Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.248.844ON1128112852490.0
Smik_13.178.844ON1131113243790.0
YML117W (NAB6)8.844ON1134113443240.0
Suva_13.268.844ON1122113342060.0
TDEL0B005408.844ON1115102116950.0
CAGL0B02365g8.844ON105096615900.0
KNAG0G034408.844ON105366811631e-140
KAFR0A028508.844ON104247211231e-135
Kpol_1068.58.844ON103255511171e-134
NDAI0E002708.844ON119852511201e-133
NCAS0B002808.844ON108165611101e-132
TPHA0I002708.844ON103961911031e-132
KLTH0C03784g8.844ON99764110941e-131
Kwal_27.102398.844ON91461910811e-130
ZYRO0G14256g8.844ON125942011011e-130
TBLA0B032808.844ON136230310171e-117
ABL122C8.844ON10436569791e-114
SAKL0D01364g8.844ON10824179571e-111
Ecym_46158.844ON10674928551e-96
TBLA0B052106.183ON7102144351e-43
KNAG0M004306.183ON4432134202e-43
AFL061C6.183ON5232184224e-43
NCAS0H010406.183ON6292744284e-43
SAKL0A05280g6.183ON5822144255e-43
NDAI0F022606.183ON6802144279e-43
TPHA0J022106.183ON5933074193e-42
TDEL0G016206.183ON5842144166e-42
Ecym_22336.183ON5762184159e-42
KAFR0B066906.183ON5332144121e-41
Kpol_1002.696.183ON5902144151e-41
CAGL0C01419g6.183ON6392144161e-41
KLLA0E19031g6.183ON6522144133e-41
KLTH0H04906g6.183ON5692154006e-40
Suva_16.1236.183ON5962144017e-40
YPL184C (MRN1)6.183ON6122144027e-40
Kwal_27.111586.183ON5672133998e-40
ZYRO0G08140g6.183ON6322134011e-39
Smik_6.3906.183ON6252143982e-39
Skud_16.946.183ON6142143939e-39
KLLA0D01485g8.844ON11512862161e-16
NDAI0F01720singletonON474132870.12
Skud_4.478.466ON34377840.22
Suva_4.398.466ON34871840.24
KLTH0D11088g8.670ON42269840.30
Kwal_26.87638.670ON42653830.33
YOR242C (SSP2)8.670ON371303820.51
SAKL0F15070g7.482ON58685800.83
TPHA0L012008.466ON32280791.0
ACR135C8.670ON376163781.4
KAFR0D016608.797ON212179761.7
TDEL0A018602.412ON320150771.9
Suva_8.2928.670ON370214771.9
KAFR0G023206.104ON62079772.0
TDEL0B010108.797ON210212752.0
KLLA0C05522g6.104ON54084772.2
TPHA0G010808.797ON22083752.4
NCAS0B061402.306ON443177762.5
Skud_2.3456.104ON664165762.5
Ecym_24038.670ON375162753.4
CAGL0J03740g8.670ON369223744.0
KAFR0H016208.466ON33078734.5
CAGL0H10604g2.306ON416128735.7
ZYRO0F07238g8.670ON38941736.3
KNAG0C058904.134ON859172728.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.24
         (1128 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...  2026   0.0  
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...  1691   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...  1670   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...  1624   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   657   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   617   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   452   e-140
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   437   e-135
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   434   e-134
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     436   e-133
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     432   e-132
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   429   e-132
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   426   e-131
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   421   e-130
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   428   e-130
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   396   e-117
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   381   e-114
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   373   e-111
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   333   1e-96
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   172   1e-43
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   166   2e-43
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   167   4e-43
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   169   4e-43
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   168   5e-43
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    169   9e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   166   3e-42
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   164   6e-42
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   164   9e-42
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   163   1e-41
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   164   1e-41
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   164   1e-41
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   163   3e-41
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   158   6e-40
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   159   7e-40
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   159   7e-40
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   158   8e-40
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   159   1e-39
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   157   2e-39
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   155   9e-39
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...    88   1e-16
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    38   0.12 
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    37   0.22 
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    37   0.24 
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    37   0.30 
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    37   0.33 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    36   0.51 
SAKL0F15070g Chr6 (1213643..1215403) [1761 bp, 586 aa] {ON} simi...    35   0.83 
TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.4...    35   1.0  
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    35   1.4  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    34   1.7  
TDEL0A01860 Chr1 (341309..342271) [963 bp, 320 aa] {ON} Anc_2.41...    34   1.9  
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    34   1.9  
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    34   2.0  
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    33   2.0  
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    34   2.2  
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    33   2.4  
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...    34   2.5  
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    34   2.5  
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    33   3.4  
CAGL0J03740g Chr10 (358554..359663) [1110 bp, 369 aa] {ON} weakl...    33   4.0  
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    33   4.5  
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...    33   5.7  
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    33   6.3  
KNAG0C05890 Chr3 (1147381..1149960) [2580 bp, 859 aa] {ON} Anc_4...    32   8.6  

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score = 2026 bits (5249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1003/1128 (88%), Positives = 1003/1128 (88%)

Query: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60
            MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL
Sbjct: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVXXXXXX 120
            PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPV      
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVSNQNGY 120

Query: 121  XXXXXXXXXXXXXMMTPXXXXXXXXXXXXXXXXXXXXXXXXXXKGCDTXXXXXXXXXXXX 180
                         MMTP                          KGCDT            
Sbjct: 121  NGNSSNHNHSGNGMMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSRS 180

Query: 181  XIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLE 240
             IFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLE
Sbjct: 181  NIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLE 240

Query: 241  SAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF 300
            SAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF
Sbjct: 241  SAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF 300

Query: 301  VCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSAL 360
            VCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSAL
Sbjct: 301  VCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSAL 360

Query: 361  EKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYL 420
            EKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYL
Sbjct: 361  EKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYL 420

Query: 421  KKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAXXXXXXXXXXX 480
            KKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPA           
Sbjct: 421  KKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKNDNNNNSN 480

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEIDLLTTKLQGIELDGTSLEI 540
                                                  EEIDLLTTKLQGIELDGTSLEI
Sbjct: 481  KGNISSINAQNNNSSIGSSIYGNSNISLTSLSSSVSLNEEIDLLTTKLQGIELDGTSLEI 540

Query: 541  TSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVIP 600
            TSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVIP
Sbjct: 541  TSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVIP 600

Query: 601  QQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPR 660
            QQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPR
Sbjct: 601  QQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPR 660

Query: 661  SRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 720
            SRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW
Sbjct: 661  SRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 720

Query: 721  GHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLRED 780
            GHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLRED
Sbjct: 721  GHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLRED 780

Query: 781  FSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFD 840
            FSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFD
Sbjct: 781  FSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFD 840

Query: 841  GRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKES 900
            GRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKES
Sbjct: 841  GRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKES 900

Query: 901  FDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTXXXXXXXXVA 960
            FDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETT        VA
Sbjct: 901  FDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTGLGGLGLGVA 960

Query: 961  NCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINS 1020
            NCDVKRATSDETDYEELFNK          IEVIMHSPSDPEYALKSQTLRSSSQTVINS
Sbjct: 961  NCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVINS 1020

Query: 1021 KRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRER 1080
            KRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRER
Sbjct: 1021 KRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRER 1080

Query: 1081 KRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
            KRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE
Sbjct: 1081 KRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score = 1691 bits (4379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 843/1132 (74%), Positives = 910/1132 (80%), Gaps = 5/1132 (0%)

Query: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60
            M N N RKP ANYAYRQQ DYNGMNAMVGN ++YHPVDFING GQYG SQHPAYY+NSPL
Sbjct: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVXXXXXX 120
            PN+PPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN KRKAYSRPV      
Sbjct: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSNHNNY 120

Query: 121  XXXXXXXXXXXXXMMTPXXXXXXXXXXXXXXXXXXXXXXXXXXKGCDTXXXXXXXXXXXX 180
                          M                            KGCD             
Sbjct: 121  NGNNNSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHNNKGCDNRNSSGRRTSTRN 180

Query: 181  XIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLE 240
             IFD+I+ E+LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHS+VKNFVK NTLE
Sbjct: 181  NIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLE 240

Query: 241  SAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF 300
            S Y + N+K+DDL+D +T NLS+LISFLTRSDCLNFYNNILQRLSEFK FLKS+SLNLKF
Sbjct: 241  STYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKF 300

Query: 301  VCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSAL 360
            VCLNY+ +CLSTF+E +   E  EQ+   NDS MISASLHHD+ENKDATRSII+EFKS L
Sbjct: 301  VCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL 360

Query: 361  EKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYL 420
            + TELF K+LQFLD S NKRYILESID+VNTDVPSNQFPENYAVLTFLNIFMA+EVLDYL
Sbjct: 361  KSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYL 420

Query: 421  KKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAXXXXXXXXXXX 480
            KK+SK L ISKCFYVSL PL++SSTRSSVANIYE KT+T RLSVPSVP            
Sbjct: 421  KKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSNN 480

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXEEIDLLTTKLQGIELDGTSLE 539
                                                   EEID+LTTKLQGI+LDGT LE
Sbjct: 481  HKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGTDLE 540

Query: 540  ITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVI 599
            I  HDY TPT++EHSTHLSN+KISKTVENSR FP DIPSPLPLNE+MFMNDSN SNG+++
Sbjct: 541  INYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIV 600

Query: 600  PQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP 659
            PQQL+A PSP+SS +Q+NQRVLPN ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP
Sbjct: 601  PQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP 660

Query: 660  RSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG 719
            RSRAEDICNVVRGGILQSIKY+PEKRI FVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG
Sbjct: 661  RSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG 720

Query: 720  WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLRE 779
            WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAEQLRE
Sbjct: 721  WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRE 780

Query: 780  DFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKF 839
            DFSTYGDIEQINYLSDSHCCWINFMNISSAI LVEEMNKES AH++ GE+  KTA E+KF
Sbjct: 781  DFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKF 840

Query: 840  DGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE 899
             GRY+GLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE
Sbjct: 841  GGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE 900

Query: 900  -SFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTXXXXXXXX 958
             +FDK LNLESLGISLD HKD GIG IE +N  G EIE+E EA N   NET         
Sbjct: 901  RAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVN-RSNETVGIGGLGLG 959

Query: 959  VANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVI 1018
            VA+ +V RA SDETDYE+LFNK          IEVIMHSPSDPEYALKSQTLRSSSQTVI
Sbjct: 960  VASSEVNRAASDETDYEDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVI 1019

Query: 1019 NSKRPVKVEDEDD-VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQD-SRNAETAN 1076
            NSKRPVK EDE+D V ISQ NH+SSLR APPRAPSTLSY+  KK+ET  +D   N ET +
Sbjct: 1020 NSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTS 1079

Query: 1077 NRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
            NR++ RGS PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN ++EE
Sbjct: 1080 NRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score = 1670 bits (4324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 837/1134 (73%), Positives = 905/1134 (79%), Gaps = 6/1134 (0%)

Query: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60
            M NSN +KP ANYAYRQQ DYNGMNAMVGN MMYHPVDF+NG GQYG SQHPAYYTNSPL
Sbjct: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVXX-XXX 119
            PN+PPTPFDTAYGASL PSHLLMGSPFVSSPNMQ GY+ ARSSNLKRKAYSRPV      
Sbjct: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNGY 120

Query: 120  XXXXXXXXXXXXXXMMTPXXXXXXXXXXXXXXXXXXXXXXXXXXKGCDTXXXXXXXXXXX 179
                          M+TP                          KGCDT           
Sbjct: 121  NGNSNSNQNNTNNGMVTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTFAR 180

Query: 180  XXIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTL 239
              IFD+I PE+LLQRPF INYK+LPTGDDAYRTRSLLIENVD S DLHS+VKNFVK NTL
Sbjct: 181  NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL 240

Query: 240  ESAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLK 299
            ESAY ++  K+DD +D ET+NLS+LISFLT+ DCLNFYNNILQRLSEFK FLKS++LNLK
Sbjct: 241  ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK 300

Query: 300  FVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSA 359
            FVCLNY+ +CL TF+E E   E  E+    N S MISASLHH++ NKDATRSIIIEFKS 
Sbjct: 301  FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP 360

Query: 360  LEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDY 419
            +EK++LF+K+LQFLD SKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNI MA+EVLDY
Sbjct: 361  VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY 420

Query: 420  LKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAXXXXXXXXXX 479
            LKK+SK+L ISKCFYVSL PL+VSS RSSVANIYE KT+T RLSVPSV A          
Sbjct: 421  LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNNG 480

