjct: 481 RAALYVGIGLASVGIFVSGAYAIE 504

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/519 (53%), Positives = 368/519 (70%), Gaps = 3/519 (0%)

Query: 12  SRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYL 71
           + +D    E +S+  +   S  + +  T  +STD  +    +   +QNP+YFKN + E+ 
Sbjct: 20  NNEDCKNPEQQSLKNIDSRSSLN-SSLTQVLSTDTADN--DESSSYQNPDYFKNKYQEFG 76

Query: 72  FIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGD 131
           FIF+ MI QLL+QAG TQTLSIMN++A    S  + + WLM+SFPL  GSFIL+SGRLGD
Sbjct: 77  FIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGD 136

Query: 132 IYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIY 191
           IYGLKK+L  GY++  +WS+ICGL+ Y+ +D FFI +RAFQGLG+AF LPN++G+IG IY
Sbjct: 137 IYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIY 196

Query: 192 VSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVY 251
             G FRKN++IS++GAM+P GATLG LFAGL    +   WPW+FYA+ + S +NL +S Y
Sbjct: 197 RPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWY 256

Query: 252 SIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXX 311
            IPN+IPTNI    MDW+GS LGV GL+++NFV+NQAPI GW  AY              
Sbjct: 257 CIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVI 316

Query: 312 XXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWA 371
              YE ++AK+PL+P+A+  +R M+ I+ +LF GWGSFGI+TFYYF F+LN+RHYS +WA
Sbjct: 317 FVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWA 376

Query: 372 GGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLG 431
           G +YF+F+I G   A++ G+ IKK+ PSV    SMM F  G+I+ + TPV++T+FR  LG
Sbjct: 377 GSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLG 436

Query: 432 TMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDP 491
            M +L  GMDFSFPASSII SD+LPM+YQGMAGSLVNTV+NYS S+CLGM  TVE   + 
Sbjct: 437 CMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNS 496

Query: 492 DGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDH 530
            GK +L GYR A Y  IGLA LA  +SG YM+E + KD 
Sbjct: 497 HGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/521 (53%), Positives = 374/521 (71%), Gaps = 3/521 (0%)

Query: 10  AESRQDSFE-AENESVSAVKKSSRHD--GNEETVTISTDHGEEMTVDKQRWQNPNYFKNS 66
           ++ R+D F+  +N S  +   +S ++  G+  +V+  +D   E    + +  +P YFKN 
Sbjct: 36  SKERKDYFQLKKNYSQDSQTNTSMNEVIGSISSVSNDSDINSENLQSENKVLSPKYFKNR 95

Query: 67  WHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILIS 126
            HEYLFI +CM+SQ ++QAG TQ LSIMNI+A    + ++ + WLMASF L  GSFIL+S
Sbjct: 96  THEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVS 155

Query: 127 GRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 186
           GRLGDIYGLKK+L  GY ++ IWSLICG + YS +D FFI SRAFQGLG+AFVLPN LG+
Sbjct: 156 GRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGL 215

Query: 187 IGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINL 246
           IG IY  G+ +KN++I  +GAM+P+GATLG LFAG+IGTK+PKQWPW+FY++ I S  N+
Sbjct: 216 IGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNM 275

Query: 247 ALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXX 306
            LS YSIPNNIPTNI + SMDWIG+ LG+ GL+++NFV+NQAPI GW  AY         
Sbjct: 276 ILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSF 335

Query: 307 XXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHY 366
                   YE ++AK+PL+P+A+  +R M+ I+ ALF GWG+FG +TFYYF F LN+R Y
Sbjct: 336 CALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGY 395

Query: 367 SAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYF 426
           +A WAGG+YF+F++ G   A L G  +KKV PSV L++SM+ F  G +M +VTP+H++YF
Sbjct: 396 TAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYF 455

Query: 427 RTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 486
           +  LG M +L  G+D SFPA+SII SD LP++YQGMAGSLV T+ NYS S+CLGM  +VE
Sbjct: 456 QNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVE 515

Query: 487 THVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERII 527
            + + +G+++LKGYR A      LA L  I+SG+YMV  +I
Sbjct: 516 AYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLI 556

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/524 (56%), Positives = 380/524 (72%), Gaps = 12/524 (2%)

Query: 10  AESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHE 69
           AESR  S +   +S  ++ KSS    NE+         E +  +K +WQ+P YFKNS+ E
Sbjct: 2   AESRTSSIKEHIQSDISIDKSS----NEKC--------EVIVREKSKWQDPGYFKNSFQE 49

Query: 70  YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRL 129
           YLF+ +CM +QLLNQA T QTLSIMN++++SF S+ +++TWL+ASFPLV+GSFILISGR+
Sbjct: 50  YLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRI 109

Query: 130 GDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 189
           GDIYGLKK L  GY+ +IIWSLICG T YS SDTF II+RAFQGLGIAF LPNV+G IGN
Sbjct: 110 GDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGN 169

Query: 190 IYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALS 249
           IY  G+ RKN+VISL+ A APVGA +G  FAGLI T++P QWPW+FYA+ I    NL +S
Sbjct: 170 IYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLIS 229

Query: 250 VYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXX 309
           +YSIP+NIPTN+  F MDWIGSAL V GL+L NF WNQ PI GWD AY            
Sbjct: 230 IYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFI 289

Query: 310 XXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAV 369
                YE  FA SPL+ R +   R+MI  +  LF GWGS+GI++FYYF F LN+RHYS V
Sbjct: 290 LAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPV 349

Query: 370 WAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQ 429
           WAGG+YF+F I+G++A+  VGI IKK++  V L  SM+ F +G+ + SV PV ++YF+  
Sbjct: 350 WAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLT 409

Query: 430 LGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHV 489
           L  M IL  G+D SFPA++II SD LPMEYQGMAGSL  T+VNYSMSLCLGMG TVE  +
Sbjct: 410 LAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQI 469

Query: 490 DPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAK 533
           + DG+ VLKGYR A+YLGIGL+ L  +++ + ++++++  ++ K
Sbjct: 470 NKDGQDVLKGYRSAEYLGIGLSGLGLLLACILVIDKLVAKYRNK 513

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/527 (51%), Positives = 362/527 (68%), Gaps = 8/527 (1%)

Query: 13  RQDSFEAENESVSAVKKSSRHDGNEETVTISTDH----GEEMTVDKQRWQNPNYFKNSWH 68
           R DS +++N   S V  S + D +E+ V   ++                Q P YF +  H
Sbjct: 21  RSDS-DSDN---STVNSSQKIDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLH 76

Query: 69  EYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGR 128
           E+ FIFTC++ QLLNQAGTTQ++SIMNIIA  FGS  + + WL ASFPLVSGSFIL+ GR
Sbjct: 77  EWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGR 136

Query: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 188
            GDIYGLKKML +GY ++ IWS+ICGLT Y+ SD FFI+++AFQGLG++F+LPN++G++G
Sbjct: 137 FGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVG 196

Query: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLAL 248
            IY  G+ +KNI IS +GAMAP+GAT G LF+G++  K+ K WPW FYA+ I S +    
Sbjct: 197 TIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVT 256

Query: 249 SVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXX 308
             + +P+N+PTN  +  MDWIGSA+GV+GL+L +FVWNQAP+ GWD+AY           
Sbjct: 257 CYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVIL 316

Query: 309 XXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSA 368
                 YE  +A+ PLLP+A+  +RH+I I+LA+F GWG+FGI++FYYF F LN+RH+S 
Sbjct: 317 IIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSP 376

Query: 369 VWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRT 428
           VW GG YF F++ G   A  VG  IK + PS+ L +S+  F +G+++ +VTP  +TY+R 
Sbjct: 377 VWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRN 436

Query: 429 QLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETH 488
             G M++L  GMD SFPASSII SD LP EYQGMAGSLVNT+VNYS S CLG+  TVE  
Sbjct: 437 TFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQ 496

Query: 489 VDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535
           ++  G  +LKGYR A Y G+G+ +L   I+ LYM E    D+K K +
Sbjct: 497 INSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/536 (52%), Positives = 364/536 (67%), Gaps = 1/536 (0%)

Query: 3   EKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTIS-TDHGEEMTVDKQRWQNPN 61
            K L +  E +    + +  +V+A         + +   IS TD       +  +WQ+P 
Sbjct: 6   RKKLKQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPT 65

Query: 62  YFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGS 121
           YFK+SW EY FI TCM++ LLNQAG TQTLS MN++A+S  S+  ++TWLMASF L SGS
Sbjct: 66  YFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGS 125

Query: 122 FILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLP 181
           FIL+SGR+GDIYGLK     G ++  IWS++CG++KY+ + TFFII RAFQGLG+AFVLP
Sbjct: 126 FILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLP 185

Query: 182 NVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTIT 241
           NV+G++GNIY  G+ RKNIVIS +G MAPVG T G ++ GLI   N  QWPW F+A  I 
Sbjct: 186 NVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIA 245

Query: 242 SIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXX 301
             INL + +YSIPN++PTNI +  MDWIGS LGVIGL+LMNFVWNQAPISGW +AY    
Sbjct: 246 VFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVI 305

Query: 302 XXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL 361
                        YE + A+SPLLP  V K+RH++ I+++LF GWG+FGI+TFYY+ F L
Sbjct: 306 LIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNL 365

Query: 362 NIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPV 421
           N+RH+S +WAG T+F+F+I+G + A+ V   I KV PSV   LS + F  G+I+ SVT  
Sbjct: 366 NLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSP 425

Query: 422 HETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 481
            +TY+R  LG  IIL+ GMD SFP SSII SD LPM+YQGM+GSLVNT+ NY+ SLCLGM
Sbjct: 426 DQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGM 485

Query: 482 GATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
           G T E   +  GK VLKGYR A Y+ IGL +L    S  YM E +   ++ + +  
Sbjct: 486 GTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNE 541

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  467 bits (1202), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 219/499 (43%), Positives = 321/499 (64%)

Query: 37  EETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNI 96
           E +++ +    +    + Q  + P+ FKN + E+ F+   +I Q L+Q G TQ LS MNI
Sbjct: 90  ESSLSATPPDNKPFITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNI 149

Query: 97  IANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156
           +A    + +  + WLMA+FPL  G  ILISGRLGDI+GLKK+L +GY++  IW+LICG +
Sbjct: 150 LAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFS 209

Query: 157 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLG 216
            Y+ SD  FI+SR FQGLG+A  LPN+  +IG IY    F+KN++  ++GAM+P+GATLG
Sbjct: 210 SYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLG 269

Query: 217 CLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVI 276
            +FAGL    N K WPW+FY++ I + +N  ++ + IPN+I  N Q   MDWIGSALG+ 
Sbjct: 270 GIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLF 329

Query: 277 GLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMI 336
           GLV++NFV+NQ PI GW  AY                 YE   A  PL+P+ +  +  +I
Sbjct: 330 GLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLI 389

Query: 337 QIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKV 396
            I+L LF GWG F I+TFYYF FQLN+RHYS +WA  + F+ +I G I  ++  + ++++
Sbjct: 390 LILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRM 449

Query: 397 SPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLP 456
            P + LF SM+ F  G+I+ +VTP+H+T+FR   G+M +   GM FSFP++S++ ++ LP
Sbjct: 450 KPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLP 509

Query: 457 MEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACI 516
             Y+ MAGSLVN  +NY+ S+C+GM  +   + +  G+ +L G+R A YL IGL+  +  
Sbjct: 510 THYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVF 569

Query: 517 ISGLYMVERIIKDHKAKAR 535
           +SGLYM+  I  D   K +
Sbjct: 570 LSGLYMIGSIWTDRNQKMK 588

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  332 bits (852), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/516 (37%), Positives = 288/516 (55%), Gaps = 18/516 (3%)

Query: 23  SVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLL 82
           ++S+       D N ET+       +E+  D+   Q        W E  F+     +QL+
Sbjct: 2   TLSSPVTEENLDMNVETL----KKDDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLM 56

Query: 83  NQAGTTQTLSIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTI 141
            QAG  Q+L+ ++II +SFG+ N    +W  +++ L  G+FILI+GRLGDI+G KK   +
Sbjct: 57  TQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 116

Query: 142 GYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIV 201
           G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V
Sbjct: 117 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMV 174

Query: 202 ISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTN- 260
            SL GA AP G  LG +F+ ++G      WPWA++   I   +      Y IP+    N 
Sbjct: 175 FSLFGASAPGGFVLGAVFSSMLGQL--AWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNR 232

Query: 261 -IQHFSM----DWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXY 315
            +  F +    D+ GS  GV+GL+L NF WNQ P+ GW   Y                  
Sbjct: 233 DVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFI 292

Query: 316 ENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTY 375
           E+R A  PLLP A L       ++  +  GW SFGI+ FY +QF  + R  + + +   +
Sbjct: 293 ESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQF 350

Query: 376 FMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMII 435
               I G  AAL+ G  +    PS  +F +M AF +G+I+ +  PVH+TY+     ++I+
Sbjct: 351 SPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIV 410

Query: 436 LSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKH 495
           + +GMD SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E++V+  G +
Sbjct: 411 MPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAN 470

Query: 496 VLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531
           VLKGYR + YLGIGL+     ++  Y V   +K  K
Sbjct: 471 VLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSKK 506

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/508 (37%), Positives = 286/508 (56%), Gaps = 18/508 (3%)

Query: 32  RHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTL 91
           + D +  T T+  D  +E+ +D+   Q+       W E  F+     +QL+ QAG  Q+L
Sbjct: 9   QKDFDTNTGTLKKD--DEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSL 65

Query: 92  SIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           + ++II  SFG+ N    +W  +++ L  G+FILI+GRLGDI+G KK   +G+    +WS
Sbjct: 66  APLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWS 125

Query: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210
           L+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y SG  RKN+V SL GA AP
Sbjct: 126 LLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAP 183

Query: 211 VGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFS----- 265
            G  LG +F+ L+G      WPWA++   I     LA++ Y I  +     +H S     
Sbjct: 184 GGFVLGAVFSSLLG--QLAWWPWAYWIMGIACFF-LAIAGYFIIPHTAMPSRHASSFKLL 240

Query: 266 --MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSP 323
             +D+ GS  GVIGL+L NF WNQ P+ GW   Y                  E+R A  P
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFP 299

Query: 324 LLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGI 383
           LLP A L       ++  +  GW SFGI+ FY +QF  + R  + + +   +    + G 
Sbjct: 300 LLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGF 358

Query: 384 IAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFS 443
            AAL  G  + +  PS  +  +M AF  G+I+ +  PVH+TY+     ++I++ +GMD S
Sbjct: 359 CAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 418

Query: 444 FPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGA 503
           FPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E++V+  G   LKGYR +
Sbjct: 419 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCS 478

Query: 504 QYLGIGLASLACIISGLYMVERIIKDHK 531
            Y+GIGL+ L   ++ +Y      K  K
Sbjct: 479 WYMGIGLSGLGIFVAAIYAWSTFKKSKK 506

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  325 bits (833), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/517 (36%), Positives = 289/517 (55%), Gaps = 14/517 (2%)

Query: 28  KKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGT 87
           ++ S    N ET   +T   +E+ +++   Q+       W E  F+     +QL+ QAG 
Sbjct: 3   RRPSVTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGL 61

Query: 88  TQTLSIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVI 146
            Q+++ ++II +SFG+ N    +W  +S+ L  G+FILI+GRLGDI+G +K   +G+   
Sbjct: 62  GQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWY 121

Query: 147 IIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVG 206
            +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V SL G
Sbjct: 122 ALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFG 179

Query: 207 AMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPN-NIPT-NIQHF 264
           A AP G  LG +F+ ++G      WPWA++   I   +      + IP+  +P+ +   F
Sbjct: 180 ASAPGGFVLGAVFSSMLGQL--AWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSF 237

Query: 265 SM----DWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFA 320
           +M    D+ GS  GVIGL+L NF WNQ P+ GW+  Y                  E+R A
Sbjct: 238 NMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-A 296

Query: 321 KSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLI 380
             PLLP A L       ++  +  GW SFGI+ FY +QF    R  S + +   +    I
Sbjct: 297 AYPLLPFAALSSDAAF-VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAI 355

Query: 381 WGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGM 440
            G  AA+  G  +     S  +  +M AF +G I+ +  PVH+TY+     ++I++ +GM
Sbjct: 356 SGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGM 415

Query: 441 DFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGY 500
           D SFPA++I+ S+++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ V+  G + LKGY
Sbjct: 416 DMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGY 475

Query: 501 RGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
           R + Y+GIGL+ L   ++ +Y     +K  K  +  +
Sbjct: 476 RCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQ 512

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 191/517 (36%), Positives = 284/517 (54%), Gaps = 21/517 (4%)

Query: 23  SVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLL 82
           S S+       D N E +        E  +  +R   P   K+   E  F+     +QL+
Sbjct: 2   STSSSVTQKNLDTNAEALKKEDKVLSEFDIQDER---P---KSLLWESAFVGVLCSAQLM 55