Query: 480  XXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXEEIDLLTTKLQGIELDGTS 537
                                                     EEID+L TKLQG+ELDGT 
Sbjct: 481  NNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLSSSVSLNEEIDMLATKLQGVELDGTY 540

Query: 538  LEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGA 597
            LEI   DY TPTI EHSTHLSN+KISKT ENSR F QDIPSPLPLNE MFMNDSNQSNGA
Sbjct: 541  LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA 600

Query: 598  VIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNI 657
            +IPQQLIA PSP+S NLQ+NQRVLPN ITQSLEQNFNVSAKVASSMGSD+GNRTIYIGNI
Sbjct: 601  IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 660

Query: 658  NPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 717
            NPRS+AEDICNVVRGGILQSIKYIPEK+I FVTFIEAPSAVQFYANSFIDPIVLHGNMLR
Sbjct: 661  NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 720

Query: 718  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQL 777
            VGWGHYSGPLPK ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAEQL
Sbjct: 721  VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 780

Query: 778  REDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEE 837
            REDFSTYGDIEQINYLSDSHCCWINFMNISSAI LVEEMNKES   ++ GEV +K A EE
Sbjct: 781  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE 840

Query: 838  KFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 897
            KF GRYKGLLINYGKDRCGNINKNL+AGKNSRFYKKVKRPSYNIRLSKLEE+RRQNE D+
Sbjct: 841  KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE 900

Query: 898  KE-SFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTXXXXXX 956
            KE +FDK LNLESLGISLD HKD G G   T N TG E ESE+EAEN N NET       
Sbjct: 901  KEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENENGNETGSFGGLG 960

Query: 957  XXVANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQT 1016
              VA+ DVKRATSDETDYE++FNK          +EVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 961  LAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYALKSQTLRSSSQT 1020

Query: 1017 VINSKRPVKVEDEDD-VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQD-SRNAET 1074
            VINSKRPVK+EDE++ VG+SQLN+RSSLRQAPPRAPSTLSY+H K +ET  QD   N ET
Sbjct: 1021 VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET 1080

Query: 1075 ANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
            ANNR++KRGS  RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN + +E
Sbjct: 1081 ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score = 1624 bits (4206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 835/1133 (73%), Positives = 892/1133 (78%), Gaps = 16/1133 (1%)

Query: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60
            M NSN RKP AN+AYR+QHD+NGMNAMVGN M+YHPVDF+NG GQYG SQHPAYYTNSPL
Sbjct: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVXXXXXX 120
            PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGY+  RSS   RKAYSRP+      
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSY 120

Query: 121  XXXXXXXXXXXXX---MMTPXXXXXXXXXXXXXXXXXXXXXXXXXXKGCDTXXXXXXXXX 177
                            MMTP                          KG +T         
Sbjct: 121  NANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYETRNSSGRRTS 180

Query: 178  XXXXIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFN 237
                IFDEI+PE LLQ+PFRINYKILP GDDAYRTRSLLIENVD S DLHSLVKNFVK N
Sbjct: 181  SRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240

Query: 238  TLESAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLN 297
             LESAY V + + D+LE  ET+NLS+LISFLTR DCLNFYNNILQRLSEFK FLKSKSLN
Sbjct: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300

Query: 298  LKFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFK 357
            LKFVCLNY+S+ L T VE E+    +EQ    + S MISASLHHDVENKDATRSIIIEFK
Sbjct: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360

Query: 358  SALEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVL 417
            S LEK ELF+++LQFLD SKNKRYILESID+V+TDVPSNQFPENY VLTFLNIFMA+EVL
Sbjct: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420

Query: 418  DYLKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAXXXXXXXX 477
            DYLKK+SK L ISKCFYVSLTPLMVSS RSSVA+IYESK+++ RLS PSVPA        
Sbjct: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNNDINN 480

Query: 478  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEIDLLTTKLQGIELDGTS 537
                                                     EEI++LTTKLQGI+LDGT 
Sbjct: 481  INNNNNNGSIGSSIYGNSNISLTSLSSSVSLN---------EEIEVLTTKLQGIDLDGTI 531

Query: 538  LEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGA 597
            LE+T HDY TP INEHS HLSNIKISKTV+NSR F QDIPSPLPLNE MFM DSNQSNG 
Sbjct: 532  LEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNGT 591

Query: 598  VIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNI 657
            ++ QQLI APSP S N Q+NQRVLPN ITQSLEQNFNVSAKVASSMGSD+GNRTIYIGNI
Sbjct: 592  IVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 651

Query: 658  NPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 717
            NPRSRAEDICNVVRGGILQ+IKYI EKRI FVTFIEA SAVQFYANSFIDPIVLHGNMLR
Sbjct: 652  NPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLR 711

Query: 718  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQL 777
            VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQL
Sbjct: 712  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQL 771

Query: 778  REDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEE 837
            REDFSTYGDIEQINYLSDSHCCWINFMNISSAI LVEEMN+E   H D GE+I KTA EE
Sbjct: 772  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEE 831

Query: 838  KFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 897
            KFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK
Sbjct: 832  KFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 891

Query: 898  KESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTXXXXXXX 957
            KESFDKVLNLESLGISLDPHK   I   E E  TG   E E E E  N NET        
Sbjct: 892  KESFDKVLNLESLGISLDPHKGTDIDEAEAEGTTG--AEVENEVEAENGNETVGLGGLGL 949

Query: 958  XVANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTV 1017
             V N DVKRA SDETDY+E FNK          IEVIMHSPSDPEYALKSQTLRSSSQTV
Sbjct: 950  GVVNSDVKRALSDETDYDEFFNKSSRSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTV 1009

Query: 1018 INSKRPVKVEDEDD-VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSR-NAETA 1075
            +NSKRP KVE+ED  VG+SQ NHRSSL+QAPPRAPSTLS++H KK++   QD+  NAE  
Sbjct: 1010 LNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEVT 1069

Query: 1076 NNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
            +N+ +KRGS PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYS+E
Sbjct: 1070 DNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1021 (40%), Positives = 560/1021 (54%), Gaps = 155/1021 (15%)

Query: 192  LQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKND 251
             + PF + Y++LP G+D +RTRSLL ENVD S DLHS V NF  +  +ES Y        
Sbjct: 162  FKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVY-------- 213

Query: 252  DLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLS 311
             L   E +++S+L+SF +++ CL+FYN++LQRLSE+K  L SK+L L FV L Y+   +S
Sbjct: 214  -LFKSEGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYK---VS 269

Query: 312  TFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRKRLQ 371
               E +  KE D +  A N  +  + SL +DV N+ ATRSI+I FK+   K EL  K+L+
Sbjct: 270  DTSEEDIDKEDDSKPDAFN--ITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLE 327

Query: 372  FLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISK 431
            FL +  N RY+LESIDLV  D PS  FP+NYA            VL +L  F   + +  
Sbjct: 328  FLKKENNTRYVLESIDLVTADEPSKHFPQNYA------------VLTFLNIF---MAVEI 372

Query: 432  CFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAXXXXXXXXXXXXXXXXXXXXXX 491
              Y+ L    +  ++    +I       +RLSV S                         
Sbjct: 373  LDYIRLHSQKLDISKCFFISIQPQIPDGKRLSVSSA------------------SNGRSM 414

Query: 492  XXXXXXXXXXXXXXXXXXXXXXXXXXXEEIDLLTTKLQGIELDGTSLEITSHDYSTPTIN 551
                                       +EID +T KLQ +      LE+T+++Y  P+  
Sbjct: 415  ESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFE 474

Query: 552  EHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDS----NQSNGAVIPQQLIAAP 607
             H+ HL+N+ +S+            P  + +NE +  N      N  N A   Q + A P
Sbjct: 475  GHTDHLTNVTVSEAASLDSQLTMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAVP 534

Query: 608  S---PLSS-------------NLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRT 651
                P+S+             N++ N   +   ITQSL++ +  SA+VASSMG  +GNRT
Sbjct: 535  PSMVPMSTMPNTPYGCYMPPPNVRQNGN-MTKPITQSLQRQYATSAEVASSMGGGIGNRT 593

Query: 652  IYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVL 711
            +YIGNI+PRSR EDICNVVRGGILQ++K++ EKRI FVTF+EA +AVQFY N+FIDPIVL
Sbjct: 594  VYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVL 653

Query: 712  HGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLAL 771
            HGNML+VGWGH+SGPLPKSI+LAVT+GASRNVYVSLPEFAFK+K+I+DPQY++ ++   L
Sbjct: 654  HGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRL 713

Query: 772  PDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIV 831
            PD EQLR+DFS YGDIEQINYL+D HCCW+NF NIS+AI LVEE+       ++GG    
Sbjct: 714  PDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVK------YEGGGNFY 767

Query: 832  KTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR 891
            K  G     GRY GL+I YGKDRCGN+NKN +AGKNSRFYKKVK+PS+NIRLSK+EE RR
Sbjct: 768  KMLG-----GRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERR 822

Query: 892  QNE----NDKKESFDKVLNLESLGISL------DPHK------------DAGIGVIETEN 929
            Q+E      ++ + +K L   SLGI++      DP K            D+       E 
Sbjct: 823  QHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSPKKTVEQ 882

Query: 930  ITGDEIESEIE-----------AENVNDNETTXXXXXXXXVANCDVKRATSDETDYEELF 978
             +G E + E +           A+ +N  E+                 + +DET      
Sbjct: 883  ASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDET------ 936

Query: 979  NKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLR----------SSSQTVINSKRPVKVED 1028
                        +E+I++SP + E   KS++ R          ++     +SK   K   
Sbjct: 937  ---SAKSDASSDVELIINSPEEEESNFKSKSNRGFRKNDRRKLANCAEGASSKERFKSTT 993

Query: 1029 EDDVGISQLNHRSSLRQAPPRAPSTLS----------YDHLKKSE---TSFQDSRNAETA 1075
             D   +S     SSL   PP AP+T+S          Y+H K  +    SF D    E+ 
Sbjct: 994  ND---VSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESN 1050

Query: 1076 NNRERKRGS-------LPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNAYSE 1127
             + E  + +           ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN Y +
Sbjct: 1051 FDFESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLD 1110

Query: 1128 E 1128
            E
Sbjct: 1111 E 1111

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%)

Query: 43 VGQYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
          V Q+ +SQ P YY   P+ N PPTPFDTAYG +LLPSHLLMGSPFVSSPN+
Sbjct: 37 VPQFMNSQ-PMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL 86

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/966 (39%), Positives = 537/966 (55%), Gaps = 125/966 (12%)

Query: 192  LQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSL-VKNFVKFNTLESAY-FVDNDK 249
            L  P  INY++LP+GDD Y+TRSLL ENV ++ ++ S+ ++  + ++ +ES Y F   D 
Sbjct: 166  LISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTDT 225

Query: 250  NDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYES-E 308
                ++ + +   + +SFL+R   L+FYNN LQRL +FK  L S  L++ FV  +Y + E
Sbjct: 226  PSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTDE 285

Query: 309  CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRK 368
                  + +K    +++    +  ++   +L  ++ + DATRSI IEF S +E+  LF K
Sbjct: 286  DKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVEQDALFEK 345

Query: 369  RLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLE 428
             L FLD+  NKRYILE++D+++ +  ++ FP NY +LTF+NI MA+EVLDYLK    +  
Sbjct: 346  -LPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLMTYS 404

Query: 429  ISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAXXXXXXXXXXXXXXXXXXX 488
            +++CF+VSL P   S   SS   +    +T    SV  V                     
Sbjct: 405  VNECFFVSL-PGCKSQRESSTTPVLGHISTEGSKSVSEV--------------------- 442

Query: 489  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEIDLLTTKLQGIELDGTSLEITSHDYSTP 548
                                           E++ L+ +L  ++L+   L+I   DY  P
Sbjct: 443  ------------------NLANGGNTVMIDRELESLSDELASLKLEEKCLKIIRSDYPKP 484

Query: 549  TINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVIPQQLIAAPS 608
             I  H  H     I  +   S +   D  +P   N  M+++D+   + ++I         
Sbjct: 485  EIRSHDDH-----IPGSTNFSMYIFDDGMNP-EGNSGMYLHDNLTDHSSIIGSPFSNYID 538

Query: 609  PLSSNLQINQRVLP------------------------NAITQSLEQNFNVSAKVASSMG 644
            P  S++ +    LP                          ITQS+E   N SA++A++MG
Sbjct: 539  PSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNTSARIAAAMG 598