Query: 83  NQAGTTQTLSIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTI 141
            QAG  Q+L+ ++II NSFG+ N    +W  +++ L  G+FILI+GRLGDI+G KK   +
Sbjct: 56  TQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVL 115

Query: 142 GYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIV 201
           G+    +WSL+ G + YS +  FF   RAFQG+G AF+LPN + I+G  Y  G  RKN+V
Sbjct: 116 GFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMV 173

Query: 202 ISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNI 261
            SL GA AP G  LG +F+ ++G      WPWA++   I   + LA++ Y +  + P   
Sbjct: 174 FSLFGASAPGGFFLGAVFSSMLG--QLAWWPWAYWIMGIACFV-LAVAGYFVIPHTPMPS 230

Query: 262 QHFS-------MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXX 314
           +  S       +D+ GS  GV+GL+L NF WNQ P+ GW   Y                 
Sbjct: 231 RDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAY 290

Query: 315 YENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGT 374
            E+R A  PLLP A L       ++  +  GW SFGI+ FY +QF  + R  + + +   
Sbjct: 291 IESR-AAFPLLPFAALSSDTAF-VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQ 348

Query: 375 YFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMI 434
           +    I G  AA+  G  +    PS  +  +M AF +G+I+ +  PVH+TY+     ++I
Sbjct: 349 FSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSII 408

Query: 435 ILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGK 494
           ++ +GMD SFPA++I+ SD++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+ V+  G 
Sbjct: 409 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGA 468

Query: 495 HVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531
             LKGYR + Y+GIGL+ L   ++  Y     +K  K
Sbjct: 469 KPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKSKK 505

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/511 (36%), Positives = 283/511 (55%), Gaps = 16/511 (3%)

Query: 28  KKSSRHDGNEETVTISTDHGEEMTVDKQRW-QNPNYFKNSWHEYLFIFTCMISQLLNQAG 86
           K+ ++   +  T   + D G+E++       Q P        E  F+     +QL+ QAG
Sbjct: 6   KEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLG---EAAFVGVICGAQLMTQAG 62

Query: 87  TTQTLSIMNIIANSFGS-NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVV 145
             Q+++ ++II +SFG+ N    +W  A++ L  G+FILI+GRLGD+YG KK   IG+  
Sbjct: 63  LGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFW 122

Query: 146 IIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLV 205
             +WSL+ G + YS +  FF   RAFQG+G A +LPN + I+G  YV G  RK +++SL 
Sbjct: 123 YALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLF 180

Query: 206 GAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPN----NIPTNI 261
           GA AP G  LG +F+ + G      WPWA++A  I         +  IP      + T++
Sbjct: 181 GATAPAGFVLGAVFSSIFGQLT--WWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSV 238

Query: 262 QHFS-MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFA 320
             +  +D  GS  GVIGLVL+NF WNQ P+ GW   Y                  E+R A
Sbjct: 239 STYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-A 297

Query: 321 KSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLI 380
             PLLP + L       ++  +  GW SFGI+ +Y++ F   +R +S +     +    I
Sbjct: 298 PHPLLPLSALSSDAAF-VLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAI 356

Query: 381 WGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGM 440
            G+ AAL  G  I +V  S+ +  +M AF +G I+ +  PV + Y+     ++I++ +GM
Sbjct: 357 SGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGM 416

Query: 441 DFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGY 500
           D SFPA++I+ SD++P E+QG+A SLVN VVNYS+S+ LG+  TVE  V+  G ++LKGY
Sbjct: 417 DMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGY 476

Query: 501 RGAQYLGIGLASLACIISGLYMVERIIKDHK 531
           RGA Y+GIGL+    +I+ +Y      K  K
Sbjct: 477 RGAWYMGIGLSGFGILIAFMYEYHTFKKSKK 507

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  322 bits (826), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/510 (36%), Positives = 284/510 (55%), Gaps = 26/510 (5%)

Query: 18  EAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCM 77
           +AE ES+ A           + V +  + GE + + +   + P        E LF+    
Sbjct: 2   DAELESLEA-----------QFVELKNEEGESLQLVQSHVEKPQSLM---REALFVGILS 47

Query: 78  ISQLLNQAGTTQTLSIMNIIANSFG-SNENSRTWLMASFPLVSGSFILISGRLGDIYGLK 136
            +QL+ QAG  Q+++ + II NSFG SN    +W  A++ L  G+FILI+GRLGD++G K
Sbjct: 48  CAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHK 107

Query: 137 KMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTF 196
           K+  +G++   +WSL+ G + YS +  FF   RA QG+G AF+LPN + I+G  Y  G  
Sbjct: 108 KLFVVGFLWYSLWSLLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK- 165

Query: 197 RKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNN 256
           RK +V S+ GA AP G  LG +F+ +        WPWA++A     ++     +  IP  
Sbjct: 166 RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQA 223

Query: 257 IPTNIQHFS-----MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXX 311
            P  I   +     +D  G+  G++GL L+NF WNQ P+ GW   Y              
Sbjct: 224 PPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLV 283

Query: 312 XXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWA 371
               E+R A+ PLLP A L    +  ++  +  GW SFGI+ FY++QF  + R  S +  
Sbjct: 284 FSLIESR-ARFPLLPFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLT 341

Query: 372 GGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLG 431
              +    I G+ AAL  G  +  V     + ++M+AF +G ++ +  P+++TY+     
Sbjct: 342 SAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFV 401

Query: 432 TMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDP 491
           ++II+ +GMD SFPA++I+ S+ +P E+QG+A SLVNTVVNYS+SL LG   T+ET V+ 
Sbjct: 402 SLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNN 461

Query: 492 DGKHVLKGYRGAQYLGIGLASLACIISGLY 521
            G + L+GYRGA Y+GIGL+ L  +++ +Y
Sbjct: 462 KGANRLEGYRGAWYMGIGLSGLGVLVAIVY 491

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  298 bits (763), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 168/507 (33%), Positives = 291/507 (57%), Gaps = 14/507 (2%)

Query: 34  DGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSI 93
           +  E +++ + +  +E   D+  W   + F     EY F+FT +++Q  NQAG T  L +
Sbjct: 16  ECTERSISCNQESSKE-AYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPL 74

Query: 94  MNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLIC 153
           +N++++SF        +L+ S+P+V GSF+LI GRLG+++G K+ L  GY+++I+ SL+ 
Sbjct: 75  VNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLLG 129

Query: 154 GLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS--GTFRKNIVISLVGAMAPV 211
           GL++YS S  F++I RAFQG+G+A +LPN        Y S     RK I+ +++G  A  
Sbjct: 130 GLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGAST 189

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHF--SMDWI 269
           GA LG   +G+  T++   W WA+Y YTI + + LALS YS+P+NI    +     + W 
Sbjct: 190 GAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNGLGWF 249

Query: 270 GSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAV 329
            +     GL+++N   N A ++  + ++                 +E +F++ P+  + +
Sbjct: 250 SNR--SCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKEL 307

Query: 330 LKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLV 389
             +  +  ++ ++FFGWG++GI++ Y+F+F LN+R+YS + AG TY   +I G +A + +
Sbjct: 308 FTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGI 367

Query: 390 GIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSI 449
            + +K+  P +FL  S + F    I+ SVTP+H++YFR+ LG+MI L+ G+DFSFP+S+I
Sbjct: 368 SMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAI 427

Query: 450 IFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYLGIG 509
           I  + LP +Y  M   L N + NY++S   G+  +    +      ++K YR   Y  IG
Sbjct: 428 ILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSSI--ELIKYYRYVYYFAIG 485

Query: 510 LASLACIISGLYMVERIIKDHKAKARG 536
           L+++    +G+ +    I  ++ K  G
Sbjct: 486 LSAIGLFAAGIQLARASIMYYRGKYTG 512

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  296 bits (759), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 170/469 (36%), Positives = 258/469 (55%), Gaps = 17/469 (3%)

Query: 45  DHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFG-S 103
            H E+   D    QN   + +   E   I     +QL+ QAG  Q++  + II +SFG  
Sbjct: 8   SHEEQ---DSLLLQNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIK 64

Query: 104 NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDT 163
           N    +W  ++F L  G+FILI+GRLGD +G KK   +G++   +WS++ G + YS +  
Sbjct: 65  NPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQI 123

Query: 164 FFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLI 223
           FF   RAFQG+G AF LPN + II   Y  G  ++N++ SL GA AP G  +G +F+ L+
Sbjct: 124 FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL 182

Query: 224 GTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFS-----MDWIGSALGVIGL 278
                  WPWA++   IT  +        IP++ P +          +D  GS  GV+GL
Sbjct: 183 --SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGL 240

Query: 279 VLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLP-RAVLKDRHMIQ 337
           +L NF WNQ P+ GW+ +Y                  E+R AK PLLP R +  D   I 
Sbjct: 241 ILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLPVRKLSSDT--IF 297

Query: 338 IMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVS 397
           +M  +  GW SFGI+ +Y +Q   N+R    + +   +    I G+ AA+     + + S
Sbjct: 298 VMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTS 357

Query: 398 PSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPM 457
           PS  + ++M+AF +GSI+ +  PV +TY+     ++I++ +GMD SFPA++II S  +P 
Sbjct: 358 PSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPA 417

Query: 458 EYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGYRGAQYL 506
            +QG+A SLVNT++NYS+S+ LG   T+E+ +      +LKGYRGA Y+
Sbjct: 418 SHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  229 bits (584), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 158/540 (29%), Positives = 264/540 (48%), Gaps = 33/540 (6%)

Query: 8   KSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSW 67
            S+++R+DS    +++VS + KS+     EE     T  GEE T++              
Sbjct: 35  DSSKTRRDS----DDNVSDINKSA--PAPEEHDPPCT--GEEATLNMSLL---------- 76

Query: 68  HEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRT-WLMASFPLVSGSFILIS 126
           HE +F+     SQ+L  AG  Q +  M++I   F     S + W    +    GSF+LI+
Sbjct: 77  HEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIA 136

Query: 127 GRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 186
           G++GD+ G K M  IGY  + +WSL+ G ++Y  S  FF   RA QG+G AF   + L I
Sbjct: 137 GKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSI 196

Query: 187 IGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINL 246
           +G  Y     RKN + S  GA    G  LG +F+ L        W WA+++  I  ++ +
Sbjct: 197 LGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALF--TQLAHWSWAYWSMAIACVVII 253

Query: 247 ALSVYSIPNNIPTNIQH---FSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXX 303
            LS++ IP ++    +    F  D++G+ L V GLVL +  WNQAP  G+ + Y      
Sbjct: 254 ILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLI 313

Query: 304 XXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNI 363
                       E +    PLLP   +   + ++++LA+FF + SF ++  Y F+F L  
Sbjct: 314 VSVVILALAMYVETK-VDDPLLPWTHIS-ANTLKVLLAIFFAYASFTMWAAYTFRFNLMA 371

Query: 364 RHYSAVWAGGTYFMFLIWGIIAALLVGIYIK-KVSPSVFLFLSMMAFNIGSIMASVTPVH 422
           +  + + A        + G+ AAL   + +   V   + + +S++AF +  I+ +     
Sbjct: 372 KGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAG 431

Query: 423 ETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMG 482
           +TY+     T I++SFG+D SFP+++++ S+ +P +++G+  SLV  V+NY+ +L     
Sbjct: 432 QTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTA 491

Query: 483 ATVETHVDPD-----GKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKARGR 537
           A+V  +  PD     G    K      Y+GIG A L  +++   ++    K    K   R
Sbjct: 492 ASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGEDR 551

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  184 bits (467), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 127/190 (66%), Gaps = 34/190 (17%)

Query: 77  MISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLK 136
           M+SQLLNQ GTTQTL ++N+++  F S+   +T L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 137 KMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTF 196
             L  GY  +I+WS ICGLT+Y+GS  FF+I+RAFQGLG+AFVLPNV+G + N+Y++G+ 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 197 RKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNN 256
           RKN+V                                  YAYT+   +N+AL V+++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 257 IPTNIQHFSM 266
           IPTN++  +M
Sbjct: 147 IPTNVRGQAM 156

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 6/44 (13%)

Query: 454 NLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVL 497
           N+P   +G A      ++ YSM +CLG+  TVE  V   G   L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  189 bits (480), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 154/541 (28%), Positives = 262/541 (48%), Gaps = 37/541 (6%)

Query: 16  SFEAENESVSAVKKSSRHDGNEET--VTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFI 73
           SF    E+++    SS+   +E T  V +   H E ++   +   N  +      E + +
Sbjct: 2   SFHESEETLT----SSKLQPHEPTSPVKVVPSHNEILSKTDEHPLNMQF-----KEIIIV 52

Query: 74  FTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRT---WLMASFPLVSGSFILISGRLG 130
                 Q ++  G  Q +  M  IA++F    +      W  A++   + +F++I+G+LG
Sbjct: 53  LLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLG 112

Query: 131 DIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDT-FFIISRAFQGLGIAFVLPNVLGIIGN 189
           DI G K M   GY  + +WSL+ G +KY+ ++  FF   R  QG+G AF+ P  L ++G 
Sbjct: 113 DINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGK 172

Query: 190 IYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALS 249
            Y     RKN V S  GA  P G   G +F+ L        W W +++  +T +I   LS
Sbjct: 173 HYPPCK-RKNYVFSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVTCLIITILS 229

Query: 250 VYSIP-NNIPTNIQH--FSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXX 306
              IP +N P   +   +S D++G   G+ G++L + VWNQAP+S +   Y         
Sbjct: 230 YIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSV 289

Query: 307 XXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHY 366
                    ++R  K PL+P   +   ++I+ ++ +FFG+  F I+ FY ++F L  ++ 
Sbjct: 290 VFMTMALIIDSR-VKDPLIPWKSMCS-NVIKALIVVFFGFLGFTIWLFYSWRFYLVAKND 347

Query: 367 SAVWAGGTYFMFLIWGIIAALL-VGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETY 425
           S + A   +    I GI AA   V +  KKV   + L  ++ AF I +I+ S   + ETY
Sbjct: 348 SLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETY 407

Query: 426 FRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 485
           +       +I++ G+D +FP+++++ S+ +  E QG+A +L  T +NY  +L  G+   +
Sbjct: 408 WGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI 467

Query: 486 ETH------VDPDGKHVLKGYRGAQYLGIGLASLACIISGL-----YMVERIIKDHKAKA 534
            T+         DG+ V      A Y+ IG A +A +++       Y  ER + D + K 
Sbjct: 468 ITYQCDDCLARSDGRFV-HAVHIAGYVAIGTAGIAVVVAIFGSITEYYKER-MDDLREKK 525

Query: 535 R 535
           R
Sbjct: 526 R 526

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  171 bits (432), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 128/452 (28%), Positives = 219/452 (48%), Gaps = 23/452 (5%)

Query: 63  FKNSWHEYLFIFTCMIS-QLLNQAGTTQTLSIMNIIANSF---GSNENSRTWLMASFPLV 118
              +W   +F+   +IS QL+   G  Q + I   +   +    +      W  AS+ L 
Sbjct: 31  LPKTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLG 90

Query: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYS-GSDTFFIISRAFQGLGIA 177
           S   +LI+G+LGD+ G K+M+  G++ + IWSLI G + Y  G+  F+  +RA QG+G  
Sbjct: 91  SAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSG 150

Query: 178 FVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYA 237
           F++PN L I+G  Y     +K I+ S+ G M   G  +G  F+ L       +W W ++A
Sbjct: 151 FIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT--KWAWNYWA 208

Query: 238 YTITSIINLALSVYSIPNNIPTNIQHFS--------MDWIGSALGVIGLVLMNFVWNQAP 289
                ++    ++  IP   P NI H           D++G+  GV GLVL +  + QA 
Sbjct: 209 LACVCVLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQAS 265

Query: 290 ISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSF 349
             GW   +                  + R    PL+P   L+   ++ I++ ++FG+ SF
Sbjct: 266 ALGWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLR-ADVVVILICVYFGFLSF 323

Query: 350 GIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIK-KVSPSVFLFLSMMA 408
            I+  +++QF   + + S +          I  I AA+     ++  +     + +SM+ 
Sbjct: 324 VIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVC 383

Query: 409 FNIGSI-MASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLV 467
           F + +I MA+VTP + TY+     + II  F +D + P ++++FSD++  E QG+A SL+
Sbjct: 384 FLVPNILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLI 442

Query: 468 NTVVNYSMSLCLGMGATVETHVDPDGKHVLKG 499
            TV++Y++S+     A V  +V P G     G
Sbjct: 443 ITVISYAISIGPSYTAMVMWYVAPLGNDSTPG 474

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 139/534 (26%), Positives = 244/534 (45%), Gaps = 38/534 (7%)

Query: 14  QDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFI 73
           QD+   ++   S    SS H  ++ T    ++       D+    NP    +   E +FI
Sbjct: 18  QDTGNTDHYLPSNSTASSLH--SQRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFI 75

Query: 74  FTCMISQLLNQAGTTQTLSIMNIIANSF---GSNENSRTWLMASFPLVSGSFILISGRLG 130
                SQ ++ A  +Q +  M+ I   F           W  A+F +  G+FI+ +G+L 
Sbjct: 76  VIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLC 135