Query: 645  SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
             D  NRT+YIGNINPRS+ EDICNVVRGGILQ++K+I +KRI FVTFIEA +A QF ANS
Sbjct: 599  GDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANS 658

Query: 705  FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            FIDPIVLHGN LRVGWG+ SGPLPKSI+LAVT+GA+RNVYVSLPE+AFK+KFI+DP+YK+
Sbjct: 659  FIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKE 718

Query: 765  LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
             HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF+NI+SAI LVE++N      H
Sbjct: 719  YHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDIN------H 772

Query: 825  DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLS 884
            + GE   K     KF+ RY+GL+INYGKDRCGNINKNL+AGK S+FYKKVK+PSY+IR+ 
Sbjct: 773  NNGEEFHK-----KFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIK 827

Query: 885  KLEERRRQNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENV 944
            K+EE+R+  E++        + L+SLG                           I  +  
Sbjct: 828  KMEEKRKMQEDNLLSQKKNSIQLDSLG---------------------------ISVDRT 860

Query: 945  NDNETTXXXXXXXXVANCDVKR---ATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDP 1001
              NE+           N  VK+   +   ++D+ ++ +              I    S  
Sbjct: 861  FSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGS 920

Query: 1002 EYALKSQTLRSSSQTVINSKRPVKVED-EDDVGISQLNHRSSLRQAPPRAPSTLSYDHLK 1060
            + ++ S    S+S+   +S R  +  +   D  + + N    L  APPRAPST++  + K
Sbjct: 921  DESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTN----LSHAPPRAPSTINMTYKK 976

Query: 1061 KSETSFQDSRNAETANNRERKR--GSLPRH---RTIPGSDVMAQYLAQVQHSTFMYAANI 1115
             S     + +  +    ++ KR   + P     R IPGSDVMAQYLAQ+QHSTFMYAANI
Sbjct: 977  ISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQYLAQLQHSTFMYAANI 1036

Query: 1116 LGASAE 1121
            LGAS E
Sbjct: 1037 LGASVE 1042

 Score = 69.3 bits (168), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 33/37 (89%)

Query: 57 NSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
          NSP  NVPPTPFDTAYGASLLPSHLLMGSP +S+ N+
Sbjct: 43 NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNL 79

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  452 bits (1163), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 286/668 (42%), Positives = 378/668 (56%), Gaps = 131/668 (19%)

Query: 519  EEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSR-------- 570
            +++D L  KL+ IEL  ++L++   DY  P   + S H + I  S  V  +R        
Sbjct: 444  DDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSS 503

Query: 571  --------HFPQDIPSP----LPLNEQMFMNDSNQSNGA--VIPQQLIAAPS-PLSS--- 612
                     FP DI SP    LPL       D N SN    + P  + A PS P+S    
Sbjct: 504  ISTPRAFGAFPNDIGSPPASFLPL-------DLNHSNSVPNLPPGFIPATPSGPMSPQQQ 556

Query: 613  ----NLQINQR-----VLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRA 663
                N Q  QR        + IT SLE     S +VA++MGSD  NRTIYIGNINPRSRA
Sbjct: 557  QLFLNSQRQQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRA 616

Query: 664  EDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHY 723
            EDICNVVRGGILQ+IK+I  K I F+TFIEA +AVQFYAN+FIDPIVLHGN L++GWG Y
Sbjct: 617  EDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTY 676

Query: 724  SGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFST 783
            +GPLPK I+LAVTIGASRNVY+SLPE AFK+K+I DP++K  HE+  LP  E LR+DF  
Sbjct: 677  TGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLH 736

Query: 784  YGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRY 843
            YG IEQIN L+DSHCCW+NFMNISSAI LVE+ + +            +    + FD RY
Sbjct: 737  YGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTK------------QDHFNQLFDHRY 784

Query: 844  KGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE---- 899
            +GL+INYGKDRCGNIN+NLVAGK S+++KKVK+ + ++RLS+LEE+RR  + +++E    
Sbjct: 785  EGLVINYGKDRCGNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNG 844

Query: 900  ------SFDKV------------LNLESLGISLDPHKDAGIGVIETENITGDEIESEIEA 941
                   FD              L+L+SLGIS          ++E E+       S I  
Sbjct: 845  TIPEENPFDAFAINTGSAEKKDELSLDSLGIS----------IMEVES------ASPISP 888

Query: 942  ENVNDNETTXXXXXXXXVANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDP 1001
               +  + T        +A  +    +   +D                 IE+I++ P+DP
Sbjct: 889  VMGDLEDHTNGSYTDAGIAPLNYTNNSGSSSD-----------------IELIINPPNDP 931

Query: 1002 EYALKSQTLRSSSQTVINSKRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKK 1061
              ++       S+ +  + KR +       V + +++        PP AP T+S  + + 
Sbjct: 932  NRSVGVLEGDPSTLSPPSDKRKL-------VALHEVS-----SPPPPLAPDTISRQYAEA 979

Query: 1062 S-------ETSFQDSRNAETANNRERKRGSLPRH-RTIPGSDVMAQYLAQVQHSTFMYAA 1113
            S            D+   +  N R R++  LPR+ RTIPGSDVMAQYLAQ+QHSTFMYAA
Sbjct: 980  SYHNELVTGNDHPDTGYGKAENGRHRQQ--LPRNARTIPGSDVMAQYLAQLQHSTFMYAA 1037

Query: 1114 NILGASAE 1121
            N+LGAS E
Sbjct: 1038 NVLGASNE 1045

 Score =  191 bits (484), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 168/289 (58%), Gaps = 31/289 (10%)

Query: 187 NPEI---LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAY 243
           +P+I   L Q PF I+YKILP GDD YRTRSLL+ N+D   DLH+ V  FV+ N++ES Y
Sbjct: 148 DPQIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVY 207

Query: 244 FVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCL 303
                     E  + E    L+SFL+   CLNFYNN+LQRL EFK  LK+ SL L FV +
Sbjct: 208 ITK-------EGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSM 260

Query: 304 NYESECLSTFVEGEKPKEVDEQVH---AANDSMMISASLHHDVENK-DATRSIIIEFKSA 359
                        ++P +V+ +++   AA+D   + A+LH D+  +  ATRSI IEF   
Sbjct: 261 R------------QRPTKVEGKIYRRFAADDGDGM-ANLHFDMAAQTGATRSIAIEFVDK 307

Query: 360 ---LEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEV 416
              L + EL  K+L+FL E  N RYILE I +  T   +  F +NYA++TFL+I MA+E+
Sbjct: 308 DVILTRDELLNKKLKFLSEG-NNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEI 366

Query: 417 LDYLKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVP 465
           +DYLK   K L ++K FYV +T     S  +S    + + T + R + P
Sbjct: 367 MDYLKLNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSP 415

 Score = 69.3 bits (168), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 1/46 (2%)

Query: 57  NSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-QGGYSPAR 101
           NSP+ N  PTPFDTAYGA+LLPSHLLMGSPFVS+PN+ Q  Y+  R
Sbjct: 83  NSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQR 128

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  437 bits (1123), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/472 (51%), Positives = 300/472 (63%), Gaps = 74/472 (15%)

Query: 519 EEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPS 578
           EE+  +  KL+GI+L   SL+I   DY  P  N  + HL N+ IS   +  +     IP 
Sbjct: 460 EEVISIADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQ-----IPG 514

Query: 579 PLPLNEQMFMNDSNQS----------------NGAVIPQQLIAAPSP---LSSNLQINQ- 618
             P  +++++ND + S                NG  I    +  PS    +  N QI + 
Sbjct: 515 -TPRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEA 573

Query: 619 ----RVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGI 674
                   + IT SLE   + SAKVAS+MGSD GNRTIYIGNINPRS+AEDICNVVRGGI
Sbjct: 574 PFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGI 633

Query: 675 LQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLA 734
           LQSIK+I  K I FVTFIEA +AVQFYAN+FIDPIVLHGN L++GWG+YSGPLPKSI+LA
Sbjct: 634 LQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALA 693

Query: 735 VTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLS 794
           VTIGASRNVYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYLS
Sbjct: 694 VTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLS 753

Query: 795 DSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDR 854
           DSHCCW+NFMNISSAI LVEE      A +D           EKFD RY GL+INYGKDR
Sbjct: 754 DSHCCWVNFMNISSAIKLVEE------ATNDFDRF------NEKFDERYNGLVINYGKDR 801

Query: 855 CGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR----------------------- 891
           CGNINKNL+AGKNSRFYK   R ++N +LSKLEE+RR                       
Sbjct: 802 CGNINKNLIAGKNSRFYK--IRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNES 859

Query: 892 -----QNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESE 938
                Q+  + KE+  K L L+SLGISL+   +    +   + +T D+ E+E
Sbjct: 860 METDNQHNEESKENDGKFLQLDSLGISLESKNEIADDI--NDALTVDQFENE 909

 Score =  209 bits (533), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 167/280 (59%), Gaps = 42/280 (15%)

Query: 189 EILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND 248
           E L   P  I+Y ILP GDDAYRTRSLL ENVD + +LHS + NFVK N++ES Y V N 
Sbjct: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPN- 232

Query: 249 KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESE 308
           KND      +    +++SFL+R  CL+FYNN+LQRL EFK  L S+SLNL FV L Y   
Sbjct: 233 KND------SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNK- 285

Query: 309 CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKS------ALEK 362
              T  + + P                  SL  ++  +DATRS+ IE  S       LEK
Sbjct: 286 ---TTRDNQGP------------------SLEFNIVTRDATRSLAIELCSNENDSLILEK 324

Query: 363 TELFRKRL-QFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLK 421
            +LF K L + L   +NKRY+LESIDLV+TD  + +F +NYA+L+FLNI MA+E++DY++
Sbjct: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384

Query: 422 KFSKSLEISKCFYVSLTPLMV------SSTRSSVANIYES 455
             S  L I KC +V++ PL+       SS  SS  NI  S
Sbjct: 385 VISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIQSS 424

 Score = 82.0 bits (201), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/41 (82%), Positives = 37/41 (90%)

Query: 53  AYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
            YY  SPLPN PPTPFDTAYGA+LLPSHLLMGSPF+SSPN+
Sbjct: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%)

Query: 1090 TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSE 1127
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+  Y E
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  434 bits (1117), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 246/555 (44%), Positives = 334/555 (60%), Gaps = 69/555 (12%)

Query: 591  SNQSNGAVIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNR 650
            SNQ N      +LI      + N  +    + + + ++ +  F  SA++A++MG   GNR
Sbjct: 522  SNQLNSEFENTRLIHLIWMETINCNLRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNR 581

Query: 651  TIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIV 710
            T+YIGNINPRS+AEDICNVVRGG LQ IK+  EK I FVTFIEA SA QFYANSFIDPI+
Sbjct: 582  TVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYANSFIDPII 641

Query: 711  LHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLA 770
            LH N LRVGWG +SGPLPKSISLAVT+GASRNVYVSLPE+AFK+KFI+DP+YK+ H    
Sbjct: 642  LHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYV 701

Query: 771  LPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVI 830
            LP  E+LR+DFS +G++EQ+N+L+D HCCWINFMNI SAI LVE +N       +GG+  
Sbjct: 702  LPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSS-----NGGKTF 756

Query: 831  VKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERR 890
                  E++  RYKGL+I YGKDRCGN+NK+L++GKNS+FY+KVK+PSYNIRL +LEE R
Sbjct: 757  -----HERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEEER 811

Query: 891  RQNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETT 950
                  K+E  +K+ N                   ++ N+    I+ E  ++N ++ E  
Sbjct: 812  ------KQEEKNKISN-------------------KSINLNSFGIQVETPSQNESEQEEP 846

Query: 951  XXXXXXXXVANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTL 1010
                    ++   + +  S+  D +E              IE+I+  P           +
Sbjct: 847  KISLDGLGMS---LSKPNSENHDLKE---TDDSDSDISTDIELIIDPP-----------V 889

Query: 1011 RSSSQTVINSKRPVKVEDEDD---VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQ 1067
            R +++   N K+  +  D ++    G      ++ L  +PP AP+TLS D  K S+    
Sbjct: 890  RENTKGNKNKKQNHRKNDMNNNLNFGNPPPVSKTLLESSPPLAPATLSRDFQKSSKQLSS 949

Query: 1068 DSRNAET--------------ANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAA 1113
            D  N  T              + N   KR S    + +PGSDVM+QYLAQ+QHSTFMYAA
Sbjct: 950  DLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAA 1009

Query: 1114 NILGASAEDNAYSEE 1128
            NILGAS+++  + +E
Sbjct: 1010 NILGASSDEPEFYDE 1024

 Score =  176 bits (446), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 156/280 (55%), Gaps = 36/280 (12%)

Query: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND------- 248
           F I+YK+LP G+D Y+TRSLL ENVD+S DLH  +K FV F  +ES Y ++++       
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNK 310

Query: 249 ------------KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSL 296
                        ++D      +  S+L+SFL+R  CL+FYN++LQRLSEFK  L S  L
Sbjct: 311 NNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370

Query: 297 NLKFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEF 356
            L FV L Y+++        ++P + +     A     +  SL +D+  + ATRSI +EF
Sbjct: 371 TLSFVLLKYKNQ--------DRPDDEESDFSPA-----LPLSLEYDIIKRGATRSIAVEF 417

Query: 357 KSALEKTELF-RKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVE 415
              +   E F   +L FL   +NKRYI+ES+D++N        P+N  +LTFLNI M V+
Sbjct: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477

Query: 416 VLDYLKKFSKSLEISKCFYVSL---TPLMVSSTRSSVANI 452
           V+D ++   K   ISKC +V+     P + +  R S+ +I
Sbjct: 478 VMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDI 517

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 44/62 (70%)

Query: 37  VDFINGVGQYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGG 96
           V  IN +    S+    YYTN  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   
Sbjct: 95  VAAINMINSQLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQS 154

Query: 97  YS 98
           YS
Sbjct: 155 YS 156

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  436 bits (1120), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/525 (46%), Positives = 320/525 (60%), Gaps = 54/525 (10%)

Query: 625  ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEK 684
            I ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRS+AED+CNVVRGGILQSIK I  K
Sbjct: 703  IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASK 762

Query: 685  RISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 744
            RI FVTFIEA +AVQFYANSFIDP++LHGN L++GWG+Y  PL KSI+LAVTIGASRNVY
Sbjct: 763  RICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVY 822

Query: 745  VSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 804
            VSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NFM
Sbjct: 823  VSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFM 882

Query: 805  NISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVA 864
            NI+SAI LVE++N     +             +KF+ RY GL+INYGKDRCGN+N+NL++
Sbjct: 883  NITSAIKLVEDVNNNPKDN----------TFSKKFNHRYDGLIINYGKDRCGNVNRNLIS 932

Query: 865  GKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKDA-GIG 923
             KNSR Y+KVK+ S N +L +L+E+RR  E +K +  +  +N   L     P  DA GIG
Sbjct: 933  NKNSRHYRKVKKFSDNYKLRQLQEKRRV-EQEKGKELNGGVNDNKL-----PSLDALGIG 986

Query: 924  VIETENITGDEIESEIEAENVNDNETTXXXXXXXXVANCDVKRATSDETDYEELFNKXXX 983
            +  T      ++    E +   D+  T             ++  T    D      +   
Sbjct: 987  LQRTAPPEEQKVPESNEDDANYDSAVTESDTNTFNALGFRIQSNTDSHDD-----EQNDE 1041

Query: 984  XXXXXXXIEVIMHS-------PSDPEYALKSQTLRSSSQTVINSKRPVKVEDE--DDVGI 1034
                   ++VI H+        SD E  +      S +  +   K+ ++   +  D +  
Sbjct: 1042 KGEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKIDRLAK 1101

Query: 1035 SQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRERKRGSL--------- 1085
            ++       R+  P   + L           F D +N +  N R++ +G +         
Sbjct: 1102 ARNAMFPEHRETIPDINNKL-----------FHDRKNKD-KNRRKQVQGGIQDQDPHLSS 1149

Query: 1086 --PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
               + R IPG+DVMAQYL Q+QHSTFMYAANILG SAEDN Y +E
Sbjct: 1150 TGKQQRVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194

 Score =  198 bits (503), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 170/305 (55%), Gaps = 54/305 (17%)

Query: 185 EINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYF 244
           E++P  L Q+PF I+YK+LPTGDDAYRTRSLL  NV  S DLHS + +FV+++++ES Y 
Sbjct: 174 EVDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYL 233

Query: 245 VDNDKNDDLEDGETEN----LSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF 300
           + N   DD +D + EN     S+L+SFL+R  CL+FYNN+LQRL+EFK  L+SKSL L F
Sbjct: 234 ISN--TDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNF 291

Query: 301 VCLNY---ESECLSTFVEGEKPKEVDEQVHAAN-------DSMMISASLHHDVENKDATR 350
           V LNY     +  +  +   +  ++ E  +  N       +SM    +L  D+ N DATR
Sbjct: 292 VILNYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATR 351

Query: 351 SIIIEFKSALEKTELFRKRLQFL-DESKNKRYILESIDLVNT------------------ 391
            I+IE K+  +K  L  K L FL D  KN RYILESIDL N                   
Sbjct: 352 FIMIELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNE 411

Query: 392 --DVPSNQ-----------------FPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISKC 432
             + P  +                 FP +YAVL+F+NI+MA+E+ DYLK       I+  
Sbjct: 412 NENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNA 471

Query: 433 FYVSL 437
            YV +
Sbjct: 472 SYVQI 476

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 57/90 (63%), Gaps = 9/90 (10%)

Query: 10  GANYAYRQQHD-------YNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPLPN 62
           G++Y    Q D       Y  +N  V N  M +  D  NG  QY ++   AYY  SPLPN
Sbjct: 24  GSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHD-PNG-SQYFATTQQAYYIPSPLPN 81

Query: 63  VPPTPFDTAYGASLLPSHLLMGSPFVSSPN 92
            PPTPFDTAYGA+LLPSHLLMGSP+VS+PN
Sbjct: 82  APPTPFDTAYGATLLPSHLLMGSPYVSTPN 111

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  432 bits (1110), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 274/656 (41%), Positives = 374/656 (57%), Gaps = 86/656 (13%)

Query: 519  EEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIP- 577
            E++D L+ KL+   ++   L + +  Y  P+   H  HL N  +S +  +S  F Q +P 
Sbjct: 463  EKLDKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLS-SSSNPFEQQLPY 521

Query: 578  --------------SPLPLNEQMFMNDSNQSNGAVIPQQLIAAPSPL--SSNLQINQRVL 621
                            LP N Q F N  N   G + P   +   +PL   +   +N    
Sbjct: 522  SYEEDDDQRTNVRSGSLPANPQ-FPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAF 580

Query: 622  P------------NAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNV 669
                         N I+++LEQ+   +++V +S+G+D GNRTIYIGNIN RS+ EDICNV
Sbjct: 581  SMNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNV 640

Query: 670  VRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPK 729
            VRGGILQ++KYI  K I F+TFIEA +A+ FYANSFIDPIVLH + L++GWG+Y  PLPK
Sbjct: 641  VRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPK 700

Query: 730  SISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQ 789
            +++LAVT+GASRNVYVSLPEFAFK+KFI+DP+Y++ H+   LP A+QLR DFS YG IEQ
Sbjct: 701  AVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQ 760

Query: 790  INYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLIN 849
            INYL DSHCCW+NF+NIS+AI LVE+      AH+      V++   EKF+ RY GL+IN
Sbjct: 761  INYLKDSHCCWVNFLNISAAIRLVED------AHNP-----VESKFSEKFNNRYDGLIIN 809

Query: 850  YGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERR-----RQNENDKKESFDKV 904
            YGKDRCGN+NK+L++ KNSRFYKKVK  S N++L +LEE+R     R N   K  S D  
Sbjct: 810  YGKDRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQ 869

Query: 905  LN-LESLGISLDP----------HKDAGIGVIETENITGDEIESEIEAENVNDNETTXXX 953
            L+ L++ GI +D            K   +  I+T+    + +  +IE ++   NET    
Sbjct: 870  LSKLDAFGIGIDTVSNNEEDGNIEKGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDNN 929

Query: 954  XXXXXVANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSS 1013
                   N  ++  +SDE+   EL             +       S+  +  K    R+S
Sbjct: 930  TE----GNNTLENISSDESSNIELMISSPKESVQKGDVITNQKPHSNNHHNFK----RNS 981

Query: 1014 SQTVINSKRPVKVEDEDDVGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAE 1073
            S    N +R  + +       +Q  HR++       AP+          E  F  S N +
Sbjct: 982  SS---NRQRYKETD-------TQNTHRNNNNSNATFAPN---------KEFGFGISPNVD 1022

Query: 1074 TANNRERKRGSLPRH-RTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
                  +K  +  +  R IPGSDVMAQYLAQ+QHSTFMYAANILGASAED +Y +E
Sbjct: 1023 EHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078

 Score =  243 bits (619), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 174/268 (64%), Gaps = 12/268 (4%)

Query: 185 EINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYF 244
           E +P+ L  +PFR++YKILP+GDDAYRTRSLL ENV  S +LH+ +  FV+F+ +ES Y 
Sbjct: 166 ETDPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYL 225

Query: 245 VDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLN 304
           + N  + D  D +TE  S+L+SFLTR  CL FYNN+LQRL EFK  LKS++L L FV + 
Sbjct: 226 I-NHHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIK 284

Query: 305 YESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTE 364
           Y+ E      E E+   VDE       S     S++ ++ N  ATRSI+I+FK+   + E
Sbjct: 285 YQDEN-----EEEETNIVDEP------SFYTKESVYFELSNPQATRSILIQFKNPCSEQE 333

Query: 365 LFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFS 424
           LF K+L+FL++  N RYILESIDLVN     N+FP++YA+LTF+NI MA+E+ DYLK   
Sbjct: 334 LFDKKLKFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHG 393

Query: 425 KSLEISKCFYVSLTPLMVSSTRSSVANI 452
               I  C +V + P  VS   S  A+I
Sbjct: 394 PRYGIQDCMFVQVIPKAVSCVSSKRASI 421

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 1/47 (2%)

Query: 45  QYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91
           QY  +Q P YY  SPLPNVPPTPFDTAYGA+LLPSHLLMGSPFV++P
Sbjct: 61  QYFPTQQP-YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATP 106

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  429 bits (1103), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 256/619 (41%), Positives = 351/619 (56%), Gaps = 98/619 (15%)

Query: 524  LTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKT-VENSRHFPQDIPSPLPL 582
            +  KL  +E+   +  +   +YS P I   + HL N+ IS+  +  +    Q  PS    
Sbjct: 497  IANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSPPSGYME 556

Query: 583  N-------------EQMFMNDSNQSNGAVIPQQLIAAPSPLSSNLQINQRVLPNAITQSL 629
            N              + + ND    N      QL   P P                 Q+L
Sbjct: 557  NMWTTTPFLSSHIVHEEYANDRVDYNMKHYNNQLYNVPLP-----------------QTL 599

Query: 630  EQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFV 689
            +  F  SA++AS MG  VGNRTI+IGNINPRS+ EDICNV RGGI+Q +KYI EK I FV
Sbjct: 600  QSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFV 659

Query: 690  TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPE 749
             FI+  +A QFYANSFIDPI+LH N L++GWG + GPLPK+I LAVT GASRNVYVSLPE
Sbjct: 660  IFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPE 719

Query: 750  FAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSA 809
            FAFK+K+I+DP YK+ H    LP  +QLREDFS +G++EQIN+L D HCCWINF NI SA
Sbjct: 720  FAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSA 779

Query: 810  IGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSR 869
            I LVE +  E                 E++  RYKGL+I YGKDRCGN+NK+LV+ KNSR
Sbjct: 780  IKLVELVKNED-----------NNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSR 828

Query: 870  FYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETEN 929
            +++KVK+PSYNIRL +LEE R++N+ + K+  +K +NL+SLGI+  P+++  I   ET +
Sbjct: 829  YFRKVKKPSYNIRLQQLEEERKRND-EIKQIDNKRINLDSLGITTSPNQN--IQEDETLS 885

Query: 930  ITGDEIESEIEAENVNDNETTXXXXXXXXVANCDVKRATSDETDYEELFNKXXXXXXXXX 989
            +   ++ S+   +N ++NE+             D+  + S+ +                 
Sbjct: 886  LAKLKLTSDTGFKN-SENES-------------DIDDSASNSS----------------T 915

Query: 990  XIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKVEDEDDVGISQLNHRSSLRQAPPR 1049
             +E+I++SP +     KS   R      ++     KV+                +   P 
Sbjct: 916  DVELIINSPGN---GFKSHRNRKPKPNNLDLGERPKVD------------AIVFKADGPM 960

Query: 1050 APSTLSYDHLKKSETSFQDSRNAETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTF 1109
            AP+ LS+D+ +   T   + R+      R RKR      + IPGSDVM+QYLAQVQHSTF
Sbjct: 961  APNKLSHDYHRTHNTRVDNPRSE-----RTRKRT---HKKIIPGSDVMSQYLAQVQHSTF 1012