Query: 131 DIYGLKKMLTIGYVVIIIWSLICGLTKYS--GSDTFFIISRAFQGLGIAFVLPNVLGIIG 188
           D+ G K +   GY    +WSL+ G+++Y+  G  TFF   R  QG+G A + P+ L ++G
Sbjct: 136 DLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLG 195

Query: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLAL 248
             Y   + +KNIV SL G   P+G  +G +F+ +        W W +++  I S     +
Sbjct: 196 K-YYPPSCKKNIVFSLYGFCVPLGVVVGGVFSAIF--TQLAHWSWNYWSMAIVSAFFTLI 252

Query: 249 SVYSIPNN--IPTNIQ-------HF-SMDWIGSALGVIGLVLMNFVWNQAPISGWD---- 294
           S + IP +  I +  Q       H    D++G+ L V  L+L    WNQA  +G+     
Sbjct: 253 SCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQA--TGFKFKSV 310

Query: 295 QAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTF 354
           Q Y                 +   +   P++P   +  +  I+ +L +FF + SF I+ F
Sbjct: 311 QVYVTLIVSLVCFVAMVIVEF---YVDDPIIPARKIHPQ-TIKALLVVFFSYLSFTIWLF 366

Query: 355 YYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSP-SVFLFLSMMAFNIGS 413
           Y +++   +R+ + +     +    I G IAAL   + I    P  + L     +F +  
Sbjct: 367 YLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAH 426

Query: 414 IMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNY 473
           I+       E+Y+     T+II+S G+D SFP+++++ S+ +P E +G++ +LV T +NY
Sbjct: 427 ILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNY 486

Query: 474 SMSLCLGMGATV------ETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLY 521
              +   +  T+      +     D    +K    A  +GIG + +A ++ GLY
Sbjct: 487 GTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV-GLY 539

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 138/572 (24%), Positives = 258/572 (45%), Gaps = 87/572 (15%)

Query: 39  TVTISTDHGEEMT----VDKQRWQNPNYFKNSW-HEYLFIFTCMISQLLNQAGTTQTLSI 93
           T T+      ++T    +  Q+ Q+P    NS+ ++ +FIF    SQ +  A  +Q +  
Sbjct: 39  TETVQDQQSHKVTHSSLIRLQKLQSPT---NSYLNDIIFIFLICSSQFITLASASQAILQ 95

Query: 94  MNIIANSFGSNENSRT---WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           M+ ++  F     S     W+ ASF +  G+FI+++G+L DI   + +   GYV   +W+
Sbjct: 96  MDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWT 155

Query: 151 LICGLTKYSGSDTFFI-ISRAFQGLGIAFVLPNVLGIIGNIYV----------------- 192
           LI G   Y   +  F+ I R  QG+G A + P+ L ++   Y                  
Sbjct: 156 LITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTS 215

Query: 193 ----SGTFRKN-------------------------IVISLVGAMAPVGATLGCLFAGLI 223
               S    KN                         I  SL GA AP+G  +G +F+ + 
Sbjct: 216 APSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF 275

Query: 224 GTKNPKQWPWAFYAYTIT----SIINLALSVYSIP----NNIPTNIQHF-SMDWIGSALG 274
                  WPW +++ +I     SI++    V  IP    ++ P +++++ + D++G  LG
Sbjct: 276 --TQLATWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILG 333

Query: 275 VIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRH 334
           +  L+L    W+QA +  +   +                 +E  F  +P++P   ++  H
Sbjct: 334 ISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYF-NNPIIP---IRQIH 389

Query: 335 --MIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGIIAALL-VGI 391
              I+ +L +FF + SF  + FY ++    ++  S +     +    + GII+A   + +
Sbjct: 390 PGTIKALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILL 449

Query: 392 YIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSIIF 451
            +K+V   + L     +F +  I+     +  +Y+  Q  ++I +S G+D SFP+++++ 
Sbjct: 450 IVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLL 509

Query: 452 SDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV------ETHVDP-DGKHVLKGYRGAQ 504
           ++ +P E QG+  +LV +V+NY  ++   +  T+          DP D K  LKG   A 
Sbjct: 510 TNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAG 569

Query: 505 YLGIGLASLACIISGLYMVERIIKDHKAKARG 536
            +G+G + +A +I G+Y     I ++  K +G
Sbjct: 570 AVGVGCSGIAVLI-GIY---GTITEYSWKTKG 597

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 4/133 (3%)

Query: 51  TVDKQRWQNPNYFKN-SWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRT 109
           T+ K R    + F+N S+H Y+ +   M+S   +    T  LS    I N++     + +
Sbjct: 4   TIIKTRDSIRSNFQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTAS 63

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISR 169
           W + ++ +    FI   GR+GDI G   +      +  I SLIC +    G+   F + R
Sbjct: 64  WALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFR 120

Query: 170 AFQGLGIAFVLPN 182
           A QG+  A ++P+
Sbjct: 121 ALQGIAAAGIVPS 133

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 92/213 (43%), Gaps = 7/213 (3%)

Query: 324 LLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLIWGI 383
           L+P+ VL  ++ I I +A+F  +G      +   Q+   +   S + A       ++  +
Sbjct: 303 LIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSML 362

Query: 384 IAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVH----ETYFRTQLGTMIILSFG 439
           I  +++ I    +SP   + L      IGSI+  +  +H      Y++    +  +++FG
Sbjct: 363 IPNVVIAIKSDLISPRKAVVLGFFIMFIGSII--LIQLHLITDNLYWKIFFCSQSLIAFG 420

Query: 440 MDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDP-DGKHVLK 498
               FP S  I     P EY+G+A  ++ T   + + +   +  ++  +++   GK    
Sbjct: 421 AAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKSGSA 480

Query: 499 GYRGAQYLGIGLASLACIISGLYMVERIIKDHK 531
           G    ++      +LA  + GL      +K++K
Sbjct: 481 GIYKTRFQNCTYFTLASSVVGLISTAFFVKENK 513

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 107/245 (43%), Gaps = 32/245 (13%)

Query: 54  KQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMA 113
           + + QN  Y +   +  L  F C    LLN AG    +S++  +  ++       +W + 
Sbjct: 16  RLKCQNSRY-QLGINITLIFFGCTF-DLLNVAGV---ISVIEDLGETYKLGYTGASWALT 70

Query: 114 SFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQG 173
           S+ +    FI   GRLGDI G   + TI   +  ++SL+C + +   +   F + RA QG
Sbjct: 71  SYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT---FAVFRALQG 127

Query: 174 LGIAFVLPNVLGIIGNI-----------YVSGTFRKNIVISLV--GAMAPVGATLGCL-- 218
           +  A ++P    +I  +            VS  F   I I L+  GA A        +  
Sbjct: 128 ISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLIVGGAFALTKVGYAGIFY 187

Query: 219 --FAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVI 276
             FAG++          +FY Y I     L + V  IP++ P   +  S+D++GS + V 
Sbjct: 188 LSFAGMLVVSIAA----SFYTYRIEERKFLEVKVEDIPHDHP---KVASLDFVGSLIFVS 240

Query: 277 GLVLM 281
           G VL+
Sbjct: 241 GSVLI 245

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 108/514 (21%), Positives = 196/514 (38%), Gaps = 60/514 (11%)

Query: 47  GEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNEN 106
           G+ +   + R Q   Y  N       IF      LLN A     +S+++ +A  +  +  
Sbjct: 10  GKALEKIRNRCQKSTYQLNV--NVALIFLGCTFDLLNVA---SMISLIDDLAQKYDISYT 64

Query: 107 SRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFI 166
           + +W + S+ +    FI   GRLGDI G   + T+      I SL+C +     +   F 
Sbjct: 65  TASWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPA---FA 121

Query: 167 ISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATL---GCLFAGLI 223
           + RA QG+  A ++P    +I  +      +K   I   G  + +G  L   G   A  I
Sbjct: 122 VFRAIQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKI 181

Query: 224 GTKNPKQWPWAFYAYTITSIINLALSVYSIPN--NIPTNIQHF----SMDWIGSALGVIG 277
           G K    +   F    + SI+    + Y + N    P   Q      S+D+IGS + V G
Sbjct: 182 GYKG--IFYLTFAVMFLISIVAFFFT-YGVENLSEPPRKDQATNRVRSLDFIGSLIFVTG 238

Query: 278 LVLM-------NFVWNQAP--------------ISGWDQAYXXXXXXXXXXXXXXXXXYE 316
            +L+          WN+                   W+ +Y                 +E
Sbjct: 239 SILIVVGLTEGGESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFE 298

Query: 317 NRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYF--QFQLNIRHYSAVWAGGT 374
                  L+P  VL  ++ I I+LA  F   +  +F+  Y   Q+       S ++AG  
Sbjct: 299 K---VQLLIPVDVLFMKNFIPIVLA--FALNNACLFSCIYIIDQYSQYEEKNSPLYAGVK 353

Query: 375 YFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVH----ETYFRTQL 430
               +I  +I   L      K+ P V + L       GSI+  +T +H    + +++   
Sbjct: 354 LVPLIICMVIGNGLCAFESTKLKPKVGVVLGFSLALAGSII--LTQLHLIKEDMFWKIFF 411

Query: 431 GTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVD 490
            +  ++ FG+   +P +  I     P   +G+A  +  T     + +   + A+V  ++D
Sbjct: 412 SSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASVLGNID 471

Query: 491 ------PDGKHVLKGYRGAQYLGIGLASLACIIS 518
                    +    G++   Y  + + +L  +++
Sbjct: 472 GIRGKSGASQKFRTGFQNCTYFTVAVGALGFLVT 505

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 73/149 (48%), Gaps = 6/149 (4%)

Query: 74  FTC-MISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDI 132
           F C +I+  L+ A     + ++  I   F  +     W + S+ +    FI   GR+GDI
Sbjct: 25  FICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDI 84

Query: 133 YGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV 192
            G   M+ +  V+  I+SL+C +     + T F   RAFQG+  A ++P    ++  ++ 
Sbjct: 85  VGNGIMMCVFSVIFGIFSLLCAVVPNFIAFTVF---RAFQGMAGAGIVPCAYALVNKMFQ 141

Query: 193 SGTFRK--NIVISLVGAMAPVGATLGCLF 219
               ++  +I+ S++ AMA VG  +G  F
Sbjct: 142 GPNLQRYFSILSSVISAMAGVGFIIGGAF 170

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 97/481 (20%), Positives = 186/481 (38%), Gaps = 54/481 (11%)

Query: 80  QLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKML 139
            LLN A     +S+++ +A ++  +  + +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 140 TIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKN 199
           TI      + SL+C +     +   F + RA QG+  A ++P    +I  +      +K 
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 IVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI------ 253
             I   G  + +G  LG +  G   T         +  + + ++I++    ++       
Sbjct: 155 FSIVSCGFSSTIG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLN 212

Query: 254 --PNNIPTNIQHFSMDWIGSALGVIGLVLMNF-------VWNQAPIS------------- 291
             P     +    S+D+IGS + V G +L+          WN+ P++             
Sbjct: 213 KKPQKDQASTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNR-PVTYVTLVIGIILFFG 271

Query: 292 --GWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSF 349
              W+  Y                 +E       L+P  VL  ++ I I+LA  F   + 
Sbjct: 272 FFVWNCTYTKIVRGFKYCGIDTSKYFEKV---QLLIPIDVLFMKNFIPIVLA--FALNNA 326

Query: 350 GIFTFYYF--QFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMM 407
            +F+  Y   Q+       S + AG      +I  +I   L      K+ P V + +   
Sbjct: 327 CLFSCLYIIDQYSQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFF 386

Query: 408 AFNIGS-IMASVTPVHETYF-RTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGS 465
               GS I+  +  V E  F +       ++ FG+   +P +  I     P E +G+A  
Sbjct: 387 LALAGSIILIQLHLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASG 446

Query: 466 LVNTVVNYSMSLCLGMGATVETHVDP-DGK-----HVLKGYRGAQYLGIGLASLACIISG 519
           +  T     + +   + A+V  +++   GK         G++   Y  + + +L  +++ 
Sbjct: 447 VAQTFGQLGIEITFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVTA 506

Query: 520 L 520
           +
Sbjct: 507 I 507

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 99/483 (20%), Positives = 189/483 (39%), Gaps = 58/483 (12%)

Query: 80  QLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKML 139
            LLN A     +S+++ +A  +  +  + +W + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 140 TIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKN 199
           TI      I SL+C +     +   F + RA QG+  A ++P    +I  +      +K 
Sbjct: 98  TISCSCFAILSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 200 IVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLA--LSVYSIPN-- 255
             I   G  + +G  LG +  G             +  + + S+I++      Y++ N  
Sbjct: 155 FSIVSCGFSSTIG--LGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFD 212

Query: 256 NIPTNIQH----FSMDWIGSALGVIGLVLM-------NFVWNQAPIS------------- 291
             P  IQ      S+D+IGS + V G +L+          WN+ P++             
Sbjct: 213 KKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGGESWNR-PVTYVTLIIGILLFFG 271

Query: 292 --GWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSF 349
              W+  Y                 +E       L+P  VL  ++ I I+LA  F   + 
Sbjct: 272 FFVWNCTYAKIVRGIRFVGIDTSKYFEKV---QLLIPVDVLFMKNFIPIVLA--FALNNA 326

Query: 350 GIFTFYYF--QFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMM 407
            +F+  Y   Q+       S + AG      +I  ++   L      K+ P V + L   
Sbjct: 327 CLFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFS 386

Query: 408 AFNIGSIMASVTPVH----ETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMA 463
               GSI+  +  +H      +++    +  ++ FG+   +P +  I     P + +G+A
Sbjct: 387 LALAGSII--LIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIA 444

Query: 464 GSLVNTVVNYSMSLCLGMGATVETHVDP-DGK-----HVLKGYRGAQYLGIGLASLACII 517
             +  T     + +   + A+V   ++   GK     +   G++   Y  + + +L  ++
Sbjct: 445 SGVAQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLV 504

Query: 518 SGL 520
           + +
Sbjct: 505 TAI 507

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 123/287 (42%), Gaps = 61/287 (21%)

Query: 82  LNQAGTTQTLSIMNIIANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLT 140
           L  A  T   +IM  IA+ F  NE  R +W+  ++ L S +F  + G+L DI+G K +L 
Sbjct: 91  LAAADGTLVSTIMAHIASEF--NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148

Query: 141 IGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSG------ 194
           +  +V ++  L+CGLT                        P+  G++G  ++SG      
Sbjct: 149 LNNIVFLVGCLMCGLT------------------------PSFWGLVGARFISGIGGGGV 184

Query: 195 TFRKNIVIS---------LVGAMAPVGATLGCLFAGLIG---TKNPKQWPWAFY-AYTIT 241
           T   +I IS         L   M      LG    G++G   + +   W  AF     ++
Sbjct: 185 TSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQVPLS 244

Query: 242 SIINLALSVY-SIPN-----NIPTNIQH--FSMDWIGSALGVIGLVLMNFVWNQAPISGW 293
           ++ +L ++V+  +P      N P +I++   S+DWIG++  V   V ++     A + G 
Sbjct: 245 ALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALV---VFLSLFLVTASLGGK 301

Query: 294 DQAYXXXXXXXXXXXXXXXXXY----ENRFAKSPLLPRAVLKDRHMI 336
           + A+                 +    E   AK P+LP + L++R ++
Sbjct: 302 EIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVL 348

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 92/214 (42%), Gaps = 19/214 (8%)

Query: 31  SRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYL----FIFTCMISQLLNQAG 86
           + H  NEE+    TD      V+K+   N  Y KN+  E L     ++TC  S  L    
Sbjct: 34  ASHGINEES---GTDAEVSNHVEKKPNFNSKYGKNAMGEDLPSGIVLYTCAFSLALAIFL 90

Query: 87  TTQTLSIMNII----ANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIG 142
               + I++ I    A  FG+   +  W+ A + L +    L+ GR+  I G K  +   
Sbjct: 91  AALDIMIVSTIIEDVAKKFGAYSKT-GWIFAGYSLPNALLALLWGRIASIIGFKSCMLAA 149

Query: 143 YVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVI 202
            ++  I SLI G+   + S    I  R   G+G + +  ++  +IG+  V    R+ ++I
Sbjct: 150 IIIFEIGSLISGV---ANSMNMLIGGRVIAGVGGSGI-QSLAFVIGSNLVDER-RRGLII 204

Query: 203 SLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFY 236
           + + +   V + +G    G   T     W W FY
Sbjct: 205 ACMSSAFAVASVIGPFLGGAFTTH--ATWRWCFY 236

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 57/118 (48%), Gaps = 11/118 (9%)

Query: 65  NSWHEY-------LFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPL 117
             +HEY         +F+  +   L+   +T   +IMN +A  F S  + + W+  SF L
Sbjct: 24  QKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLL 82

Query: 118 VSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLG 175
            + +F  + G+L DI G K  L I       + L C LT ++ + T F I+RA  G+G
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLIAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 58/129 (44%), Gaps = 10/129 (7%)

Query: 54  KQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMA 113
           ++R QN  Y          IF      LLN AG    +S++  +  ++G    + +W + 
Sbjct: 20  RRRCQNSKY--QLIINMALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYTTASWALT 74

Query: 114 SFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICG-LTKYSGSDTFFIISRAFQ 172
           S+ +     I   GRLGDI G   + TI      ++ L+C  +T +      F + RA Q
Sbjct: 75  SYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNFPA----FAVLRALQ 130

Query: 173 GLGIAFVLP 181
           G+  A ++P
Sbjct: 131 GIAAAGLVP 139

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 29/178 (16%)

Query: 64  KNSWHEY-------LFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFP 116
           +  +HEY         +F+  +   L+    T   +IMN +A  F S  + + W+  SF 
Sbjct: 23  EQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESSRKQWIATSFL 81

Query: 117 LVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGI 176
           L + +F  + G+L DI G K  L   +     + + C LT ++ + T F I+RA  G+G 
Sbjct: 82  LTNTAFQPLYGKLSDITGRKSALLTAH---FFFGIGCLLTCFARNVTEFSIARAICGIG- 137

Query: 177 AFVLPNVLGIIGNIYVSG--TFRK--------NIVISLVGAMAPVGATLGCLFAGLIG 224
                  L  IG+I VS   T R+        NIV  L G +  +GA LG +F   IG
Sbjct: 138 ----AGGLNAIGSIAVSDICTARERGVYQGYANIVFGL-GQL--LGAPLGGVFIETIG 188

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 96/409 (23%), Positives = 154/409 (37%), Gaps = 72/409 (17%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I++++A  FG N +   WL+  + L +    LI GR   I G +  L +  ++    SL
Sbjct: 59  TIIDVVAEQFG-NYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           I  L   + S    I  R   G+G    L  +  +IG   V G   + +VIS++     V
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVG-GSGLQTLCFVIGCTMV-GERSRPLVISILSCAFAV 172

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFYAYTIT---SIINLALSVYSIPNNIPTNIQH----- 263
            A +G +  G   T     W W FY        +II   L+  +    I   I+      
Sbjct: 173 AAIVGPIIGGAFTTH--VTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTI 230

Query: 264 ----------------------FSMDWIGSALGVIGLVLM---------NFVWNQAPISG 292
                                 F  D+ G AL   GLVL           + WN    SG
Sbjct: 231 SSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWN----SG 286

Query: 293 WDQAYXXXXXXXXXXXXXXXXXYENRFAKSP--------LLPRAVLKDRHMIQIMLALFF 344
               Y                   ++F   P        LL R V K   +I  M+    
Sbjct: 287 QVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLL 346

Query: 345 GWGSFG--IFTFYYFQFQLNIRHYSAVWAGGTYFM-FLIWGIIAALLVGIYIKK---VSP 398
             G  G  I++  +FQ    +   S+ W  G + +  +I  +IAA+  G+  KK   V P
Sbjct: 347 CTGYNGQMIYSVQFFQ----LIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKP 402

Query: 399 SVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPAS 447
            + +F  ++      +M  +T  + +   TQ+G +++  F + F+  AS
Sbjct: 403 -LLIFGGVLGVIGAGLMTLMT--NTSTKSTQIGVLLLPGFSLGFALQAS 448

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 92/418 (22%), Positives = 161/418 (38%), Gaps = 46/418 (11%)

Query: 92  SIMNIIANSFGSNENSR---TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIII 148
           +I++ +    GS  NS    +W+  S+ L S +   + G+L D  G K +L    VV  I
Sbjct: 100 TIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSI 159

Query: 149 WSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAM 208
             LICG+   S S  + ++ R   G+G   +      +I ++      R+  V      +
Sbjct: 160 GCLICGM---STSIWWVVVGRFVSGIGGCGLTCLASMVISDLV---PLRERAVYQ---GL 210

Query: 209 APVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI---PNNIPTNIQHFS 265
                 LG    GL+G    + W  AF      S+ + AL V  +   P +     +H++
Sbjct: 211 CNFIFGLGTASGGLVGAAF-QDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWT 269

Query: 266 -----MDWIGSALGVIGLVLMNFVWNQAPISG-----WDQAYXXXXXXXXXXXXXXXXXY 315
                +DW     GV+ LV   F++      G     +D                     
Sbjct: 270 SKLRDLDWA----GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYV 325

Query: 316 ENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFY---YFQFQLNIRHYSAVWAG 372
           E   A  P+LP A LK R ++   LA +F   S     +Y   Y+   LN++        
Sbjct: 326 ELYVAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRS 385

Query: 373 GTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIG-----SIMASVTPVHETYFR 427
              F  + +G + A   GIY+K+     +  L+     I      +++   TPV + Y  
Sbjct: 386 IPSFFSVAFGSLGA---GIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYL- 441

Query: 428 TQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 485
                +++ SFG+      + +     +P E+     S+     +   +L + +GA +
Sbjct: 442 ----LLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAI 495

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 77/350 (22%), Positives = 142/350 (40%), Gaps = 55/350 (15%)

Query: 92  SIMNIIANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           ++++ IA+ F  NE  R +W+  ++ L S +F  + G+L DI+G + +L    +V  + +
Sbjct: 162 TLLDHIASEF--NELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219

Query: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV---SGTFRKNIVISLVGA 207
           LICG++K   +    ++ R   G+G    L ++  I     V   S    + I     G 
Sbjct: 220 LICGMSK---NLWVLVLGRFVAGIG-GGGLTSMCSITTTDIVPLRSRALYQGICNVFFGL 275

Query: 208 MAPVGATLGCLFAGLIGTKNPKQWPWAFYAYT-ITSIINLALSVY-SIPN---------- 255
               G  +G LFA          W  AF     +T +   A+ ++ ++P           
Sbjct: 276 GTACGGLVGGLFA-----DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQ 330

Query: 256 -NIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXX 314
            +IP   +   +DW G+   V+ L     V +   + G D  +                 
Sbjct: 331 RSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIY 387

Query: 315 YENRFAKSPLLPRAVLKDRHMIQIMLALFF---GWGSFGIFTFYYFQFQLNI-------- 363
           +E   A  P+LP   L++R ++   L+ +F   G  + G +   Y+   LN+        
Sbjct: 388 HELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKR 447

Query: 364 -------RHYSAVWAG------GTYFMFLIWGIIAALLVGIYIKKVSPSV 400
                    + ++ AG      G Y+ FL+   +  +L  + I  V+PS+
Sbjct: 448 IVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSI 497

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query: 65  NSWHEY-------LFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPL 117
             +HEY         +F+  +   L+   +T   +IMN +A  F S  + + W+  SF L
Sbjct: 24  QKFHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLL 82

Query: 118 VSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLG 175
            + +F  + G+L DI G K  L         + L C LT ++ + T F I+RA  G+G
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLTAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 3/90 (3%)

Query: 88  TQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVII 147
           +  +S+++ ++  +  +  + +W + S+ +    FI   GRLGDI G  ++ T+      
Sbjct: 46  SSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFA 105

Query: 148 IWSLICGLTKYSGSDTFFIISRAFQGLGIA 177
           I SL+CGL     +   F + RA QG+  A
Sbjct: 106 ILSLLCGLMPNFEA---FAVMRALQGIAAA 132

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 11/119 (9%)

Query: 64  KNSWHEY-------LFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFP 116
           +  +HEY         +F+  +   L+   +T   +IMN +A  F S  + + W+  SF 
Sbjct: 23  EQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFL 81

Query: 117 LVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLG 175
           L + +F  + G+L DI G +  L         + L C +T ++ + T F I+RA  G+G
Sbjct: 82  LTNTAFQPLYGKLSDIIGRRPALLTAQ---FFFGLGCLMTCFARNVTEFSIARAVCGIG 137

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 43  STDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFG 102
           S + GEE    ++++   N    S  ++  + +  +   L+   +T   +IMN +A  F 
Sbjct: 16  SIEDGEEDNGLEEQYHEYNL---SLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEF- 71

Query: 103 SNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSD 162
              + + W+  SF L + +F  + G+L DI G K  +   +     + L C LT ++ + 
Sbjct: 72  EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSH---FFFGLGCFLTCFAQNI 128

Query: 163 TFFIISRAFQGLG 175
           T F I+RA  G+G
Sbjct: 129 TQFSIARAICGIG 141

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 76/175 (43%), Gaps = 17/175 (9%)

Query: 97  IANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156
           +   F  +EN     +  + L  G    +SG L D++G + ++  G V+ ++ S+     
Sbjct: 128 LEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLACA 187

Query: 157 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNI---YVSGTFRKNIVISLVGAMAPVGA 213
              G   F    R  Q +GI+  +    G++G+    +  GTF        VGA + +  
Sbjct: 188 PSYGVICFL---RCIQSIGISPTIAISSGVVGDFTLKHERGTF--------VGATSGL-V 235

Query: 214 TLGCLFAGLIGTKNPKQWPWA--FYAYTITSIINLALSVYSIPNNIPTNIQHFSM 266
            LG  F  LIG     +W W   F+   I S + L ++ +++P    T + + S+
Sbjct: 236 LLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 81/174 (46%), Gaps = 13/174 (7%)

Query: 87  TTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVI 146
           +T   +IMN +A  F  ++  + W+  SF L + +F  + G+L DI G K  +   +   
Sbjct: 60  STIVANIMNRVAEEFAESDK-KQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAH--- 115

Query: 147 IIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIV---IS 203
             + L C LT ++ + T F I+RA  G+G   +  N +  I    +  T  + I     +
Sbjct: 116 FFFGLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRERGIFQGYAN 173

Query: 204 LVGAMAPV-GATLGCLFAGLIGTKN--PKQWPWAFYAYTITSIINLALSVYSIP 254
           +V  M  V GA LG LF   IG +     Q P   +   +T I N+ + +  +P
Sbjct: 174 IVFGMGQVLGAPLGGLFLDHIGWRTLFGIQVPMIMFCSYLT-ITNVNIKLLHVP 226

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 17/132 (12%)

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISR 169
           WL+  + L +  F L+ GRL  I GLK  LT   V+  I SLI  ++   G     I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMG---MIIGGR 102

Query: 170 AFQGLGIAFVLPNVLGIIGNIYVSGT-----FRKNIVISLVGAMAPVGATLGCLFAGLIG 224
              G G +       GI   ++V GT       + +VI+++G    V   +G +  G   
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF- 154

Query: 225 TKNPKQWPWAFY 236
           T+N   W W FY
Sbjct: 155 TENVS-WRWCFY 165

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 70  YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSR-TWLMASFPLVSGSFILISGR 128
           ++ I +  +   L     T   ++++ IA+ F  NE S  +W+  ++ L S +F  + G+
Sbjct: 61  HIIISSMCLGSFLAALDNTIVTTLLSHIASEF--NELSHISWIATAYLLSSATFQPLYGK 118

Query: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTK 157
           + DI+G + ++ I  +  I+  LICGL+K
Sbjct: 119 ISDIFGRRPLIIISNLFFILGCLICGLSK 147

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 122/294 (41%), Gaps = 40/294 (13%)

Query: 97  IANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGL 155
           IA+ F  NE  R +W+  ++ L S +F  I G++ DI+G K +L    +   + SLICGL
Sbjct: 148 IASEF--NELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGL 205

Query: 156 TKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTF---RKNIVISLVGAMAPVG 212
              S S  + +  R      IA +    +  + +I  S       + +   +      +G
Sbjct: 206 ---SPSFEWLVAGRF-----IAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLG 257

Query: 213 ATLGCLFAGLIGTKNPK-------QWPWAFYAYTITSIINLALSVYSIPNNIPTNIQHFS 265
             LG +  G    ++         Q P AF++ TI  I+ L L   S    +  +  +FS
Sbjct: 258 TALGGVVGGWFSDRSVGWRMSFLIQLPIAFFS-TILIILFLRLPKESKGRGLQVDGNYFS 316

Query: 266 --------MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXXXXXXXY-- 315
                   +DWIG+   V  L L +F+   A + G +  Y                    
Sbjct: 317 TIKVRLSAVDWIGATTLV--LFLFSFMIT-ASLGGKEIPYTSHKFIGLCVVTVIGALIFG 373

Query: 316 --ENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFY---YFQFQLNIR 364
             E + AK P+LP   LKDR ++   L+ +F   +    ++Y   YF   LN++
Sbjct: 374 YTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK 427

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 6/80 (7%)

Query: 97  IANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGL 155
           +A+ F  N+ S+ +W+  S+ L S +F  + G++ DI+G K +L    V  +I  L+CGL
Sbjct: 138 VASEF--NQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGL 195

Query: 156 TKYSGSDTFFIISRAFQGLG 175
           +K   S  + +I+R   G+G
Sbjct: 196 SK---SFWWLVIARFVAGVG 212

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 4/103 (3%)

Query: 73  IFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDI 132
           +++  +   L    +T   +IMN +A  F    + + W++ SF L + +F  + G+L D+
Sbjct: 43  LYSLWMGSFLGSLDSTIVANIMNKVAEEF-EESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 133 YGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLG 175
            G K  L + +   ++    C  T  S +   F I+RA  G+G
Sbjct: 102 AGRKTALMVAHSFFLVG---CLFTALSRNLVEFSIARAVCGMG 141

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +IMN +A  F S  + + W+  SF L + +F  + G+L D+ G K  L + Y  ++I   
Sbjct: 57  NIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG-- 113

Query: 152 ICGLTKYSGSDTFFIISRA 170
            C LT  + + T F ++RA
Sbjct: 114 -CLLTCLARNVTEFAVARA 131

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 86/410 (20%), Positives = 147/410 (35%), Gaps = 74/410 (18%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I++++A  FG N +   WL+  + L +    L+ GR   I G +  L +  ++    SL
Sbjct: 67  TIIDVVAKQFG-NYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSL 125

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           +  L     +    +I            L  +  +IG   V    R  +VIS++     V
Sbjct: 126 VAAL----ANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSRP-LVISILSCAFAV 180

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFYAY----------------------------TITSI 243
            A +G +  G   T     W W FY                               +  I
Sbjct: 181 AAIVGPIIGGAFTTH--VTWRWCFYINLPIGGLAVIMFLLTYDAKNDGIIQQMKGALRKI 238

Query: 244 INLALSVYSIPNNI--PTNIQHFSMDWIGSALGVIGLVL----MNFVWNQAPISGWDQAY 297
                S    P N+    N   F  D+ G AL   GLVL    + F  N+     W    
Sbjct: 239 SGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTFGGNKYT---WSSGQ 295

Query: 298 XXXXXXXXXXXXXXXXXYE-----------NRFAKSPLLPRAVLKDRHMIQIMLALFF-- 344
                            Y+           +  +  PL  R ++    +I + +  F   
Sbjct: 296 VITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAIIIVNMVTFLLC 355

Query: 345 -GWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFM-FLIWGIIAALLVGIYIKK---VSPS 399
            G+    I++  +FQ    +   S+ W  G + +  +I  +IAA+  GI  KK   V P 
Sbjct: 356 TGYNGQMIYSVQFFQ----LIFASSAWKAGLHLIPIVITNVIAAIASGIITKKLGLVKPL 411

Query: 400 VFL--FLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPAS 447
           +    FL ++   + ++M      + +   TQ+G +I+  F + F+  AS
Sbjct: 412 LIFGGFLGVIGAGLMTLMK-----NNSTSSTQIGVLILPGFSLGFALQAS 456

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 74/175 (42%), Gaps = 17/175 (9%)

Query: 97  IANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156
           +   FG +EN     +  + L  G    ISG L D++G + ++ IG ++ ++ S+     
Sbjct: 117 LEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLACA 176

Query: 157 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNI---YVSGTFRKNIVISLVGAMAPVGA 213
              G   F    R  Q +GI+  +    G++G+    +  GTF        VGA + +  
Sbjct: 177 PSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTLKHERGTF--------VGATSGL-V 224

Query: 214 TLGCLFAGLIGTKNPKQWPWA--FYAYTITSIINLALSVYSIPNNIPTNIQHFSM 266
            LG  F  LIG      W W   F+  TI    +  ++   +P    T + + S+
Sbjct: 225 LLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 65/147 (44%), Gaps = 10/147 (6%)

Query: 91  LSIMNIIANSFGSNENSRT-WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIW 149
           ++I+N IA+ F  N  S+  WL+  + L +  F L+ GR   I+G K  L +  ++  I 
Sbjct: 41  VTILNTIADKF--NAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIG 98

Query: 150 SLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMA 209
           SL+  +   S S    I  R   G G + +   V  I  ++    T  +  +++L+    
Sbjct: 99  SLVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSY 153

Query: 210 PVGATLGCLFAGLIGTKNPKQWPWAFY 236
            V + LG    G +       W W FY
Sbjct: 154 AVASALGPYIGGAL--TEYVTWRWCFY 178

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 105/247 (42%), Gaps = 34/247 (13%)