Query: 1110 MYAANILGASAEDNAYSEE 1128
            MYAAN+L AS E+  + +E
Sbjct: 1013 MYAANVLNASIEEPEFYDE 1031

 Score =  176 bits (446), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 155/257 (60%), Gaps = 16/257 (6%)

Query: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKNDDLED 255
           ++I+Y+ILP GDD Y TRSLL EN++ S DLH+ ++ FV +  +ES Y V +      E 
Sbjct: 210 YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPS-----YET 264

Query: 256 GETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLSTFVE 315
            +    S+L+SF +RS CL+FYN++LQ+LSE+K  L S++L L FV L Y    ++   +
Sbjct: 265 HQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNIN---K 321

Query: 316 GEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELF-RKRLQFLD 374
           G     V+ Q +  +    +++ + + V N  ATRS+ IEF   ++K + F    L FL 
Sbjct: 322 GNGKISVESQKNETD--FELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLS 379

Query: 375 ESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISKCFY 434
            + NKRYI+ES+ +VN +   N+FP +Y +L+FLNI M +EVL Y++  + S  I  C Y
Sbjct: 380 SNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLY 439

Query: 435 VSLTPLMVSSTRSSVAN 451
           VS        T+ +V+N
Sbjct: 440 VSF-----DRTKHAVSN 451

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 57/111 (51%), Gaps = 9/111 (8%)

Query: 3   NSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVD--FINGVGQYGSSQHPAYYTNSPL 60
           N NP  P  N+  R        N M  N      +D    +   QY S  + +    +PL
Sbjct: 49  NMNP--PPYNFQNRGYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPYHS--QQTPL 104

Query: 61  PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPN---MQGGYSPARSSNLKRK 108
           PN PPTPFD AYG +LLPSH+LM SPFVS+PN   +    SP+R  +  R+
Sbjct: 105 PNPPPTPFDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRR 155

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  426 bits (1094), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 273/641 (42%), Positives = 375/641 (58%), Gaps = 62/641 (9%)

Query: 519  EEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPS 578
            E +  L +KLQ   L   +L +    Y  P + E S HL ++ ISK + NS+    D+ S
Sbjct: 379  ESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAL-NSKSSLNDLTS 437

Query: 579  PL--PLNEQMFMND--SNQSNGAVIPQQLIAAPSPL-----SSNLQINQRVLPNAITQSL 629
                P  +++ +ND   + S G+++  +   +  P           +N   +   + Q+L
Sbjct: 438  NTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMN---MSKPLGQTL 494

Query: 630  EQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFV 689
            +Q +  +A+VA++MG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQS+KYI  K I FV
Sbjct: 495  QQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFV 554

Query: 690  TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPE 749
            TFIEA SAVQF+ANS I+PIVLHGN+L+VGWGH+SG LP+SISLAVTIGASRNVYVSLPE
Sbjct: 555  TFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPE 614

Query: 750  FAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSA 809
             AFK+KFI DP+Y++  E   LP  EQL EDFS +GDIE +N+L D HCCWINFMNIS+A
Sbjct: 615  HAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNA 674

Query: 810  IGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSR 869
            I LVE+ N  +             +  EKF  RYKGL I YGKDRCGN+NKNLVA KNS+
Sbjct: 675  IKLVEDANNPN-----------NDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSK 723

Query: 870  FYKKVKRPSYNIRLSKLEERRRQNEN---DKKESFDKVLNLESLGISLDPHKDAGIGVIE 926
            ++KKVK+ SYNIRL K ++          D+ +  DK +  ++ GIS          V +
Sbjct: 724  YFKKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGIS----------VGD 773

Query: 927  TENITGDEIESEIEAENVNDNETTXXXXXXXXVANCDVKRA--TSDETD--YEELFNKXX 982
            T+N+  D  E     + + ++E               +  A  T +ET+    +  +K  
Sbjct: 774  TQNLVRDSDEE----QKLEEDELLRLSDLNNTGGGLGISLASSTGEETNTPVSDESSKEE 829

Query: 983  XXXXXXXXIEVIMHSPSDPEYA-LKSQTL-RSSSQTVINSKRPVKVEDEDDVGISQLNHR 1040
                    +++++ +P   + + L+S+T  RS  Q  + +  P K      + I +++  
Sbjct: 830  SVSSESSDVDILVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAI-IPRVS-S 887

Query: 1041 SSLRQAPPRAPSTLSYDHLKKSE-TSFQDSRNAETANNRER---------KRGSLPRHR- 1089
            +SL   PP APSTLS  +   S+  S + SR   T  +  R         K+   PR R 
Sbjct: 888  ASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRK 947

Query: 1090 --TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128
               IPGSDVMAQYLAQ+QHSTFMYAANILG    +  + +E
Sbjct: 948  SKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988

 Score =  138 bits (347), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 142/276 (51%), Gaps = 45/276 (16%)

Query: 193 QRPFRINYKILP----TGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND 248
           QR + + + ILP     G D Y TRSLL  N++  T LH  +  F KF+ +ES Y VD+ 
Sbjct: 133 QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ 192

Query: 249 KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESE 308
           +            SVL+SFLT+  CL+FYN +LQ+LSEFK  LKSK L L F  L     
Sbjct: 193 QQ-----------SVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLR---- 237

Query: 309 CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRK 368
                  G   +E+  +V  A                  ATRS+I+EF+  ++   L  K
Sbjct: 238 ---DVKTGPTLQEIKIEVLRAG-----------------ATRSLILEFQDKVD-LALLSK 276

Query: 369 RLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLE 428
            L F+  ++  RY++E+I++VN    S  F  +YA++ F++I MA+E ++YLK  S  L 
Sbjct: 277 SLGFI-VNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLA 335

Query: 429 -ISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLS 463
            + K  YV+ T    +S +S    +  S+   R LS
Sbjct: 336 GLIKFRYVNTT---SASGKSEFQTLSSSQLNERALS 368

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 1/58 (1%)

Query: 47  GSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN 104
           GS ++  YY  + +P  P TPFDT+YG SLLPSHLLM SPF+++P M G  SP R+  
Sbjct: 32  GSREYSGYYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGM-GSASPHRAGG 88

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  421 bits (1081), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 256/619 (41%), Positives = 358/619 (57%), Gaps = 89/619 (14%)

Query: 545  YSTPTINEHSTHLSNIKISKTVEN--SRHFPQD-IPSPLPLNEQMFMNDSNQSNGAVIPQ 601
            Y  P + EH+ H S+I ISK + +  SR+     I SP P  +++ +++S        P 
Sbjct: 329  YGPPVVEEHNQHCSHITISKALSSKVSRNGSSSSIASPQP--QEVLVSNSE------APS 380

Query: 602  QLIAAPSPLSSNLQINQRVLPN---------AITQSLEQNFNVSAKVASSMGSDVGNRTI 652
               +  S LS+  Q     +P           + Q+L+Q +  +A+VA++MG   GNRT+
Sbjct: 381  SRNSIVSLLSARSQGPTYPVPGYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTV 440

Query: 653  YIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLH 712
            YIGNI+PRS+ EDICNVVRGGILQS+KYI  K I FVTFIEA SAVQF+ANS I+PIVLH
Sbjct: 441  YIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLH 500

Query: 713  GNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALP 772
            G++L+VGWGH+SG LP+SISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP
Sbjct: 501  GSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLP 560

Query: 773  DAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVK 832
              +QL +DFST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N  +            
Sbjct: 561  SKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDANNSN-----------N 609

Query: 833  TAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRL-----SKLE 887
             +  EKF+ RY+GL I YGKDRCGN+NKNLV+ KNS+++KKVK+ SYNIRL     S +E
Sbjct: 610  ESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLRRQQKSDIE 669

Query: 888  ERRRQNENDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDN 947
             + +  + D  E+ +K L +++ GIS+    DA     E + I  +E+   +     N  
Sbjct: 670  AQAKSGKGD--ENSEKKLQVDAFGISVGSQPDARYS-DEEQKIEENEL---LLLSKPNSA 723

Query: 948  ETTXXXXXXXXVANCDVKRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYA-LK 1006
            E          V   +   A   +       NK          +++++ +P     + L+
Sbjct: 724  EGGLGISVSQDVTVTENNTACGGK-------NKTGSVSSGSSEVDILVSAPGSANTSQLE 776

Query: 1007 SQTLRSSSQTVINSKRPVKVEDEDDVGISQLN---------HRSSLRQAPPRAPSTL--- 1054
                   +    N K+      E   G+S+L+          ++SL   PP AP+ L   
Sbjct: 777  GGGPTQRTTAASNGKK------ERSSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCH 830

Query: 1055 ------------SYDH----LKKSETSFQDSRNAETANNRERKRGSLPRHRTIPGSDVMA 1098
                         +DH    +  S++    S++ +  +++ R+R +    + IPGS+VMA
Sbjct: 831  YNSAPRRSARKNGHDHDSNPVSGSKSDI-GSKSTQGKSSKSRQRNA----QAIPGSNVMA 885

Query: 1099 QYLAQVQHSTFMYAANILG 1117
            QYLAQ+QHSTFMYAA+ILG
Sbjct: 886  QYLAQLQHSTFMYAADILG 904

 Score =  147 bits (370), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 141/262 (53%), Gaps = 46/262 (17%)

Query: 182 IFDEINPEILLQRPFRINYKILP---TGD-DAYRTRSLLIENVDRSTDLHSLVKNFVKFN 237
           ++DE   +I    P+++ + ILP    GD D +RTRSL   N++    LH  +  F KF+
Sbjct: 53  LYDEGTRQI----PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFD 108

Query: 238 TLESAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLN 297
            +ES Y VD            E  SVL+SFLT+  CL+FYN ILQ+LSEFK  L+SK L+
Sbjct: 109 RIESVYVVDR-----------EQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELS 157

Query: 298 LKFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFK 357
           L F                  P++V        +S      +  +V    ATRS+ +EFK
Sbjct: 158 LSFAS----------------PQKV--------ESGPTLQEIKFEVLRAGATRSLGLEFK 193

Query: 358 SALEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVL 417
             ++   L  K+  F D S   RY++ESI+ VNTD PS  F  NYA++ F++I MAVE +
Sbjct: 194 DEIDFASLL-KKFDFFDNS-GPRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETM 251

Query: 418 DYLK-KFSKSLEISKCFYVSLT 438
           +YLK +  +S  ++K  YV+ T
Sbjct: 252 EYLKVQTPESFGLTKVSYVNST 273

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  428 bits (1101), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/420 (52%), Positives = 288/420 (68%), Gaps = 42/420 (10%)

Query: 519 EEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPS 578
           +EID L++ L+G      ++ +   +Y  P   E S HLSN     +V  +      I S
Sbjct: 527 QEIDFLSSSLKGSH----TITVAVDEYPKPFFAEFSDHLSNA----SVLEASALDTQISS 578

Query: 579 PLPLNEQMFMNDSNQSNGA-----VIPQQLIAAPS---PLSSNLQIN-----------QR 619
           P P    +   DS    GA     V P    A  S   PL  ++ +N            +
Sbjct: 579 PHPQEVIVPSQDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNK 638

Query: 620 VLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIK 679
            +   ITQSL++ F  SA+VA+SMG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQSI+
Sbjct: 639 TMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIR 698

Query: 680 YIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGA 739
           ++ +K I FVTFIEA +AVQFY N+FIDPIVLHGNML+VGWGH+SGPLPKS+SLAVT+GA
Sbjct: 699 FLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGA 758

Query: 740 SRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCC 799
           SRNVYVSLP+FAFK+K+I+DPQY++  +   LP  EQLR DF+ +GDIEQIN+LSD HCC
Sbjct: 759 SRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCC 818

Query: 800 WINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNIN 859
           W+NFMNISSAI LVEE+       ++ GE   K+     FD RY+GL+I YGKDRCGN+N
Sbjct: 819 WVNFMNISSAIKLVEEIK------YNDGEAFHKS-----FDNRYRGLIIGYGKDRCGNVN 867

Query: 860 KNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNE----NDKKESFDKVLNLESLGISLD 915
           KNL++GKNSRFYKKVK+PSYNIRLS++EE R+++E    +  + + +K+L   SLGI L+
Sbjct: 868 KNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLE 927

 Score =  201 bits (512), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 163/285 (57%), Gaps = 25/285 (8%)