Query: 252 SIPNNIPTNIQHF------SMDWIGSALGVI--GLVLMNFVWNQAPISGWDQAYXXXXXX 303
           +IP N+ T +++F       +D +G  LGVI    VL+ F         W  A       
Sbjct: 253 TIPPNM-TRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIVPEV 311

Query: 304 XXXXXXXXXXXY-ENRFAKSPLLPRAVLKDRHMI-QIMLALFFGWGSFGIFTFYYFQFQL 361
                      + E +FAK PL P  ++KDR +   +++ALF  +  +   T+ Y    +
Sbjct: 312 IGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLV 371

Query: 362 NIRHYSAVWAGGTYFMFLIWGIIAALLVGIYI----KKVSPSVFLFLSMMAFNIGSIMAS 417
           +    + + A  T  MF   G+I A L+GI++    ++    +F  +SM   + G +   
Sbjct: 372 SFDT-TVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRY 430

Query: 418 VTPVHETYFRTQLGTMI---ILSFGMDF-SFPASSIIFSDNLPMEYQGMAGSLVNTVVNY 473
               H      ++GT++   +L FG  F  FPA + I         Q  A +  N  +  
Sbjct: 431 RIGAH-----AKVGTIVACCLLGFGNGFLKFPARASI---------QAAAYTHKNLAIIT 476

Query: 474 SMSLCLG 480
           S+ L LG
Sbjct: 477 SLFLALG 483

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 91/409 (22%), Positives = 153/409 (37%), Gaps = 72/409 (17%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I++++A  FG N +   WL+  + L +    L+ GR   I G +  L +  ++    SL
Sbjct: 57  TIIDVVAEQFG-NYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           +  L     +    +I            L  +  +IG   V+   R  +VIS++     V
Sbjct: 116 VAAL----ANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRP-LVISILSCAFAV 170

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFYAYTIT---SIINLALSVYSIPNNI----------- 257
            A +G +  G   T     W W FY        ++I   L+  +   NI           
Sbjct: 171 AAIVGPIIGGAFTTH--VTWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRI 228

Query: 258 ----------PTNIQH------FSMDWIGSALGVIGLVLM---------NFVWNQAPISG 292
                     P N++       F  D++G AL   GLVL           + WN    SG
Sbjct: 229 SKFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWN----SG 284

Query: 293 WDQAYXXXXXXXXXXXXXXXXXYENRFAKSP--------LLPRAVLKDRHMIQIMLALFF 344
               Y                    +F   P         L R V K   +I  M+    
Sbjct: 285 QIITYLVLGILLFVFSLIYDFFIFQKFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLL 344

Query: 345 GWGSFG--IFTFYYFQFQLNIRHYSAVWAGGTYFM-FLIWGIIAALLVGIYIKK---VSP 398
             G  G  I++  +FQ    +   S+ W  G + +  +I  +IAA+  G+  KK   V P
Sbjct: 345 CIGYNGQMIYSVQFFQ----LIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKP 400

Query: 399 SVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGMDFSFPAS 447
            + +F  ++   IG+ + ++   + T   TQ+G +I+    + F+  AS
Sbjct: 401 -LLIFGGILGV-IGAGLMTLMSNNSTS-STQIGVLILPGLSLGFALQAS 446

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 7/132 (5%)

Query: 44  TDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGS 103
           T    E    +Q +   N    S  +   + +  +   L+    T   +IMN +A  F  
Sbjct: 14  TPDTTEQDALEQEYHEHNL---SLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEF-Q 69

Query: 104 NENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDT 163
             + + W+  S+ L + +F  + G+L D+ G K  +   +     + L C LT ++ S T
Sbjct: 70  ESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAH---FFFGLGCLLTCFANSVT 126

Query: 164 FFIISRAFQGLG 175
            F I+RA  G+G
Sbjct: 127 QFAIARAICGVG 138

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 73  IFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDI 132
           +F+  +   L     T   +IMN +A  F  ++  + W+  SF L + +F  + G+L DI
Sbjct: 54  VFSLWMGSFLGALDGTIVANIMNRVAEEFQESDK-KQWIATSFLLTNTAFQPLYGKLSDI 112

Query: 133 YGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRA 170
            G K  L + +     + L C LT ++ + T F I+RA
Sbjct: 113 TGRKFALLVAHT---FFCLGCLLTCFARNVTEFSIARA 147

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 101/252 (40%), Gaps = 41/252 (16%)

Query: 7   VKSAESRQDSFEAENESVSAVKKSSRHDGNE----ETVTISTDHGEEMTVDKQRWQNPNY 62
           ++ A  R    +A+ E+    KK+  + G+E     TVT       +  V  + +   ++
Sbjct: 1   MRRASIRGTDLQADTETK---KKNCDNTGSESSVFRTVTRELRDDTDDVVTHEIYDEESF 57

Query: 63  FKNSWHEYL----FIFTCMISQ-------LLNQAGTTQTL------SIMNIIANSFGSNE 105
              S  E L      +T +  +       LL  AG   +L        +  +   F  NE
Sbjct: 58  PDGSKQEQLSEEDVPYTLLTYRQKWFMVALLTSAGFWSSLGSPIYYPALKELEAEFDVNE 117

Query: 106 NSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFF 165
                 +  + L  G    ISG L D+YG + ++ +G ++ +I S+    +K  G+  F 
Sbjct: 118 ELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL 177

Query: 166 IISRAFQGLGIAFVLPNVLGIIGNIYVS---GTFRKNIVISLVGAMAPVGATL-GCLFAG 221
              R  Q  GI+ ++    G+ G+  V    GTF        VGA++  G TL G  F  
Sbjct: 178 ---RCLQSAGISPIIAINSGVAGDFTVKSERGTF--------VGAVS--GFTLMGQAFGS 224

Query: 222 LIGTKNPKQWPW 233
           LIG      + W
Sbjct: 225 LIGAALTAAYDW 236

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/243 (18%), Positives = 99/243 (40%), Gaps = 14/243 (5%)

Query: 28  KKSSRHDGNEETVT-ISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAG 86
           + ++   G+++T +  S D  E+  + +     P+       ++  +F   I+   +  G
Sbjct: 47  RTTTNELGDDDTSSECSHDEQEQQHIVEGEQNYPHTLLTYRQKWFMVFLMTITGFWSSLG 106

Query: 87  TTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVI 146
           +      +  +   F  +EN     +  + L  G    ISG L D+YG + ++  G ++ 
Sbjct: 107 SPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIF 166

Query: 147 IIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS---GTFRKNIVIS 203
           ++ S+  G+ K + S    +  R  Q +GI+  +    G++ +  V    GTF     + 
Sbjct: 167 VVASI--GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGTF-----VG 218

Query: 204 LVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQH 263
               +  +G  +G L   +I       W   F+  TI     + +  + +P    T + +
Sbjct: 219 ATSGLVLIGQGIGPLLGAVITAA--LHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIVGN 276

Query: 264 FSM 266
            S+
Sbjct: 277 LSI 279

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 167 ISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGA-MAPVGATLGCLFAGLIGT 225
           I R FQ +G + V+P  +G + ++       K +   ++G  M P+   LG +F GLI  
Sbjct: 206 ILRVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGPNMGPI---LGPIFGGLI-L 261

Query: 226 KNPKQWPWAFYAYTITSIINLALSVYSIPNNI 257
            N  QW W F   +IT+ + L L V  +P  +
Sbjct: 262 MNGNQWRWLFGFTSITTGVGLILIVTFLPETL 293

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 94/251 (37%), Gaps = 49/251 (19%)

Query: 28  KKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP------NYFKNSWHEYLFIFTCMISQL 81
           + ++R    +    IS+ H ++   D +   N       NY ++ W        CM++ L
Sbjct: 55  RTTTRELPEDLESEISSTHSQDAKEDLEIQHNAAPYSLLNY-RDKW--------CMVA-L 104

Query: 82  LNQAGTTQTL------SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGL 135
           L   G   +L        +  +   F  +EN     +  + L  G     SG L D +G 
Sbjct: 105 LTACGFWSSLGSPIYYPALKQLEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFGR 164

Query: 136 KKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS-- 193
           + +L IG ++ ++ S+        G   F    R  Q +GI+  +    G++G+  V   
Sbjct: 165 RPVLLIGMLIYVVASIGLACAPSYGVIVFL---RCVQSIGISPSIAISSGVVGDFTVKSE 221

Query: 194 -GTFRKNIVISLVGAMAPVGAT-----LGCLFAGLIGTKNPKQWPWA--FYAYTITSIIN 245
            GTF              VGAT     LG  F  LIG      W W   F+  TI    +
Sbjct: 222 RGTF--------------VGATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGAS 267

Query: 246 LALSVYSIPNN 256
            A+    +P  
Sbjct: 268 FAICFALLPET 278

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 78/200 (39%), Gaps = 16/200 (8%)

Query: 37  EETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNI 96
           EE+   S D  + +  D Q +  P    +   +++ +    +    +  G+      +  
Sbjct: 70  EESDLESADDVKTIK-DSQEYVAPYTLFSYSQKWIMVGLLTMCGFWSSLGSPIYYPALRQ 128

Query: 97  IANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156
           +   F  +EN     +  + L  G    + G L DIYG + ++  G +V I+ S+     
Sbjct: 129 LEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALACA 188

Query: 157 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS---GTFRKNIVISLVGAMAPVGA 213
              G   F    R  Q  GI+ ++    G +G+  +    GTF        VGA++ +  
Sbjct: 189 NSYGVIIFL---RCLQSCGISPIIAISSGCVGDFTMKAERGTF--------VGAVSGL-V 236

Query: 214 TLGCLFAGLIGTKNPKQWPW 233
            LG  F  LIG      W W
Sbjct: 237 LLGQAFGSLIGAALAAAWDW 256

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 9/132 (6%)

Query: 106 NSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFF 165
           N   WL+  + L S  F L+ GR+  + GLK  L +  ++  I SLI  ++   G     
Sbjct: 78  NDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMG---ML 134

Query: 166 IISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGT 225
           I  R   G G + +  +++ I+G   VS   R  +++ L  A   VG+  G    G  G 
Sbjct: 135 IAGRVVAGAGGSGI-QSLVYIVGTSLVSERSRGMVIMVLTFAF--VGSNAGGPILG--GA 189

Query: 226 KNP-KQWPWAFY 236
            N    W W F+
Sbjct: 190 LNEHASWRWCFF 201

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 6/131 (4%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +IMN +   F  +   + W+  SF L S  F  I G+L D+ G + +L + Y + +   L
Sbjct: 69  NIMNSVTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFL---L 124

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
            C +T Y+ +   F   RA  G+G   +    +  +G+++      ++I  S    +  +
Sbjct: 125 GCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMF--SVKEQSIYQSYAHIIYTI 182

Query: 212 GATLGCLFAGL 222
           G  LG    G+
Sbjct: 183 GEVLGAPIGGI 193

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 37.4 bits (85), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 93/242 (38%), Gaps = 45/242 (18%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPN 61
           N+    + A SR  + E +  S  +++    HD   +   +       +  + Q+W    
Sbjct: 34  NKHKYEQDAPSRVTTHEMKGSSSESIEG---HDIAHDNAPLPQHAPYTLLSNAQKW---- 86

Query: 62  YFKNSWHEYLFIFTCMISQLLNQAGTTQTL------SIMNIIANSFGSNENSRTWLMASF 115
                         CM++ LL  AG   +L        +  +   F  +E      +  +
Sbjct: 87  --------------CMVA-LLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVVY 131

Query: 116 PLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLG 175
            +  G    ISG L D+YG + ++ IG ++ +  S+    +   G   F    R  Q  G
Sbjct: 132 LIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFL---RCLQSAG 188

Query: 176 IAFVLPNVLGIIGNIYVS---GTFRKNIVISLVGAMAPVGATL-GCLFAGLIGTKNPKQW 231
           I+ ++    G++G+  V    GTF        VGA++  G TL G  F  LIG      +
Sbjct: 189 ISPIIAINSGVVGDFTVKQERGTF--------VGAVS--GFTLMGQAFGSLIGAALTAAF 238

Query: 232 PW 233
            W
Sbjct: 239 DW 240

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 104 NENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSD 162
           NE  R +W+  ++ L S +F  + G++ DI+G K +LT   V   I  LICG  K   S 
Sbjct: 127 NELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK---SF 183

Query: 163 TFFIISRAFQGLG 175
              +I R   G+G
Sbjct: 184 WVLVIGRFISGVG 196

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 94/228 (41%), Gaps = 15/228 (6%)

Query: 15  DSFEAENESVSAVKKSSRHDG------NEETVTISTDHGEEMTVDKQRWQNPNYFKNSWH 68
            ++   N S+ + +   +H+       +++    S++H E    +    +N    K S  
Sbjct: 1   KAYAMSNPSLHSKEAKQQHEQKRQFAVDQKFAHTSSEHDETSIPEDNVKKNVELSKGSIL 60

Query: 69  EYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGR 128
            Y+ +    +S  L         +I+  +A   GS  +   WL   + L +   +LI GR
Sbjct: 61  -YVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGS-YSEIGWLFTGYSLPNALLVLIWGR 118

Query: 129 LGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIG 188
           +    G K  +    V+  I SLI  L   + S    I  R   G+G    + ++  +IG
Sbjct: 119 IATPIGFKATMLFAIVIFEIGSLISAL---ASSMNMLIGGRVIAGIG-GCGIQSLSFVIG 174

Query: 189 NIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFY 236
           +  V  + ++ ++I+++ +   + + +G    G+  +     W W FY
Sbjct: 175 STLVEES-KRGMLIAILSSSFAIASVVGPFLGGVFTSS--VTWRWCFY 219

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 8/130 (6%)

Query: 45  DHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMIS----QLLNQAGTTQTLSIMNIIANS 100
           D    +  D+Q     +     ++  L  F  ++S      L+   +T   +IMN +A  
Sbjct: 5   DESTRLLPDEQHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEE 64

Query: 101 FGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSG 160
           F  ++  + W+  SF L + +F  + G+L DI G K  L      +  + L C LT  S 
Sbjct: 65  FQESQE-KQWIATSFLLTNTAFQPLYGKLSDITGRKFAL---LTALSFFGLGCFLTSLST 120

Query: 161 SDTFFIISRA 170
           +   F I+RA
Sbjct: 121 NIKQFAIARA 130

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 91/237 (38%), Gaps = 21/237 (8%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQR----W 57
           NEK  ++   + +D+ E+++E +S          NE   +I  +          R    +
Sbjct: 4   NEKEDIRKTPTEKDT-ESKHERLSL------PGDNESMCSIDVEQSSCTRTKSARLEPHY 56

Query: 58  QNPNYFKNSWHE-YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFP 116
            +P Y +    E +L +  C  +   +         ++ +I + F  +E      +  + 
Sbjct: 57  TSPPYSRFGRREKFLLVVQCAFTGFFSTIAAAIYYPVLTVIEDLFDISEEKVNITVVVYF 116

Query: 117 LVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGI 176
           +  G    + G L D  G + ++ +   V++ +S   GL   S S    I  R  Q  GI
Sbjct: 117 IFQGISPTLMGGLADYLGRRPIVILS--VLVYFSACVGLA-CSQSYAQIIALRCLQAAGI 173

Query: 177 AFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPW 233
           + V+    GI+G++       +   +  V     VG+     F  LIG     +W W
Sbjct: 174 SPVIAINSGIMGDVTTRA--ERGGYVGYVSGCQVVGSA----FGALIGAGLSSRWGW 224

>NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON}
           Anc_5.284
          Length = 528

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 103/260 (39%), Gaps = 20/260 (7%)

Query: 5   SLVKSAESRQDSFEAENESVSAVKKSSRHDGNE-ETVTISTDHGEEMTVDKQRWQNP--- 60
           ++ K+    +D    E+   +++++ S  D  +  ++ +  D   E+T D+    +P   
Sbjct: 18  TISKTTYDNRDKATVEHNHANSIQEGSNKDCEKGNSIPMPVDSCFEVTFDRDGPADPEDI 77

Query: 61  ----NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFP 116
               +  +  +   L  FT M+  +++   T  +  IM+    S   +    T+ +  F 
Sbjct: 78  ARHLSLLRKYYISSLITFTSMVITIISSCWTFVSPKIMSHFHISHEVSILGITFYI--FG 135

Query: 117 LVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGI 176
           L  G   L    + + YG +        V IIW     LT +S +    +  R   G   
Sbjct: 136 LGFGPLFL--SPISEFYGRRPTFIFSLTVSIIWQC---LTTWSRTIEGMMFGRFLSGFFG 190

Query: 177 AFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFY 236
           +  L    G I +I+   +    + I    AM  +G  LG + +G +   + K   W F 
Sbjct: 191 STFLSVAGGSISDIFDKDSITVPMAIYTTSAM--LGPELGPIISGALYKVDYK---WTFV 245

Query: 237 AYTITSIINLALSVYSIPNN 256
              I S + LAL + ++P  
Sbjct: 246 TLLIASGVCLALIIVTVPET 265

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 74/178 (41%), Gaps = 10/178 (5%)