Query: 191 LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKN 250
           + + PF + Y++LP GDD YRTRSLL ENV+ S DL+S V  + ++  +ES Y    D+N
Sbjct: 210 MFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMF-KDRN 268

Query: 251 DDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNY----- 305
           D  +       SVL+SFL+R  CL+ YN++LQRL+EFK  LKSKSL + FV L Y     
Sbjct: 269 DKTKH------SVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVD 322

Query: 306 ESECLSTFVEGEKPKEVDEQVHAANDSMMIS------------ASLHHDVENKDATRSII 353
           E+E          P    +   A+   +  S            ASL +D+ N+ ATRS+ 
Sbjct: 323 ENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVA 382

Query: 354 IEFKSALEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMA 413
           +E     +KT+L  + L FL  + N+RY+LESI L+N   P   FP+NYA+LTFLNI MA
Sbjct: 383 LELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMA 442

Query: 414 VEVLDYLKKFSKSL-EISKCFYVSLTPLMVSSTRSSVANIYESKT 457
           VEVLDY++    +  +  KCF+VS++    +S+   +     S T
Sbjct: 443 VEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSIT 487

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 4/50 (8%)

Query: 1072 AETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1121
             +    R ++R +    + IPGSDVMAQYLAQ+QHSTFMYAANILGA+AE
Sbjct: 1202 GQQGKGRNKRRNA----KAIPGSDVMAQYLAQLQHSTFMYAANILGATAE 1247

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 46/69 (66%), Gaps = 5/69 (7%)

Query: 27  MVGNQMMYHPVDFINGVGQYGSSQHPAYYT--NSPLPNVPPTPFDTAYGASLLPSHLLMG 84
           M  + M + PV  +    QY   Q PAYY     PL N PPTPFDTAYG +LLPSHLL+G
Sbjct: 47  MANSPMAFPPVGSLQA--QYAPPQ-PAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIG 103

Query: 85  SPFVSSPNM 93
           SPFVSSP++
Sbjct: 104 SPFVSSPDL 112

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  396 bits (1017), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 237/303 (78%), Gaps = 21/303 (6%)

Query: 623  NAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIP 682
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRS+ ED+CNVVRGGILQ I ++ 
Sbjct: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858

Query: 683  EKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 742
            +K I FVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPKSISLAVTIGA+RN
Sbjct: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918

Query: 743  VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 802
            VYVSLPEFAFK+KFI++P Y++ HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978

Query: 803  FMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNL 862
            FMNI+SAI LVEE+N++     DG           KFDGRY GL+I YGKDRCGN+NKNL
Sbjct: 979  FMNINSAITLVEEVNED-----DGIRF------HNKFDGRYNGLIIGYGKDRCGNVNKNL 1027

Query: 863  VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKV----------LNLESLGI 912
            VA KNS+F+KKVK+P+Y I+L K+EE RR  E +   + +K+          +NLESLGI
Sbjct: 1028 VATKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGI 1087

Query: 913  SLD 915
            + +
Sbjct: 1088 TFE 1090

 Score =  160 bits (405), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 109/304 (35%), Positives = 151/304 (49%), Gaps = 63/304 (20%)

Query: 191 LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKN 250
           LL+ P  ++YKILP G D +RTRSLL+EN+++S D  +LVKNF+ F  +ES Y +     
Sbjct: 256 LLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI----- 310

Query: 251 DDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECL 310
             L  G   N S+L+SF++R  CL+FYNN+LQRL EFK  L SKSL L FV L YE    
Sbjct: 311 -KLNPGSKYN-SILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDY 368

Query: 311 STFVEGEKPKEVDE-----------------------------------QVHAANDSMMI 335
           +  +        DE                                    ++  N  +  
Sbjct: 369 NHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTF 428

Query: 336 SASLHHDVENKDATRSIIIEFKSALEKTELF-RKRLQFLDESKNKRYILESIDLVNT--- 391
           +++L  D+  + ATRS++++F   + K +L   K   F++ + N RYILESI LVN    
Sbjct: 429 ASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENN 488

Query: 392 -----------------DVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISKCFY 434
                            D P ++F  NY +LTF NI MA+E  DY K     L I  CF+
Sbjct: 489 TKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFF 548

Query: 435 VSLT 438
           VS T
Sbjct: 549 VSKT 552

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 51/69 (73%), Gaps = 4/69 (5%)

Query: 46  YGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQG-GYSPAR-SS 103
           + S+ +P YY  SP+P+ PPTPFD +YGA+LLPSHLLMGSPFVS+PN+    YS    SS
Sbjct: 89  HTSALNPTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISS 146

Query: 104 NLKRKAYSR 112
              RK++SR
Sbjct: 147 TPTRKSFSR 155

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 55/111 (49%), Gaps = 21/111 (18%)

Query: 1034 ISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRERKRGSLP------- 1086
            I Q N    L Q PP A STL+  + K       D+    T++  +     LP       
Sbjct: 1240 ILQSNQVPVLNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEK 1299

Query: 1087 --------------RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1123
                            +TIPGSDVM+QYL Q+QHSTFMYAANILG SAEDN
Sbjct: 1300 NPFRGPRNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDN 1350

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  381 bits (979), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 245/656 (37%), Positives = 351/656 (53%), Gaps = 113/656 (17%)

Query: 539  EITSHDYSTPTINEHSTHLSNIKISKTVE-------------NSRHFPQDIPSPLPLNEQ 585
            ++   +Y TP I +HS HL++I IS+  +             N+ +          L+  
Sbjct: 408  QVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSLSGV 467

Query: 586  MFMND--SNQSNGAVIP----------------QQLIAAPSPLS----------SNLQIN 617
            +FMND  S+ S   ++P                Q +   P P+S          S     
Sbjct: 468  LFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSDGNGGSPSYFM 527

Query: 618  QRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQS 677
              ++   I Q+L++ +   A    S  + + NRT+YIGNI+PRS+ EDICNVVRGGILQ+
Sbjct: 528  DPMVGAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQT 583

Query: 678  IKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTI 737
            IK+I  KRI FVTFIE  +AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVTI
Sbjct: 584  IKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTI 643

Query: 738  GASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSH 797
            GASRNVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D H
Sbjct: 644  GASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGH 703

Query: 798  CCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGE--EKFDGRYKGLLINYGKDRC 855
            CCW+NFMNI+ AI LVE+ N            I K   +   +FDGRYK L+I YGKDRC
Sbjct: 704  CCWVNFMNIAHAIRLVEDSNSP----------IEKNLEKFHAQFDGRYKNLIIGYGKDRC 753

Query: 856  GNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESL-GISL 914
            GN+NKNL A KNSRFYKK+K+ SY+++    + ++ + E+    S D   N E L G+ +
Sbjct: 754  GNVNKNLAANKNSRFYKKIKKQSYSMK----QGKQPRKEDGIVNSDDLTKNNEVLPGVQM 809

Query: 915  DPHKDAGIGVIETENITGDE----------IESEIEAENVNDNETTXXXXXXXXVANCDV 964
            +  K+ G+G  E++++ GD+            ++I  +  + +  +          + D 
Sbjct: 810  NSSKNGGVG--ESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSDGVEEGDECDDDDA 867

Query: 965  KRATSDETDYEELFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPV 1024
              +TS  +D                 I++I+  P + +      +     +   +++R  
Sbjct: 868  GYSTSGSSD-----------------IDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQ 910

Query: 1025 KVEDEDDVGISQ------LNHRS---SLRQAPPRAPSTLSYDHLK------------KSE 1063
                      +Q      L+H S   SL   PP APS++   HL              S 
Sbjct: 911  HSNAASSASYNQQYSLGSLDHTSSAGSLDAPPPLAPSSMQ-QHLADRRPRHTPGRSTDSS 969

Query: 1064 TSFQDSRNAETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1119
             S  +S+    AN + R+R      + I G DVM+QYL Q+ HSTF+YA NILGA+
Sbjct: 970  ASQYNSQTPTNANYKSRRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025

 Score =  149 bits (377), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 136/247 (55%), Gaps = 43/247 (17%)

Query: 195 PFRINYKILPTGDDAYRTRSLLIENVD--RSTDLHSLVKNFVKFNTLESAYFVDNDKNDD 252
           P+ IN+KILP G D Y TRSLL+ N++  R  D+H+ + +FVKF  +ES Y +D      
Sbjct: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMD------ 196

Query: 253 LEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLST 312
                 +N S+L+SFLT++ CL+FYNN+LQR SEFK  L S  L++ FVC          
Sbjct: 197 ------DNHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---------- 240

Query: 313 FVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRKRLQF 372
                             D       L  +V  + ATRS+ +EF+ ++++      RL+F
Sbjct: 241 -----------------QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKF 283

Query: 373 LDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFS--KSLEIS 430
                ++R++LE IDL+N    +  F   Y +L F++I MA+EV D+L++ S  + L IS
Sbjct: 284 PWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNIS 343

Query: 431 KCFYVSL 437
           +  +V++
Sbjct: 344 RIQFVNV 350

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 60 LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP 91
          +P VP TPFD  YGASLLPSH+LMGSPF+S+P
Sbjct: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  373 bits (957), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/417 (48%), Positives = 268/417 (64%), Gaps = 44/417 (10%)

Query: 519 EEIDLLTTKLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISK--------TVENSR 570
           + ++  T KLQG+ L   +L I    Y    I EH  HL++I ISK        +   S 
Sbjct: 432 QTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSSVSL 491

Query: 571 HFPQDIPSPLPLNEQMFMND-SNQSNGAVIPQQLIAA------PSPLSSNLQINQRVLPN 623
              Q++ S  P+ ++M+++D SN +   V+ Q  +A+      P P    + + +     
Sbjct: 492 QGNQNLTSS-PVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTK----- 545

Query: 624 AITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPE 683
            I Q+L+Q    +A+VAS+MG  +GNRT+Y+GNINPRS+ EDICNVVRGGILQ IK+   
Sbjct: 546 PIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEH 605

Query: 684 KRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 743
           K + FVTFIEA +AVQF+AN+ I+PIVLHGN+L+VGWGH+ G L +SI+LAVTIGASRNV
Sbjct: 606 KHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNV 665

Query: 744 YVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 803
           YVSLPE+AFK+KFI DP++++  E   LP  EQLR+DFS +G+IEQINYL D HCCW+NF
Sbjct: 666 YVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNF 725

Query: 804 MNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDG----RYKGLLINYGKDRCGNIN 859
           MNI+SAI LVE+ N                A  +KF G    RYKGL+I YGKDRCGN+N
Sbjct: 726 MNITSAIKLVEDAN---------------GADNKKFHGSYQDRYKGLIIGYGKDRCGNVN 770

Query: 860 KNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKESFDKVLNLESLGISLDP 916
           KNLVA K SRF+KKVK+ SY IR+ K  +    N  +   SF       + GI + P
Sbjct: 771 KNLVANKKSRFFKKVKKASYKIRMHKQNKAGGSNGQEPISSFQD----NAFGICISP 823

 Score =  165 bits (418), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/256 (38%), Positives = 143/256 (55%), Gaps = 47/256 (18%)

Query: 195 PFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKNDDLE 254
           P+ IN+KILP GDD Y TRSLL+ NV+ S  LH  +  FVKF  +ES Y V  ++ ++ E
Sbjct: 182 PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEEE 241

Query: 255 DGETENL--------------SVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKF 300
           + E E                S+L+SFLT++ CL+FYNN+LQ+LS+FKI L SKSL L F
Sbjct: 242 EEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301

Query: 301 VCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSAL 360
           V L  E                                +  DV  K ATRSI +EFK++ 
Sbjct: 302 VSLTSED-------------------------------IRDDVLRKGATRSIALEFKNSF 330

Query: 361 EKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYL 420
              +L  + ++ L  + N R+++E ID+VNT+ P+  F  +YA++ F++I MAVE   YL
Sbjct: 331 TTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYL 388

Query: 421 KKFSKSLEISKCFYVS 436
             + + L IS+ F+V+
Sbjct: 389 LNWDEKLGISRLFFVT 404

 Score = 79.0 bits (193), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 4/74 (5%)

Query: 22 NGMNAMVGNQMMYHPVDFING----VGQYGSSQHPAYYTNSPLPNVPPTPFDTAYGASLL 77
          NG+       M YHP+  +NG      Q        YY  SP+P+ P TPFDT+YGA+LL
Sbjct: 21 NGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQGYYAGSPMPSAPQTPFDTSYGATLL 80

Query: 78 PSHLLMGSPFVSSP 91
          PSHLLMGSPF+S+P
Sbjct: 81 PSHLLMGSPFISTP 94

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 54/100 (54%), Gaps = 9/100 (9%)