Query: 73  IFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDI 132
           +F   +   L    TT   +++  IA+   ++ N  +W+  S+ L   +F  + G+L D+
Sbjct: 35  VFALFVGSYLAALDTTIVTTLLPTIASELDAS-NQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 133 YGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV 192
           +G K +L    +      ++CG   ++ S     I R   G+G   +  N L  I    +
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDI 150

Query: 193 SGTFRKNIVISLVGAMAPVGATLGCLFAGLIGT--KNPKQWPWAFYAYTITSIINLAL 248
               ++ +       M  +   LGC    LIG   +    W WAF      S+++ +L
Sbjct: 151 IPLRQRGV----YQGMGNIVFALGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSL 204

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 56/132 (42%), Gaps = 17/132 (12%)

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISR 169
           WL+  + L +  F+L+ GRL +I G K+ L I  +V  I SLI  L   S S    I  R
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATLISGR 103

Query: 170 AFQGLGIAFVLPNVLGIIGNIYVSGT--FRKN---IVISLVGAMAPVGATLGCLFAGLIG 224
              G G +       GI    +V GT   R+N   I+I+ +     +   +G    G   
Sbjct: 104 VVAGFGGS-------GIESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGG--A 154

Query: 225 TKNPKQWPWAFY 236
                 W W FY
Sbjct: 155 FNEHLSWRWCFY 166

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 7/127 (5%)

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISR 169
           WL+  + L +  F+L+ GRL +I G  + L I  V+  I SLI  L+   G+     +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIA 106

Query: 170 AFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPK 229
            F G GI     ++  ++G   V   +R  I+I+ +     +   +G    G        
Sbjct: 107 GFGGSGI----ESLAFVVGTSIVQENYR-GIMITALAVSYVIAEGVGPFIGG--AFNEHL 159

Query: 230 QWPWAFY 236
            W W FY
Sbjct: 160 SWRWCFY 166

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 109 TWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156
           +W+  ++ L S +F  + G++ DI+G K +L    V+  +  LICGL+
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 107/268 (39%), Gaps = 29/268 (10%)

Query: 1   MNEKSLVKSAESRQDSF-EAENESV---------SAVKKSSRHDGNEE-TVTISTDHGEE 49
           M     +  A+     F E EN S+         S +    + DG +   V  S D  + 
Sbjct: 8   MTSVDPIAGAQPSSSEFTEEENCSIHSNEVAKLGSELTNERKDDGRQSYEVAFSDDFADP 67

Query: 50  MTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRT 109
             +         Y+ +S    L  FT M+  +++   ++ TL   +II +   S+E S  
Sbjct: 68  EDIASHMSMGHRYYISS----LITFTSMVITMIS---SSWTLPSTHIIEHFHISHEVSTV 120

Query: 110 WL-MASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIIS 168
            + +  F L  G   L    L ++YG +       ++ IIW     LT +SG+    +  
Sbjct: 121 GITLYVFGLGIGPLFL--SPLSELYGRRITFLYALMLSIIWQC---LTIWSGTIAGVMFG 175

Query: 169 RAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNP 228
           R   G   +  L    G I +I+     +  I +++    A +G +LG +  G +  ++ 
Sbjct: 176 RFLSGFFGSAFLSVAGGAIADIFDKD--QIGIPMAIYTTSAFLGPSLGPIIGGALYHESY 233

Query: 229 KQWPWAFYAYTITSIINLALSVYSIPNN 256
           K   W F    ITS   L L +++IP  
Sbjct: 234 K---WTFITLLITSGCCLVLIIFTIPET 258

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 60/147 (40%), Gaps = 8/147 (5%)

Query: 90  TLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIW 149
            +++ + I   F    N   WLMA + L +  F+L+ GR+  + GLK  L    V+    
Sbjct: 27  CITLYDTIGQEFNDYANV-GWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAG 85

Query: 150 SLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMA 209
           SL+ G     G     I +R   G G + +   V G +G   V    R   VI+++G   
Sbjct: 86  SLMAGAANSMG---MLIGARVISGFGGSGIESLVYG-VGTSIVEEKHRAR-VITVLGIAY 140

Query: 210 PVGATLGCLFAGLIGTKNPKQWPWAFY 236
            +    G    G  G      W W FY
Sbjct: 141 MLAEGAGPFVGG--GLAEHVSWRWCFY 165

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 10/146 (6%)

Query: 92  SIMNIIANSFGSNENSRT-WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           +I+  +A  FG  + S+T W+ A + L S    LI GR+  + G K  +    ++  + S
Sbjct: 77  TIIENVAREFG--DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGS 134

Query: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210
           L+  L   + S    I  R   GLG + +      II  +      ++ ++I+ +G+   
Sbjct: 135 LVAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEES--KRGLLIACMGSAFG 189

Query: 211 VGATLGCLFAGLIGTKNPKQWPWAFY 236
           + + +G    G   T     W W F+
Sbjct: 190 IASVVGPFLGGAFTTH--VTWRWCFW 213

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 88  TQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVII 147
           T   +IMN IA  F  ++  + W+  S+ L + +F  + G+L DI G K  +   +    
Sbjct: 60  TVVANIMNSIAAEFAESDK-KQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---F 115

Query: 148 IWSLICGLTKYSGSDTFFIISRA 170
            ++L C LT ++ + T F I+RA
Sbjct: 116 FFALGCLLTCFAQNVTQFSIARA 138

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 88/412 (21%), Positives = 151/412 (36%), Gaps = 34/412 (8%)

Query: 92  SIMNIIANSFGSNENS---RTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIII 148
           +I++ +    GS  NS    +W+  S+ L S +   + G+L D  G K +L     V  I
Sbjct: 104 TIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAI 163

Query: 149 WSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAM 208
             LICGL   S S    +  R   G+G   +      I+ ++      R   V      +
Sbjct: 164 GCLICGL---SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLV---PLRDRAVYQ---GL 214

Query: 209 APVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSI---PNNIPTNIQHFS 265
                 LG    GL+G    + W  AF      S+++  L V  +   P    +N   +S
Sbjct: 215 CNFVFGLGTASGGLVGAYF-RDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWS 273

Query: 266 -----MDWIGSALGVIGLVLMNFVWNQAPISGWDQAYXXXXXXXXXXXX----XXXXXYE 316
                +DW G A  +I  + +  +   + + G   AY                      E
Sbjct: 274 ARLRRLDWAG-ATSLIAFLFLFML--TSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVE 330

Query: 317 NRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFY---YFQFQLNIRHYSAVWAGG 373
            R A  P+LP   L+DR ++   LA +F   S     FY   Y+   L ++         
Sbjct: 331 LRVAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAM 390

Query: 374 TYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTM 433
             F  + +G + A   G+Y+K+     +  L+     I   +  V    +     Q    
Sbjct: 391 PSFFSVAFGSLGA---GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQ 447

Query: 434 IILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 485
           ++  FG+      + +     +P E+     S+     +   +L + +GA V
Sbjct: 448 VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAV 499

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 20/147 (13%)

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISR 169
           WL+  + L +  F+L+ GRL +I G  + L I  ++  + SLI  L+   G+     +  
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIA 106

Query: 170 AFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMA---PVGATLGCLFAGLIGTK 226
            F G GI     ++  ++G   V    R  ++ +L  +      VG  +G  F       
Sbjct: 107 GFGGSGI----ESLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAF------N 156

Query: 227 NPKQWPWAFYAYTITSIINLALSVYSI 253
               W W FY       INL +  +++
Sbjct: 157 EHLSWRWCFY-------INLPIGAFAL 176

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 89/210 (42%), Gaps = 19/210 (9%)

Query: 30  SSRHDGNEETVTISTDHGEEMTVDKQRWQN--PNYFKNSWHEYLFIFTCMISQLLNQAGT 87
           ++R   ++++   ++  GE  T D++  ++  P+   + W+++  +    +    +  G+
Sbjct: 56  TTRELHSDDSSIDTSLDGELSTPDEEAQEHTPPHSMLSYWNKWGMVAVLTMCGFWSSLGS 115

Query: 88  TQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVII 147
                 +  +   F  +EN     +  + +  G    +SG L DIYG + ++  G +V +
Sbjct: 116 PIYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYV 175

Query: 148 IWSL-ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVS---GTFRKNIVIS 203
           + S+ I     Y       I  R  Q  GI+ ++    G +G+  V    GTF       
Sbjct: 176 VASIGIAACNSYG----VIIFLRCLQSTGISPLIAISSGAVGDFTVKAERGTF------- 224

Query: 204 LVGAMAPVGATLGCLFAGLIGTKNPKQWPW 233
            VGA++ +   +G  F  LIG      + W
Sbjct: 225 -VGAVSGL-VLMGQAFGSLIGAALAAAYNW 252

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 59/149 (39%), Gaps = 20/149 (13%)

Query: 94  MNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLIC 153
           + +IA  F     S  W+++ + L      L+ GR   I G K  L +  ++    SLI 
Sbjct: 142 IEVIAEQFKDYSKS-GWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 154 GLTKYSGSDTFFIISRAFQGLG------IAFVLPNVLGIIGNIYVSGTFRKNIVISLVGA 207
            +   S S    I  R   G+G      + FV+ + L        +    + I+IS++  
Sbjct: 201 AI---SNSMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISVLSC 249

Query: 208 MAPVGATLGCLFAGLIGTKNPKQWPWAFY 236
              V A +G    G + T     W W FY
Sbjct: 250 SYAVAAVVGPFLGGALTTH--VTWRWCFY 276

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 89/247 (36%), Gaps = 16/247 (6%)

Query: 22  ESVSAVKKSSRHDGNEETVTIST-----DHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTC 76
           +S+  +  +   DG   ++ ++      D+ +   VDK      +   N W     +F+ 
Sbjct: 3   KSIRHISPNKNKDGIYGSIEVTETSLVEDNADIEDVDKDEDMALSRIPNLWIIEATLFS- 61

Query: 77  MISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLK 136
             +  L+    T T S    I N F     S  W+  ++ + S SF  + G   D  G +
Sbjct: 62  --NVFLSGFDGTVTASTYQTIGNEFNQMSISN-WITTAYLITSTSFQPLYGSFSDALGRR 118

Query: 137 KMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTF 196
             L        I  L C L     S   + +S      GI       L  I N  V  + 
Sbjct: 119 NCLFFANAAFTIGCLACSL-----STNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSS 173

Query: 197 RKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNN 256
           ++ I  +    +   GA  G  F G I +     W W F      SII+  L  Y +PN 
Sbjct: 174 KRGIFQAFQNLLLGFGAICGASFGGTIAST--IGWRWCFLIQVPISIISSVLMNYYVPNQ 231

Query: 257 IPTNIQH 263
              N ++
Sbjct: 232 KEYNHEN 238

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 94/243 (38%), Gaps = 38/243 (15%)

Query: 18  EAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFT-- 75
           E  + +V   +KS     N+    +ST   +E+  +K   Q P+  +        + +  
Sbjct: 7   ERASTAVDVSRKSDNKISNDSVSLLSTPSNKELEEEKGDLQRPSEDETPASVSPLVPSGI 66

Query: 76  ----CMISQLLN--------QAGTTQTLSIMNIIANSFGSNENS--------RTWLMASF 115
               C++  ++          +GT             FGS            RT L+ S 
Sbjct: 67  NWGICILCLMVAFGGYISGWDSGTIGGFEAHTDFLARFGSTSGEGKRYLSKVRTGLLTSM 126

Query: 116 PLVS---GSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQ 172
             V    GSF L  GRLGDIYG +  L +  V+ II ++I   +  +     ++I R   
Sbjct: 127 FNVGQAIGSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQ--YMIGRIIA 182

Query: 173 GLGIAFVLPNVLGIIGNIYVSGTFRKNI---VISLVGAMAPVGATLG-CLFAGLIGTKNP 228
           GLG   +      I+  + +S    KN+   ++S    M  +G  LG C   G     N 
Sbjct: 183 GLGCGLI-----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKKYHNS 237

Query: 229 KQW 231
           +QW
Sbjct: 238 RQW 240

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 89/241 (36%), Gaps = 40/241 (16%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60
           +N    +  A +R+   + E+E+       S H G+++      D  +++T +       
Sbjct: 46  VNSHGTLSKATTREIEGDLESET-------SSHSGDDKI-----DPQQQITAETGAPYTL 93

Query: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
             +   W     +  C      +  G+      +  +   F  +EN     +  + L  G
Sbjct: 94  LSYGQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQG 150

Query: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180
               ISG L D +G + ++  G ++ ++ S+        G   F    R  Q +GI+  +
Sbjct: 151 VSPTISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFL---RCIQSIGISPTI 207

Query: 181 PNVLGIIGNI---YVSGTFRKNIVISLVGAMAPVGAT-----LGCLFAGLIGTKNPKQWP 232
               G++G+    +  GTF              VGAT     LG  F  LIG     +W 
Sbjct: 208 AISSGVVGDFTLKHERGTF--------------VGATSGFVLLGQCFGSLIGAVLTARWD 253

Query: 233 W 233
           W
Sbjct: 254 W 254

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 66/145 (45%), Gaps = 8/145 (5%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I+  +A  FGS  +   WL   + L +    LI GR+    G K+ +    V+  I SL
Sbjct: 89  TIIEEVAKQFGS-YSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           I  L   + S +  I  R   G+G    + ++  +IG+  V  + ++ I+I+++     +
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVG-GCGIQSLSFVIGSTLVEES-QRGILIAVLSCSFAI 202

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFY 236
            + +G    G+    +   W W FY
Sbjct: 203 ASVVGPFLGGVF--TSSVTWRWCFY 225

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 110/258 (42%), Gaps = 21/258 (8%)

Query: 3   EKSLVKSAESRQDSFEAENESVSAVKKSS--RHDGNE-ETVTISTDHGEEMTVDKQRWQN 59
           + S + S E    S  ++  +   ++ +S  ++DG +   VT + D  +   + +     
Sbjct: 11  QSSALTSTEEEHCSINSDKAAKLDLELTSERKNDGKQSHEVTFNEDIADPEDIARHMSTA 70

Query: 60  PNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWL-MASFPLV 118
             Y+ +S    L  FT M+  +++   ++ TL   +II +   S+E S   + +  F L 
Sbjct: 71  RRYYISS----LITFTSMVITMIS---SSWTLPSTHIIEHFHISHEVSTLGITLYVFGLG 123

Query: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAF 178
            G   L    L ++YG +        + IIW     LT +S + T  +  R   G   + 
Sbjct: 124 IGPLFL--SPLSELYGRRITFLYALTLSIIWQC---LTIWSKTITGVMFGRFLSGFFGSA 178

Query: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAY 238
            L    G I +I+     +  I +++    A +G +LG +  G +  ++ K   W F   
Sbjct: 179 FLSVAGGAIADIFDKD--QIGIPMAIYTTSAFLGPSLGPIIGGALYHQSYK---WTFITL 233

Query: 239 TITSIINLALSVYSIPNN 256
            ITS   L + +++IP  
Sbjct: 234 LITSGCCLVMIIFTIPET 251

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 21  NESVSAVKKSSRHDG-NEETVTIST----DHGEEMTVDKQRWQNPNYFKNSWHEYLFIFT 75
             +VS+  K +  D  N+  ++IS     ++ EE   D+Q   +      S   +L++  
Sbjct: 11  TRTVSSSNKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLDDETTPLSRIPHLWLIE 70

Query: 76  CMI--SQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIY 133
             +  +  L+   +T T S    I N F   + S +W+ AS+ + S SF  + G   D+ 
Sbjct: 71  AALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLS-SWITASYLITSTSFQPLYGSFSDVL 129

Query: 134 GLKKMLTIGYVVIIIWSLICGLT 156
           G +K L    ++  I  L CG++
Sbjct: 130 GRRKCLFFASMIFSIGCLGCGIS 152

>KAFR0D01550 Chr4 complement(307032..308585) [1554 bp, 517 aa] {ON}
           Anc_8.783 YOR306C
          Length = 517

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 59/136 (43%), Gaps = 21/136 (15%)

Query: 19  AENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMI 78
           A N+S + + +++R DG+   +   ++  + +T D++     ++ +     +L  F C  
Sbjct: 55  ASNDSNNLINRNTRLDGDHSFMEEQSEDEKSLTFDEE-----DFPEGGLRAWLVTFGCF- 108

Query: 79  SQLLNQAGTTQTLSIMNI---IANSFGSNENSRT------WLMASFPLVSGSFILISGRL 129
                  G      I+NI   I  S   N+ S        W+ + F  +  SF + SG  
Sbjct: 109 ------CGLIPIFGIVNITSVIEESIQENQLSSYSSSSIGWIFSLFIFICFSFGIFSGTY 162

Query: 130 GDIYGLKKMLTIGYVV 145
            D  G KK++ +G V+
Sbjct: 163 FDRNGFKKVVAVGTVI 178

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 57/145 (39%), Gaps = 25/145 (17%)

Query: 97  IANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLT 156
           +   F  +EN     +  + L  G    +SG L D +G + ++  G ++ +I S+     
Sbjct: 127 LEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASIGLACA 186

Query: 157 KYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNI---YVSGTFRKNIVISLVGAMAPVGA 213
              G   F    R  Q +GI+  +    G++G+    +  GTF              VGA
Sbjct: 187 PSYGVIIFL---RCIQSIGISPTIAISSGVVGDFTLKHERGTF--------------VGA 229

Query: 214 T-----LGCLFAGLIGTKNPKQWPW 233
           T     LG  F  LIG     +W W
Sbjct: 230 TSGFVLLGQCFGSLIGAVLTARWDW 254

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%)

Query: 315 YENRFAKSPLLPRAVLKDRHMIQIMLALF 343
           +E +FA+ PL PR+VLKDR +I  ++  F
Sbjct: 320 WEAKFARFPLTPRSVLKDRGVIAALVIAF 348

>KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 98/238 (41%), Gaps = 36/238 (15%)

Query: 19  AENESVSAVKKSSRHDGNEETVT--ISTDHGEEMTVDKQRWQN---PNYFKNSWHEYLFI 73
           AE +SV  +  S  +   + TV+  +S +  ++ + D+Q  Q    P    +++ +++ +
Sbjct: 3   AEQQSVQELDASVSNRSQQSTVSNKVSDNEIKDESYDEQAGQEITLPKKPISAYSKFIIL 62

Query: 74  FTCM-------------ISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
             C+             IS  + Q    Q    +N     + SN   R  L+     +  
Sbjct: 63  SLCVAFGGFIFGWDTGTISGFVAQTDFLQRFGELNSSGEYYLSN--VREGLIVGIFNIGC 120

Query: 121 SFI-LISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAFQGL--- 174
           +F  +I  +LGD+YG K  LT   ++ I+  +IC     +  D +  + I R   GL   
Sbjct: 121 AFGGIILSKLGDMYGRKIGLTCVTIIYIVGQVIC----IASVDKWYQYFIGRIVAGLGVG 176

Query: 175 GIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLG-CLFAGLIGTKNPKQW 231
           GIA + P ++      ++ GT     ++S    M   G  LG C   G     N  QW
Sbjct: 177 GIAVLSPMLISETSPKHLRGT-----LVSCYQLMCTAGIFLGYCTNYGTSKYSNSVQW 229

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 76/183 (41%), Gaps = 30/183 (16%)

Query: 178 FVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV----GATLGCL---FAGLIGTKNPKQ 230
           F++P    +I N +VSG    NIV SL G++AP     G  + C+   F+ LI       
Sbjct: 188 FLIP----VIINTWVSG----NIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILV----- 234

Query: 231 WPWAFYAYTITSIINLALSVYSIP---NNIPTNIQHFSMD--WIGSAL--GVIGLVLMNF 283
            P+A+  Y   S  N  L  + +     N+   I  F+ D   IG  L    + LVL+  
Sbjct: 235 LPYAYAQYI--SWRNGTLPPFKLKEKGQNLRQTIWKFAEDINLIGIILFTAFLVLVLLPL 292

Query: 284 VWNQAPISGWDQAYXXXXXXXXXXXXXXXXXYENRFAKSPLLPRAVLKDRHMIQIMLALF 343
                  S W + Y                 +E RFAK+P +PR  L D   I + L + 
Sbjct: 293 TIAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPRVYLGD-PTIYVALLME 351

Query: 344 FGW 346
           F W
Sbjct: 352 FVW 354

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +IMN +A  F    + + W+  SF L + +F  + G+L DI G +  L   +     + L
Sbjct: 55  NIMNRVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH---FFFGL 110

Query: 152 ICGLTKYSGSDTFFIISRA 170
            C LT ++ S   F ++RA
Sbjct: 111 GCLLTCFAQSVEQFALARA 129

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 105/253 (41%), Gaps = 21/253 (8%)

Query: 8   KSAESRQDSFEAENESVSAVKKSS-RHD--GNEETVTISTDHGEEMTVDKQRWQNPNYFK 64
           K  E    S   + E+   ++ SS R+D  G E  V    D  +   + +       Y+ 
Sbjct: 16  KLTEEEHCSILLDREAKLDLELSSERNDDGGKEHEVIFREDLADPEDIARHMSTVRRYYI 75

Query: 65  NSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWL-MASFPLVSGSFI 123
           +S    L  FT M+  +++   ++ TL   +II +   S+E S   + +  F L  G   
Sbjct: 76  SS----LITFTSMVITMIS---SSWTLPSAHIIKSFHISHEVSTLGITLYVFGLGIGPLF 128

Query: 124 LISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNV 183
           L    L ++YG +        + IIW     LT +S + T  +  R   G   +  L   
Sbjct: 129 L--SPLSELYGRRITFLYALTLSIIWQC---LTIWSRTITGVMFGRFLSGFFGSAFLSVA 183

Query: 184 LGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSI 243
            G I +I+     +  I +++    A +G +LG +  G +  ++ K   W F    ITS 
Sbjct: 184 GGAIADIFDKD--QIGIPMAIYTTSAFLGPSLGPIIGGALYHESYK---WTFITLLITSG 238

Query: 244 INLALSVYSIPNN 256
             L L +++IP  
Sbjct: 239 CCLVLIMFTIPET 251

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 93/248 (37%), Gaps = 34/248 (13%)

Query: 32  RHDGNEETVTIST--DHGEE--MTVDKQRWQ--NPNYFK-------NSWHEYLFIFTCMI 78
           R +G  E   I +  DHGE   + V   + +  N + F+       +   + L +  C  
Sbjct: 14  RPEGESERDEIGSGPDHGETSGLAVSNSQSEVGNESDFELEPYSRFSHTQKMLLVVQCAF 73

Query: 79  SQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKM 138
           +   +    +    ++ +I   F   E      +  + +  G    I G L D +G +  
Sbjct: 74  TGFFSTVAGSIYYPVLTVIEKKFNITEELANVTIVVYFVFQGLAPSIMGGLADTFGRRP- 132

Query: 139 LTIGYVVIIIWSLI---CGLTKYSGSDTF--FIISRAFQGLGIAFVLPNVLGIIGNIYVS 193
                  +++W+++   C     + S  +   +  R  Q  GI+ V+    GI+G+  V+
Sbjct: 133 -------VVLWAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGD--VT 183

Query: 194 GTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWA--FYAYTITSIINLALSVY 251
               +   + LV     VG      F  LIG     +W W   F+   I S I L +S  
Sbjct: 184 TKVERGGYVGLVSGFQVVGTA----FGALIGAGLSSRWGWRAIFWFLAIGSGICLVVSAL 239

Query: 252 SIPNNIPT 259
            +P    T
Sbjct: 240 LLPETKRT 247

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 97/267 (36%), Gaps = 30/267 (11%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQN- 59
           +NE+  V       D +  +      V+     D +E  + IS  + +      +  QN 
Sbjct: 8   LNEQEKVDITPRSSDGYTHK------VRSYHNDDDDESVINISDINPKNQLCQTKSNQNE 61

Query: 60  -----PNYFK-NSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMA 113
                P Y +  +  + + +  C  +   +         ++++I N F   E      + 
Sbjct: 62  PDIASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITVV 121

Query: 114 SFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAF 171
            + +  G    I G L D  G + ++    +V       C     + S T+   I+ R  
Sbjct: 122 VYFIFQGIAPSIMGGLADSMGRRPVVLSSVLV-----YCCACIGLACSHTYAQIIVLRCL 176

Query: 172 QGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLF-AGLIGTKNPKQ 230
           Q  GI+ V+    GI+G+I       +   +  V     +G+  G L  AGL  T     
Sbjct: 177 QAAGISPVIAINSGIMGDITTRA--ERGGYVGYVSGFQVIGSAFGALIGAGLSAT----- 229

Query: 231 WPWA--FYAYTITSIINLALSVYSIPN 255
           W W   F+   I S + L  S+  +P 
Sbjct: 230 WSWRSIFWFLAIGSGVCLVASIIILPE 256

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 89/243 (36%), Gaps = 46/243 (18%)

Query: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGN---EETVTISTDHGEEMTVDKQRWQ 58
           N    +  A +R+   + E+E+       S H G+   + T  I+T+ G   T+      
Sbjct: 46  NSHGTLSKATTREIEGDLESET-------SSHSGDVKGDSTQQITTEIGAPYTLLS---- 94

Query: 59  NPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLV 118
               +   W     +  C      +  G+      +  +   F  +EN     +  + L 
Sbjct: 95  ----YGQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLF 147

Query: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAF 178
            G    +SG L D +G + ++  G ++ ++ S+        G   F    R  Q +GI+ 
Sbjct: 148 QGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFL---RCIQSIGISP 204

Query: 179 VLPNVLGIIGNI---YVSGTFRKNIVISLVGAMAPVGAT-----LGCLFAGLIGTKNPKQ 230
            +    G++G+    +  GTF              VGAT     LG  F  LIG     +
Sbjct: 205 TIAISSGVVGDFTLKHERGTF--------------VGATSGFVLLGQCFGSLIGAVLTAR 250

Query: 231 WPW 233
           W W
Sbjct: 251 WDW 253

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I+  +A  FGS  +   WL   + L +    LI GR+    G K+ +    V+  + SL
Sbjct: 98  TIIEEVAKQFGS-YSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL 156

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           I  L   + S    I  R   G+G    + ++  +IG+  V  + R  ++I+++     +
Sbjct: 157 ISAL---ANSMNVLIGGRVIAGVG-GCGIQSLSFVIGSNLVEESNR-GVLIAILSCSFAI 211

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFY 236
            + +G    G+  ++    W W FY
Sbjct: 212 ASVVGPFLGGVFTSR--VTWRWCFY 234

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 75/189 (39%), Gaps = 17/189 (8%)

Query: 13  RQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPN-----YFKNSW 67
            + + E +N  +   +K  + D   +     TD   ++++        N     Y + S 
Sbjct: 25  EEHATEPQNLYMEHAEKIQKTDNRLDV----TDSNRQLSLLNSTKSETNFDGIPYTRFSK 80

Query: 68  HEYLF-IFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILIS 126
           H+ LF +  C +S   +    T     ++II   F  + +     +  + L  G F +I 
Sbjct: 81  HDKLFLVVICALSGFYSTIAQTIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIFPVIM 140

Query: 127 GRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAFQGLGIAFVLPNVL 184
           G L D  G +    +    I+++   C     +   TF   I  R  QG GI+ ++    
Sbjct: 141 GGLADRLGRRP---VAMFCIMVY--FCACIGIACCRTFGEMIFLRCLQGGGISPIIAINN 195

Query: 185 GIIGNIYVS 193
           G++G+I V 
Sbjct: 196 GLMGDITVK 204

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 51/119 (42%), Gaps = 8/119 (6%)

Query: 36  NEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMN 95
           +  T T   D GEE T        P   +      + +   ++   L+   TT   +++ 
Sbjct: 14  SPTTETALVDTGEESTTSHSELP-PTKVR------ITVLALLMGSFLSALDTTIVATLLP 66

Query: 96  IIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICG 154
            IA+   ++    +W+  ++ L   +F  + G+L DI+G K +L +  +   +   ICG
Sbjct: 67  TIASDLDASSQ-MSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG 124

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 46/115 (40%), Gaps = 37/115 (32%)

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICG--------------- 154
           W+  S+ L S  F  + G+L DI+G K +L    ++     +ICG               
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVA 495

Query: 155 ---------LTKYSGSDTFFIISRA--------FQGLGIAFVLPNVLGIIGNIYV 192
                    +T  + SD   + SRA        F GLG AF      G+IG I+V
Sbjct: 496 GIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFG-----GVIGGIFV 545

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 90/232 (38%), Gaps = 29/232 (12%)

Query: 14  QDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEE-MTVDK--------QRWQNPNYFK 64
            +S E ++ S+ + +      G++     ST HG+  MT DK         R + P    
Sbjct: 3   NESIENDDISIESGEVPRLIHGDD-----STKHGDMVMTNDKPIENNGTISRNEAPYTLL 57

Query: 65  NSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFIL 124
           +   ++  +    +    +  G+      +  +   F  +E+     +  + L  G    
Sbjct: 58  SYGQKWGMVALLTMCTFWSSLGSPIYYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPT 117

Query: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184
            SG L DIYG + ++ IG ++ +  S+  GL   S S    +  R  Q   I+  +    
Sbjct: 118 FSGGLADIYGRRPVIVIGMIIYVAVSV--GLA-CSNSYGVLVFLRILQSACISPTIAISS 174

Query: 185 GIIGNI---YVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPW 233
           G +G+    +  GTF        VGA +   A LG  F  LIG      W W
Sbjct: 175 GFVGDFTLKFERGTF--------VGATSGF-ALLGQAFGSLIGAALAAAWDW 217

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 57/146 (39%), Gaps = 10/146 (6%)

Query: 92  SIMNIIANSFGSNENSRT-WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           +IM  +A  F  N  S T WL+  + L +    L+ GR G + G K  + +  V+  + S
Sbjct: 97  TIMETVAAKF--NGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGS 154

Query: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210
           LI        S T  I  R   G+G + +      I   +    T  +   IS++     
Sbjct: 155 LIAAAAT---SMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFA 209

Query: 211 VGATLGCLFAGLIGTKNPKQWPWAFY 236
           V +  G    G   T     W W FY
Sbjct: 210 VASVAGPFLGGAFATH--VTWRWCFY 233

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           ++MN IA  F    + + W+  SF L + +F  + G+L D+   +K+ T+         L
Sbjct: 62  NVMNRIAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGL 120

Query: 152 ICGLTKYSGSDTFFIISRAFQGLG 175
           I  ++ ++ + T F I RA  G+G
Sbjct: 121 I--ISCFAQNVTQFAIGRAVCGIG 142

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 94/266 (35%), Gaps = 30/266 (11%)

Query: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNP 60
           M   S+ K      D+   +  S  A+  +     N  +  I  +   +M V   R+ + 
Sbjct: 9   MRNASIAKEEREGSDNNNVDRSSSDAISDNDAERSNSHS-EIDNESNFDM-VPYSRFSHK 66

Query: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120
                   + L +  C  +   +    +    ++ II   F   E      +  + +  G
Sbjct: 67  -------QKMLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQG 119

Query: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLI---CGLTKYSGSDTF--FIISRAFQGLG 175
               I G L D +G +         I++W+++   C     + +  +   +  R  Q  G
Sbjct: 120 VAPSIMGGLADTFGRRP--------IVLWAILAYFCACIGLACAHNYAQILALRCLQAAG 171

Query: 176 IAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWA- 234
           I+ V+    GI+G+  V+    +   + LV     VG   G     LIG     +W W  
Sbjct: 172 ISPVIAINSGIMGD--VTTKVERGGYVGLVAGFQVVGTAFG----ALIGAGLSSKWGWRA 225

Query: 235 -FYAYTITSIINLALSVYSIPNNIPT 259
            F+   I S I L  S   +P    T
Sbjct: 226 IFWFLAIGSGICLVFSTLLMPETKRT 251

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 62/145 (42%), Gaps = 8/145 (5%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I++ +  SFG    S  W++  + L +  F L+ GRL  + G +  +    ++    SL
Sbjct: 66  TIIDTVCTSFGDYTKS-GWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSL 124

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           I  L K   S    I  R   G+G    L  +  +IG   V+   R  +V+SL+     V
Sbjct: 125 ISALAK---SMNMLISGRVIAGVG-GSGLQTLSLVIGCQLVNEKSRP-LVLSLLNCTFAV 179

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFY 236
            + +G    G   T     W W FY
Sbjct: 180 ASIVGPFLGGAFTTH--VTWRWCFY 202

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 93  IMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLK 136
           IMN +A  F ++ N + W+  S+ L + +F  + GRL DI G K
Sbjct: 89  IMNRVAEDFNAS-NQKQWIATSYLLTNTAFQPLYGRLSDIIGRK 131

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 109/291 (37%), Gaps = 24/291 (8%)

Query: 11  ESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEY 70
           ES +D  +   E +   K+ +     EET   S +  +E          P Y   S  + 
Sbjct: 88  ESEEDIEKKSKEELKIEKRIATATSTEETSLKSANRSKE---------PPPYTAFSKKQR 138

Query: 71  LFIFTCMI-SQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRL 129
           L IF  +I    L        +  + ++  SF  +  +    ++ F  V     L     
Sbjct: 139 LIIFLVIIYVGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALF 198

Query: 130 GDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 189
            D  G K +  +  ++ II +++      +    FF+  R  Q  G + V+   +G + +
Sbjct: 199 ADFGGRKFLYIVSLLLTIIVNILLSAVPTNIGALFFL--RIAQAFGSSSVMSLGIGTVSD 256

Query: 190 IYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALS 249
           I    +  + +   ++G    +G  L  + AGLI   +   W W F    I S I L L 
Sbjct: 257 ITPPKSRGRAVSYFMLGPN--MGPILAPIIAGLILMSS-NNWRWLFGFICIISGIALFLV 313