Query: 1033 GISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQDSRNAETANNRERKRGSLP------ 1086
            G   +   +SL   PP APST+S  +   S  S     N    +  +++ G         
Sbjct: 967  GFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHHG 1026

Query: 1087 RHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1123
            RHR    IPGS VMAQYLAQ+QHSTFMYAANILG +  DN
Sbjct: 1027 RHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  333 bits (855), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 204/492 (41%), Positives = 279/492 (56%), Gaps = 73/492 (14%)

Query: 531 IELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQ----- 585
           + L   SL++   +Y  P I  H  HL ++ IS+  +        + S   L E      
Sbjct: 416 LALGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKT-------LTSSTSLVEMDGGPN 468

Query: 586 -MFMNDSNQSNGAVI---PQQLIAAPSPLSSNLQINQRVLPNAI-------TQSLE-QNF 633
               N SN   G ++   P      PS L + L IN  ++P  +       +QSL   N 
Sbjct: 469 GGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNELNINTSLMPGPMGGQVLGTSQSLSLHNP 528

Query: 634 NVSAKVASSMGSD---------------------VG---NRTIYIGNINPRSRAEDICNV 669
           N +     S   D                     VG   NRT+YIGNI+PRS+ EDICNV
Sbjct: 529 NDNGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDICNV 588

Query: 670 VRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPK 729
           VRGGILQ+IK+I  KRI FVTFIEA +A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK
Sbjct: 589 VRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPK 648

Query: 730 SISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQ 789
           +I+LAVTIGASRNVYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQ
Sbjct: 649 NIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQ 708

Query: 790 INYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLIN 849
           INYL D HCCW+NFMNI+ AI LVE+ N  S  + +            +FDGRYK L+I 
Sbjct: 709 INYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLE--------KFHAQFDGRYKNLIIG 760

Query: 850 YGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR-----QNENDKKE--SFD 902
           YGKDRCGN+NKNL A KNSRF+KK+K+ +   + +K ++ +R      +++ +K+  S +
Sbjct: 761 YGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRGTSSASSDDARKDDASTE 820

Query: 903 KV-------LNLESLGISLDPHKDAGIGVIETE---NITGDEIESEIEAENVNDNETTXX 952
           KV       +  E LG++ D     G+G+  +    N  GD+I      +N +  ET   
Sbjct: 821 KVPVSSKEPVCDEILGLNDDNALAEGLGISLSSAYVNEYGDDISKRTNKKNRSKTETVEE 880

Query: 953 XXXXXXVANCDV 964
                   + D+
Sbjct: 881 DTGYTTSGSSDI 892

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 137/250 (54%), Gaps = 48/250 (19%)

Query: 195 PFRINYKILPTGDDAYRTRSLLIENVDRST--DLHSLVKNFVKFNTLESAYFVDNDKNDD 252
           P+++N+KILP G D Y TRSLL  N++R    D+H+ + NF+KF  +ES Y +D+     
Sbjct: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLLDDSH--- 214

Query: 253 LEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLST 312
                    S+L+SFLT++ CL+FYNN+LQR SEFK  L S  L++ FVC          
Sbjct: 215 ---------SILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------- 255

Query: 313 FVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFK-SALEKT-ELFRKRL 370
                             D       L  +V  +  TRS+ IEF+  ++E T +L  +++
Sbjct: 256 -----------------QDETNWFRLLQMNVVTRGVTRSLCIEFEDQSMELTSDLIHEKI 298

Query: 371 QFLDESKNKRYILESIDLVNTDVPSNQ-FPENYAVLTFLNIFMAVEVLDYLKKFS--KSL 427
            +L  S   R+++E IDLVN   P NQ F   Y ++ F+ I MA+EV +YL++ S  K L
Sbjct: 299 PWLFFS--HRFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL 356

Query: 428 EISKCFYVSL 437
            ISK  +V++
Sbjct: 357 GISKIQFVNV 366

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 1/46 (2%)

Query: 60  LPNVPPTPFDTAYGASLLPSHLLMGSPFVSSP-NMQGGYSPARSSN 104
           +P VP TPFD  YGASLLPSH+LMGSPFVS+P   QG + P+ SS+
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSASSH 124

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 1089 RTIPGSDVMAQYLAQVQHSTFMYAANILGASA 1120
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+ 
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGATT 1052

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 128/214 (59%), Gaps = 31/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+GN+    + ++ICN VRGG+LQ IK + ++ + FVTFI+  +A QFYA S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  + +     +VGWG +SGPLP  I+LAV+ GASRNVY+   +F    K  + P + +
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTE 642

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
           L           LR  F  YGD+EQIN+L + +CC+INF NIS+AI  +E++        
Sbjct: 643 L----------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKI-------- 684

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGNI
Sbjct: 685 -------------KNNPDFKDLKINFGKDRCGNI 705

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 108/226 (47%), Gaps = 35/226 (15%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI      +D+ + VR G++++IK +P+K  +F++F++  SA+ F++++ +  +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVS-----------LPEFAFKEKFIH 758
            + G  +++GWG  +   P   +  VT GA+RNVY+                +       
Sbjct: 328 NIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPS 387

Query: 759 DPQYKQLHETLALPDA----EQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVE 814
           +     L +   + D+    E+LRED   YG+I+ +  + D    +++  +I SAI +V 
Sbjct: 388 NNTSDDLEKKKNIDDSPLTEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVN 447

Query: 815 EMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
            +                     + +  Y+   I YGKDRC  I K
Sbjct: 448 NL--------------------AQTNPYYQNKRIFYGKDRCAFITK 473

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  166 bits (420), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 124/213 (58%), Gaps = 34/213 (15%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705
           ++GNRTIY+GN++ R R E++CNVVRGG+LQS+K++P++ + FVTF +  +A QFYA + 
Sbjct: 261 NLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMAS 320

Query: 706 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           +  + +     ++GWG +SGPLP  ++ A++ GASRNVY       F      DP   + 
Sbjct: 321 LHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEF 373

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
            E         LR+  S +G++EQ+N + +  C ++NF N+ SAI  VE++ K       
Sbjct: 374 FEE------RHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWP----- 422

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                           +++ L +NYGKDRCGN+
Sbjct: 423 ----------------QFQQLKVNYGKDRCGNV 439

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 112/245 (45%), Gaps = 51/245 (20%)

Query: 649 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDP 708
           +RT+Y+GNI P     ++ + V+ G+++  +  P K  +FV+F++  SA+ F++++ ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 709 IVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHET 768
           + +    +++GW   +   P   +   + GA+RNVY+                       
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG---------------------- 135

Query: 769 LALPDA---EQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
             LPD     +L +D S YG+I+ +  LS     +++  +I  AI  V  + +++  + D
Sbjct: 136 -NLPDGVSRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDNKIYSD 194

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYN-IRLS 884
                                 +++GKDRC  + K     + SR  + +  P  + +R+ 
Sbjct: 195 --------------------RRVSFGKDRCAYVTKL----QQSRAAQFLGLPEEDAVRME 230

Query: 885 KLEER 889
           +L +R
Sbjct: 231 QLRDR 235

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  167 bits (422), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 129/218 (59%), Gaps = 32/218 (14%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705
           ++GNRTIY+GN+    + E+ICN VRGG+LQ IK + ++ + FVTFI+  +A QFYA S 
Sbjct: 338 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSS 397

Query: 706 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +FA  +K  H P + + 
Sbjct: 398 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQH-PIFTE- 455

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++         
Sbjct: 456 ---------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI--------- 497

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLV 863
                       K    +K L IN+GKDRCGN+ +   
Sbjct: 498 ------------KSIPTFKDLKINFGKDRCGNVPRQFC 523

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 105/214 (49%), Gaps = 29/214 (13%)

Query: 649 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDP 708
           +RT+Y+GN+ P    +++ + VR G+++ +K +PEK  +F++F+E  SA+ F++++ +  
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 709 IVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKQLH 766
           + +    +++GWG  +   P   +     GA+RNVY+           ++  DP  + + 
Sbjct: 162 LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDPNEEVIT 221

Query: 767 ETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDG 826
           E       E+LR D S +G++E +  + +    +++F +I +AI +V  +          
Sbjct: 222 E-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL---------- 264

Query: 827 GEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                        +  Y    I YGKDRC  I K
Sbjct: 265 ----------ANINPYYAQKKIFYGKDRCAFITK 288

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  169 bits (428), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 160/274 (58%), Gaps = 41/274 (14%)

Query: 587 FMNDSNQSNGAVIPQQLIAAPSPLSSNLQINQR-VLPNAITQSLEQNFNVSAKVASSMG- 644
           F+  + Q N A    Q +   S + +  + + R  + NA+   L+Q+   +A   ++ G 
Sbjct: 390 FITKTQQHNAA----QFLGVQSGMENMAKFSDRKFISNAL---LQQSAAAAAIATAAGGP 442

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+GN+    + E+ICNVVRGG+LQS+K + ++ + FVTFI+  +A QFYA S
Sbjct: 443 NNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMS 502

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  + +     +VGWG +SGPLP +++LAV+ GASRNVY+      F++  + DP+   
Sbjct: 503 SLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR--- 557

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
                 +   + LR+ F  YG++EQIN+L + +CC+INF NIS+AI  ++++        
Sbjct: 558 ------IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI-------- 603

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  ++ L IN+GKDRCGN+
Sbjct: 604 -------------KSNPHFEDLKINFGKDRCGNV 624

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 106/212 (50%), Gaps = 33/212 (15%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI      +++ + VR G+++ +K IPEK  +F++F++  SA+ F++++ +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            + G  +++GWG  +   P   +  +   A+RNV++         K  +D   K+     
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKE----- 323

Query: 770 ALPDAE-QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGE 828
             P  E +LRED   +G+IE +  + +    +++F +I+SAI  V   N  SM  +    
Sbjct: 324 --PITEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVH--NLRSMNPY---- 375

Query: 829 VIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                         Y+   I YGKDRC  I K
Sbjct: 376 --------------YENKKIAYGKDRCAFITK 393

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  168 bits (425), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 129/214 (60%), Gaps = 34/214 (15%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705
           ++GNRT+Y+GN+    + E+ICN VRGG+LQS+K + ++ + FVTFI+  +A QFYA S 
Sbjct: 397 NLGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSS 456

Query: 706 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           +  + +H    ++GWG +SG LP +++LAV+ GASRN+YV   +F              +
Sbjct: 457 LHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDF------------NAI 504

Query: 766 HETLALPDAEQ-LREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
            ET      EQ LRE F  +G++EQIN+L + +CC+INF NIS+AI  ++++        
Sbjct: 505 DETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI-------- 556

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L +N+GKDRCGN+
Sbjct: 557 -------------KCNPYFKNLKVNFGKDRCGNV 577

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 111/218 (50%), Gaps = 39/218 (17%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI P   A+ + + VR G+++ +K +P++  +F++F++  SA+ F++++ +  +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTI---GASRNVYVSL----PEFAFKEKFIHDPQY 762
            + G  ++VGWG    P P    +A  I   GA+RNVY+      P+ A   +F  DP  
Sbjct: 221 NIEGRDIKVGWGK---PTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 763 KQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMA 822
           + + E       E+LR+D + +G+IE I  + D    +++F +I SAI +V  +      
Sbjct: 276 EIVSE-------EKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNL------ 322

Query: 823 HHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                            +  Y    I YGKDRC  I K
Sbjct: 323 --------------ASVNPYYTNKKIFYGKDRCAFITK 346

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  169 bits (427), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 133/214 (62%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRTIY+GN+    R E+ICNVVRGG+LQS+K + ++ + FVTFI+  +A QF+A S
Sbjct: 494 NNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMS 553

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  + +     +VGWG +SGPL  +++LAV+ GASRN+Y+   +FA  +K   +P + +
Sbjct: 554 SLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKR-DNPIFTE 612

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
                     + LR+ FS YG++EQIN+L + +CC+INF NIS+AI  ++++    +   
Sbjct: 613 ----------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV--- 659

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                             +K L IN+GKDRCGNI
Sbjct: 660 ------------------FKDLKINFGKDRCGNI 675

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 139/296 (46%), Gaps = 61/296 (20%)

Query: 606 APSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGN---------RTIYIGN 656
            P+P+ SN+      + N +T +     N + ++ S+MGS + +         RT+Y+GN
Sbjct: 169 GPTPMLSNMPSMVPTVENMVTATAAAVANANTRMQSTMGSRLNDPLDFTTAPSRTVYLGN 228