Query: 250 VYSIP--------NNIPTNIQHFSMDWIGSALGVIG-LVLMNFVWNQAPIS 291
           V  +P        N  P   + + +D    AL     L L  F+  Q P+S
Sbjct: 314 VLLLPETLRCIVGNGDPHWREDYQLDAESQALKAGNRLQLCKFIGIQVPVS 364

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 83/230 (36%), Gaps = 36/230 (15%)

Query: 12  SRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYL 71
           S+  + E E +  S     S  D  + ++ I+T+ G   T+          +   W    
Sbjct: 53  SKATTREIEGDLESETSSHSGDDKLDPSLPITTETGAPYTLLS--------YGQKWGMVA 104

Query: 72  FIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGD 131
            +  C      +  G+      +  +   F  +EN     +  + +  G    + G L D
Sbjct: 105 VLTMC---GFWSSLGSPIYYPALRQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLAD 161

Query: 132 IYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNI- 190
            +G + ++  G +V ++ S+        G   F    R  Q +GI+  +    G++G+  
Sbjct: 162 CFGRRPIILGGMLVYVVASVGLACAPSYGVIIFL---RCVQSIGISPTIAISSGVVGDFT 218

Query: 191 --YVSGTFRKNIVISLVGAMAPVGAT-----LGCLFAGLIGTKNPKQWPW 233
             +  GTF              VGAT     LG  F  LIG     +W W
Sbjct: 219 LKHERGTF--------------VGATSGFVLLGQCFGSLIGAVLTARWDW 254

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 124 LISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAFQGL---GIAF 178
           L  GRLGDIYG K    IG + +I+  ++  + + + +D +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDIYGRK----IGLMCVILVYIVGIVIQIASTDKWYQYFIGRIISGMGVGGIAV 177

Query: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLG-CLFAGLIGTKNPKQW 231
           + P ++      ++ GT      +S    M  +G  LG C   G     N  QW
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSIQW 226

>Skud_15.474 Chr15 complement(829767..831335) [1569 bp, 522 aa] {ON}
           YOR306C (REAL)
          Length = 522

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 57/276 (20%), Positives = 106/276 (38%), Gaps = 33/276 (11%)

Query: 5   SLVKSAESRQDSFEAENESVSAVKKSSRHDGNEE-TVTISTDHGEEMTVDKQRWQNPNYF 63
           SL  +A        A+  +  A  K++  +G    + T S  H  +        +  N+ 
Sbjct: 42  SLETTASYASTLVSAKGYTKKAEHKTTDIEGRPHWSETTSRTHESDSEEGDSNGEAENFP 101

Query: 64  KNSWHEYLFIFTCMIS-----QLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLV 118
           +     ++  F C +       LLN  G  ++    N +AN    + ++  WL + F  V
Sbjct: 102 EGGLKAWVVTFGCFLGLIACFGLLNSTGVIESHLQDNQLANE---SVSTIGWLFSLFLFV 158

Query: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAF-QGLG 175
             +  +ISG   D  G + ++ +G V       + GL   + S  +  FI+S A   G G
Sbjct: 159 CFASCIISGTYFDRNGFRTIMIVGTVF-----HVAGLFATANSTKYWHFILSFAIVCGFG 213

Query: 176 IAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLG---------CLFAGLIGTK 226
              VL  ++ +  + +     R+   +    AMA +G ++G           F+  + T 
Sbjct: 214 NGIVLSPLVSVPAHYFFK---RRGTAL----AMATIGGSVGGVVFPIMLRSFFSMKLDTD 266

Query: 227 NPKQWPWAFYAYTITSIINLALSVYSIPNNIPTNIQ 262
               + W         +  LALS+  +   +P  I+
Sbjct: 267 PSYGFVWGIRTLGFLDLALLALSIVLVKERLPHVIE 302

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 63/143 (44%), Gaps = 15/143 (10%)

Query: 110 WLMASFPL--VSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFII 167
           W+ + F L  + GSF   +G   D YG KK+     VV+ I SL+     YS +    +I
Sbjct: 78  WITSIFSLGGLLGSFY--AGSWADHYGRKKVSIASSVVVTIGSLV---LFYSNTYLQLLI 132

Query: 168 SRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTK- 226
            R   G+     L     +I  +Y++         +L GAM  V   LG L   L+  + 
Sbjct: 133 GRTIVGIACGVYL-----VITPLYINEIAPAQHRGAL-GAMNQVAINLGILLTQLLALRY 186

Query: 227 -NPKQWPWAFYAYTITSIINLAL 248
            +  +W W F+A  +  ++ L +
Sbjct: 187 TDSFRWRWLFFAGVVLGLLTLVM 209

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184
           ISG L D+YG + ++  G ++ ++ S+    +   G   F    R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL---RCVQSAGISPLIAISS 208

Query: 185 GIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPW 233
           G++G+ + + + R     S VGA++   A +G  F  LIG      + W
Sbjct: 209 GVVGD-FTTKSERG----SFVGAVSGF-ALMGQAFGSLIGAGLTAAYDW 251

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 91/239 (38%), Gaps = 5/239 (2%)

Query: 259 TNIQHFSMDWIGSALGV--IGLVLMNFVWNQAPISGWDQAYXXXXXXXX-XXXXXXXXXY 315
           T I  + +D+IG  L V   GLVL+ F         W  A                   +
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 316 ENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTY 375
           E +FAK PL P   +KDR +   ++   F   +F +   Y +   L   + +   A    
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRIN 388

Query: 376 FMFLIWGIIAALLVGIYIKKVSPSV-FLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMI 434
            +F     ++  L+G+ I KV  +  F+F  +  + +   +          +   +  + 
Sbjct: 389 SLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIAVWFLSFGLLERYTGGTNAYAGIIAALC 448

Query: 435 ILSFGMDF-SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPD 492
           +L FG  F  +P  + + +  L  E   +  SL   +     S+   +   + T+V PD
Sbjct: 449 LLGFGNGFIKYPTKASMQASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPD 507

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 78  ISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKK 137
           +   L+   TT   +++  IA+   ++    +W+  S+ L   +F  + G+L DI+G K 
Sbjct: 49  LGSFLSALDTTIVSTLLPTIASDLDASSQ-MSWIATSYLLSCSAFQPLYGKLSDIFGRKI 107

Query: 138 MLTIGYVVIIIWSLICG 154
           +L    +V  I   +CG
Sbjct: 108 LLVWSNLVFAIGCALCG 124

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 97/253 (38%), Gaps = 25/253 (9%)

Query: 11  ESRQDSFEA---ENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSW 67
           ES  DS+     + +SV   K     D      T S  H E  T+D+     P Y +   
Sbjct: 42  ESDMDSYNPITFDQDSVEIDKLDEPIDTTSLYKTKSGQHNEP-TLDE-----PPYSRFGR 95

Query: 68  HEYLF-IFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILIS 126
            E +F +  C  + L +    +    +++++   F   E      +  + +       + 
Sbjct: 96  KEKIFLVIQCAFTGLFSSIAGSIYYPVLSVMEKEFYITEEQVNVSVVVYFIFQALSPTLM 155

Query: 127 GRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGI 186
           G L D  G ++ + +  +V+   + I GL + +       + R  Q  GI+ V+    GI
Sbjct: 156 GGLADSLG-RRPVVLSSIVLYFCACI-GLARCTNYSQLIGL-RCLQAAGISPVIAVNSGI 212

Query: 187 IGNIYVSGTFRKNIVISLVGAMAPVGAT--LGCLFAGLIGTKNPKQWPWA--FYAYTITS 242
           +G++               G M  V  T  LG  F  LIG     +W W   F+   I S
Sbjct: 213 MGDVTTKAERG--------GYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFWFLVIGS 264

Query: 243 IINLALSVYSIPN 255
            I L +S+  +P 
Sbjct: 265 GICLIVSIIVLPE 277

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 88/397 (22%), Positives = 148/397 (37%), Gaps = 51/397 (12%)

Query: 92  SIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSL 151
           +I++ +  SFG    S  W++  + L +  F L+ GR+    G +  +    V+    SL
Sbjct: 65  TIIDTVCKSFGDYTKS-GWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAGSL 123

Query: 152 ICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPV 211
           I  L +   S    I  R   G+G    L  +  +IG   V    R  +V+SL+     +
Sbjct: 124 ISALAR---SMNMLIAGRVVSGVG-GSGLQTLSLVIGCQLVDEKSRP-LVLSLLNCTFAI 178

Query: 212 GATLGCLFAGLIGTKNPKQWPWAFYA-YTITSIINLALSVYSIPNN-------------- 256
            + +G    G   T     W W FY    I  +  L    +  P+N              
Sbjct: 179 ASIIGPFIGGAFTTH--VTWRWCFYINLPIGGVAILTFLCFYNPHNENLLEEGKKAFKRV 236

Query: 257 ---IPTNI-----QH---FSMDWIGSALGVIGLVLMNFVWNQAPIS-GWDQAYXXXXXXX 304
               PT++      H   F  D +  AL   G VL          S  WD          
Sbjct: 237 LKFKPTSLFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSWDSGVVISFLVV 296

Query: 305 XXXXXXXXXXYENRF---AKSPLLPRAVLKDRHMIQIMLAL-----FFGWGSFGIFTFYY 356
                     Y+ +     KS    R +L  R M Q  + L     FF   ++ +   Y 
Sbjct: 297 GILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFSTVAYNVQMIYS 356

Query: 357 FQFQLNIRHYSAVWAGGTYFM-FLIWGIIAALLVGIYIKK---VSPSVFLFLSMMAFNIG 412
            QF   +  ++A W  G + +  L+  ++ +++ G+  KK   + P + +F S M    G
Sbjct: 357 VQFFQLVYGFTA-WKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKP-LLVFGSAMGVLGG 414

Query: 413 SIMASVTPVHETYFRTQLGTMIILSFGMDFSFPASSI 449
            +M  +      +  TQ+G +I+    + F  P++ I
Sbjct: 415 GLMTLLNNTSTKH--TQIGVLILPGVALGFVLPSALI 449

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 17/113 (15%)

Query: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184
           ISG L D+YG + ++ +G ++ +  S+    ++  G   F    R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 185 GIIGNI---YVSGTFRKNIVISLVGAMAPVGATL-GCLFAGLIGTKNPKQWPW 233
           G++G+    +  GTF        VGA++  G TL G  F  LIG      + W
Sbjct: 198 GVVGDFTLKHERGTF--------VGAVS--GFTLMGQAFGSLIGAALTAAFDW 240

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 80/212 (37%), Gaps = 17/212 (8%)

Query: 46  HGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNE 105
           HG +   D +    PN     W     +FT   +  L+    T T S    I N F ++ 
Sbjct: 38  HGADEDEDIKLSDIPNL----WIIEAALFT---NVFLSGFDGTVTASTYQTIGNEF-NHM 89

Query: 106 NSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFF 165
           N  +W+  ++ + S SF  + G   D  G +  L        I  L CGL     S    
Sbjct: 90  NISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGL-----SPNIV 144

Query: 166 IISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGT 225
           ++S      GI       L  I N  +  + ++ I  +    +  +GA  G  F G I +
Sbjct: 145 VLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLGLGAICGASFGGSIAS 204

Query: 226 KNPKQWPWAFYAYTITSIIN-LALSVYSIPNN 256
                W W F+      I N L +S Y +PN 
Sbjct: 205 S--IGWRWCFFVQVPICITNSLIMSSY-VPNQ 233

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 64/163 (39%), Gaps = 9/163 (5%)

Query: 71  LFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLG 130
           + +F    S ++   GT+     +N I   F ++       +  + L  G F L    L 
Sbjct: 108 MIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLS 167

Query: 131 DIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNI 190
           ++ G +      + ++  +S+   L     S   FI  R   G   A V     G + ++
Sbjct: 168 ELEGRRTTYITSFAMLFAFSIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVADL 224

Query: 191 YVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPW 233
           Y+S    KN+    +G +      L  L + +IG+    +WPW
Sbjct: 225 YISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPW 261

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 39/206 (18%), Positives = 81/206 (39%), Gaps = 10/206 (4%)

Query: 32  RHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTL 91
             + ++E  T +     E+    ++  + +     +  Y  + +  ++  L+        
Sbjct: 5   EDNSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVS 64

Query: 92  SIMNIIANSFGSNENSRT-WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWS 150
           +I+  ++  F  NE S++ WL+  + L +    L+ GR   I G K  + +  ++  + S
Sbjct: 65  TIIETVSRDF--NEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGS 122

Query: 151 LICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAP 210
           L+  L   + S    I  R   G+G + +      II  +       + + IS++     
Sbjct: 123 LVSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMAISVLSCSFA 177

Query: 211 VGATLGCLFAGLIGTKNPKQWPWAFY 236
           V + +G    G   T     W W FY
Sbjct: 178 VASIVGPFLGGAFTTH--VTWRWCFY 201

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 52/263 (19%), Positives = 99/263 (37%), Gaps = 30/263 (11%)

Query: 11  ESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQ----NPNYFKNS 66
           ES Q ++   +    +++  +  D +EE     T +G   T  + R +    +P Y   S
Sbjct: 36  ESDQVTYNPVSFEKDSIEIPTDDDDDEEGNHHDTTNGMYKTKSQNRDEPDIDSPPY---S 92

Query: 67  W----HEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSF 122
           W     +   +  C  + LL+    +    +++++   F   E      +  + +     
Sbjct: 93  WFDKKEKAFLVVQCAFTGLLSSLAGSIYYPVLSVLEVKFHITEEQINISVVVYYVFQAVS 152

Query: 123 ILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAFQGLGIAFVL 180
             + G L D  G + +     ++  ++   C     +  + +   I  R  Q  GI+ V+
Sbjct: 153 PTLMGGLADSLGRRPV-----IITSVFLYFCACIGLACCNNYSQLIGLRCLQATGISPVI 207

Query: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGAT--LGCLFAGLIGTKNPKQWPWA--FY 236
               G++G++               G M  V  T  LG  F  LIG     +W W   F+
Sbjct: 208 AVNSGLMGDVTTKA--------ERGGYMGLVSGTQVLGTAFGALIGAALFSRWGWRSIFW 259

Query: 237 AYTITSIINLALSVYSIPNNIPT 259
              I S + L LS++ +P    T
Sbjct: 260 FLVIGSGVCLVLSLFILPETKRT 282

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 11/125 (8%)

Query: 66  SWHEYLFIFTCMISQLLNQAGT-TQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFIL 124
           S+ ++LFI +   S         T TL++  I ++ F       TW +    ++     +
Sbjct: 70  SYKQWLFILSAFASFTWEAFDFFTVTLNVKKI-SHDFDVTTKQVTWGITLVLMLRVVGAV 128

Query: 125 ISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVL 184
           + G +GD YG K    I    +++  +I G  K++    +F+I+RAF G+ +        
Sbjct: 129 LFGYIGDRYGRKVSFIINLFFMMVLEIITGFIKHNFK--YFLIARAFFGVVLG------- 179

Query: 185 GIIGN 189
           GI GN
Sbjct: 180 GIFGN 184

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 57/154 (37%), Gaps = 7/154 (4%)

Query: 110 WLMASFPLVSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISR 169
           W+  ++ + S SF  + G   D  G +  L        I  L CG      S   +++S 
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGF-----SSNIYMLSF 60

Query: 170 AFQGLGIAFVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPK 229
                GI       L  I N  V  T ++ I  +    +   GA  G  F G I +    
Sbjct: 61  MRALTGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIAST--I 118

Query: 230 QWPWAFYAYTITSIINLALSVYSIPNNIPTNIQH 263
            W W F      S+I+  L  Y +PN    N Q+
Sbjct: 119 GWRWCFLIQVPISMISSILMNYYVPNQKEYNDQN 152

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 50/106 (47%), Gaps = 20/106 (18%)

Query: 392 YIKKVSPSVFLFLSMMAFNIGSIMASVTPVHET--------------YFRTQLGTMIILS 437
           Y+K   P + +F+ ++ F+   +++   P+ ET              YF   L ++++++
Sbjct: 408 YLKYTFPVMLMFICIL-FSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMIN 466

Query: 438 FGMDFS-----FPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 478
           F +  +     FP + +  S+ LP   Q +  S++  V N  +S+C
Sbjct: 467 FPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISIC 512

>YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}
           HXT2High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 541

 Score = 30.8 bits (68), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 124 LISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTF--FIISRAFQGL---GIAF 178
           L  GRLGD+YG +    IG + +++  ++  + + + SD +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDMYGRR----IGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAV 177

Query: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLG-CLFAGLIGTKNPKQW 231
           + P ++      ++ GT      +S    M  +G  LG C   G     N  QW
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQW 226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,562,860
Number of extensions: 2184383
Number of successful extensions: 8540
Number of sequences better than 10.0: 297
Number of HSP's gapped: 8629
Number of HSP's successfully gapped: 314
Length of query: 537
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 423
Effective length of database: 40,409,475
Effective search space: 17093207925
Effective search space used: 17093207925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)