Query: 657 INPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNML 716
           I      +++ + VR G+++ +K IPEK  +F++F++  SA+ F++++ +  + ++G  +
Sbjct: 229 IPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRLNINGKDI 288

Query: 717 RVGWGHYSGPLPKSISLAVTIGASRNVYVS-LPEFAF---KEKFIHDPQYKQ--LHETLA 770
           ++GWG  +   P   +  +  GA+RNV++  L   +F   K K    P  +   ++ T++
Sbjct: 289 KIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNHDINATIS 348

Query: 771 LPDAE--------------------------QLREDFSTYGDIEQINYLSDSHCCWINFM 804
             + E                          +LR+D + +GDI+ I  + D    +I+F 
Sbjct: 349 NENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKGIAFIHFA 408

Query: 805 NISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
           +I+SAI  V  +N  SM  +                  Y    I YGKDRC  I K
Sbjct: 409 SITSAIKCVHNLN--SMNDY------------------YSTKKIFYGKDRCAFITK 444

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  166 bits (419), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 161/307 (52%), Gaps = 47/307 (15%)

Query: 557 LSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAVIPQQLIAAPSPLSSNL-Q 615
           LS IK+   + NS  +          +   F+  + + N A    Q +  P+  +++L Q
Sbjct: 327 LSAIKVVNNLSNSNPYYSKKKIYYGKDRCAFITKTQKHNAA----QFLGIPTSKANSLEQ 382

Query: 616 INQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGIL 675
            N  +L NA+ Q       ++     S  +++GNRT+Y+GN+    R EDICN +R G+L
Sbjct: 383 TNSGLLANALLQQSAAAAAIATSAGGS--NNLGNRTVYLGNLPNDIRIEDICNTIRCGLL 440

Query: 676 QSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAV 735
           Q+IK + ++ + FVTFI+  SA QFYA S I   VL     +VGWG +SGPL   ++LAV
Sbjct: 441 QNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIYGFVLQKKRCKVGWGKHSGPLSNPLTLAV 500

Query: 736 TIGASRNVYVSLPEFAF----KEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQIN 791
           + GASRNVY+   +F      +E++  D                 LR  FS YG++EQIN
Sbjct: 501 SNGASRNVYIGNIDFTADGTKRERYFTD---------------SNLRRIFSEYGEVEQIN 545

Query: 792 YLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYG 851
           +L   +CC++N+ NI++AI  ++++                     K +  +K L IN+G
Sbjct: 546 FLYSKNCCFVNYTNINNAISAIDKI---------------------KNNPTFKNLKINFG 584

Query: 852 KDRCGNI 858
           KDRCGNI
Sbjct: 585 KDRCGNI 591

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 108/215 (50%), Gaps = 26/215 (12%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI P   A D+ + VR G+++ +K +PEK  +F++F++  S++ F++++ +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAV-TIGASRNVYVSLPEFAFKEKFIHDPQYKQLHET 768
            + G  +++GWG  S PL   I+ +V T GA+RN+++         K   D      H +
Sbjct: 228 NIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIYHGS 285

Query: 769 LALPDA---EQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
               D    E+LR+D   YGDI+ I    +    +++F +I SAI +V  ++        
Sbjct: 286 DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNS------ 339

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                         +  Y    I YGKDRC  I K
Sbjct: 340 --------------NPYYSKKKIYYGKDRCAFITK 360

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  164 bits (416), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 130/214 (60%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+GN+    + E+ICNVVRGGILQ+IK + ++ + FVTFI+  +A QFYA S
Sbjct: 398 NNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMS 457

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  I +     RVGWG + GPLP +I+LAV+ GASRNVY+   +F +++    +P +  
Sbjct: 458 SLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIFT- 515

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
                    A+ LR+ F  YG++EQ+N+L + +C ++N+ NIS+AI  ++++    +   
Sbjct: 516 ---------ADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNPL--- 563

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                             +K L IN+GKDRCG I
Sbjct: 564 ------------------FKNLKINFGKDRCGTI 579

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 109/213 (51%), Gaps = 29/213 (13%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           +T+Y+GNI P     ++ + VR G+++ +K +PEK  +F+TF++  +A+ F++++ +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKQLHE 767
            + G  +++GWG  +   P   +   + GA+RNVY+ L   +     +   DP  +++ E
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKITE 282

Query: 768 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGG 827
                  E+LR D   +G+I+ +  + +    +I+F +I SA+                 
Sbjct: 283 -------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAV----------------- 318

Query: 828 EVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
           +V+   AG   +   Y+   I YGKDRC  I K
Sbjct: 319 KVVANLAGINPY---YENKKIYYGKDRCAFITK 348

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  164 bits (415), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 127/218 (58%), Gaps = 32/218 (14%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705
           ++GNRTIY+GN+    + E+ICN VRGG+LQ IK + ++ + FVTFI+  +A QFYA S 
Sbjct: 391 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSS 450

Query: 706 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +F    K +  P + + 
Sbjct: 451 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFEDDRK-LEQPIFTE- 508

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++         
Sbjct: 509 ---------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI--------- 550

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNLV 863
                       K    +K L IN+GKDRCGN+ +   
Sbjct: 551 ------------KSIPTFKDLKINFGKDRCGNVPRQFC 576

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 108/215 (50%), Gaps = 33/215 (15%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GN+ P     ++ + VR G+++ +K +PEK  +F++F++  SA+ F++++ +  +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL----PEFAFKEKFIHDPQYKQL 765
            +    +++GWG  +   P   +     GA+RNVY+      P+     ++  DP  + +
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEETI 273

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
            E       E+LR D + +G++E +  +++    +++F +I SAI               
Sbjct: 274 TE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAI--------------- 311

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
             +V+   A    +  + K   I YGKDRC  I K
Sbjct: 312 --KVVANLANVNPYYAQKK---IFYGKDRCAFITK 341

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  163 bits (412), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 130/214 (60%), Gaps = 36/214 (16%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRTIY+GN+    + E+ICNVVRGG+LQ+IK + ++   F+TFI+  +A QFYA S
Sbjct: 351 NNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMS 410

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  + +  N  +VGWG +SGPL  +++LA++ GASRN+Y+   +F  K ++ ++     
Sbjct: 411 SLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE----- 465

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
                     E LRE F  +G++EQIN+L +  CC++NF NI+ AI  +++         
Sbjct: 466 ----------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDK--------- 506

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                 +K+  E      ++ L IN+GKDRCGNI
Sbjct: 507 ------IKSLPE------FEDLKINFGKDRCGNI 528

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 110/212 (51%), Gaps = 39/212 (18%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI      +++ + VR G+++S+K +P K  +F++FI+   A+ F++++ +  +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVT-IGASRNVYVSLPEFAFKEKFIHDPQYKQLHET 768
            + G  +++GWG  S  +   ++  +T  GA+RNVY+                  QL++ 
Sbjct: 188 NIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG-----------------QLNDD 229

Query: 769 LALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGE 828
             +   ++L +D   +G+I+ I +LS+    +++F +IS AI +V+ ++           
Sbjct: 230 PTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLS----------- 278

Query: 829 VIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                    K + +YK   I YGKDRC  I K
Sbjct: 279 ---------KLNEKYKNKRIFYGKDRCAFITK 301

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  164 bits (415), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+GN+    + E+ICN VR G+LQS+K + ++ + FVTFI+  +A QFYA S
Sbjct: 404 NNLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMS 463

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  ++L     +VGWG +SGPLP  I+LAV+ GASRNVY+   +F    K         
Sbjct: 464 SLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSK--------- 514

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
            +E +   D   LR+ F  YG++EQIN+L   +CC+IN+ NIS+AI  ++++        
Sbjct: 515 RNERVFTED--NLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI-------- 564

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGNI
Sbjct: 565 -------------KSNPYFKDLKINFGKDRCGNI 585

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 108/217 (49%), Gaps = 37/217 (17%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI      +++ + VR G+++ +K +PEK  +F++F++  SA+ F++++ +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            + G  +++GWG  +   P   +   T GA+RNVY+         +   D    ++ E+L
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG--------QLYTD---AEVAESL 277

Query: 770 ALPD------AEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAH 823
            +P        E+L  D   YGDI+ +  + +    +I+F +I SAI +V  +       
Sbjct: 278 NIPKESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL------- 330

Query: 824 HDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                     A   ++   Y+   I YGKDRC  I K
Sbjct: 331 ----------AASNRY---YQNRKIFYGKDRCAFITK 354

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  164 bits (416), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/214 (39%), Positives = 127/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+GN+    + E+ICN VRGG+LQSIK + ++ + FVTFI+  +A QFYA S
Sbjct: 453 NNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMS 512

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +    +     +VGWG +SGPLP +++LAV+ GASRNVY+   +F    K     +   
Sbjct: 513 SLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----KEQPI 568

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
            +ET        LR  F  YG++EQIN+L +  CC+INF NI++AI  ++++        
Sbjct: 569 FNET-------ALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI-------- 613

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGN+
Sbjct: 614 -------------KSNPHFKSLKINFGKDRCGNV 634

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 107/211 (50%), Gaps = 31/211 (14%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI P    +++ + VR G+++  K +PEK  +F++F+E  SA+ F++++ +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            +    ++VGWG  +   P   S  +  GA+RNVY+            +D   K+  E L
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKENKEPL 335

Query: 770 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEV 829
                E+LRED   YG+I+ I  + +    +++F +I++AI +V  +             
Sbjct: 336 T---EEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTL------------- 379

Query: 830 IVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
               A +  F   Y+   I YGKDRC  I K
Sbjct: 380 ----AQKNPF---YQEKKIFYGKDRCAFITK 403

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  163 bits (413), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 127/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+GN+    + E+ICN +RGG+LQ+IK + ++ + FVTFI+  +A QFYA S
Sbjct: 467 NNLGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMS 526

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +  + +H    ++GWG +SGPLP  I+LAV+ GASRN+Y  L    F+E        KQ
Sbjct: 527 SLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEE------DAKQ 578

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
                A    + LR  F  +G +EQIN+L + +CC+INF NIS+AI  ++++        
Sbjct: 579 EESVFA---EDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI-------- 627

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +  L IN+GKDRCGN+
Sbjct: 628 -------------KSNPHFNNLKINFGKDRCGNV 648

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 99/213 (46%), Gaps = 29/213 (13%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI      + + + VR G+++ +K + EK  +FV+F++   A+ F++++ +  +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFK--EKFIHDPQYKQLHE 767
            + G  +++GWG      P   +     GA+RNVY+          EK+  DP+      
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADPKE----- 347

Query: 768 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGG 827
              L   E+L +D S +G+IE I  + D    +++F +I +AI  V  +           
Sbjct: 348 --ILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIG---------- 395

Query: 828 EVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                       D  Y    + YGKDRC  I K
Sbjct: 396 ----------SIDPYYSNKKVFYGKDRCAFITK 418

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  158 bits (400), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 131/215 (60%), Gaps = 34/215 (15%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRTIY+GN+    + E+ICN VRGG+LQSIK + ++ + FVTFI+  +A Q YA +
Sbjct: 383 NNLGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMT 442

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEF-AFKEKFIHDPQYK 763
            +  + +H    ++GWG +SG L  +++LAV+ GASRN+Y+   +F A  E+ +  P + 
Sbjct: 443 SLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDV--PVFT 500

Query: 764 QLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAH 823
           +          + LR+ F  YG++EQIN+L +  CC++NF NIS+AI  ++++       
Sbjct: 501 E----------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI------- 543

Query: 824 HDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                         K + ++K L IN+GKDRCGN+
Sbjct: 544 --------------KSNEQFKDLKINFGKDRCGNV 564

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 109/215 (50%), Gaps = 31/215 (14%)

Query: 649 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDP 708
           +RT+Y+GNI P     ++ + VR G+++ ++ + EK  +F++F++  SA+ F++++ +  
Sbjct: 147 SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 709 IVLHGNMLRVGWGHYSGPLPKSISLAVT-IGASRNVYVSL--PEFAFKEKFIHDPQYKQL 765
           + + G  ++VGWG  + P+   ++ AV+  GA+RNVY+     +     +F  DP  + L
Sbjct: 207 LNIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP--RDL 263

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
             T      E+LR D   YG+IE +  + +    +++F +I SAI +V  +         
Sbjct: 264 IAT-----EEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL--------- 309

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                         +  Y    I YGKDRC  + K
Sbjct: 310 -----------ATVNPYYSNKKIFYGKDRCAFVTK 333

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  159 bits (401), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ + FVTFI+  +A QFYA S
Sbjct: 410 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 469

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV   +FA             
Sbjct: 470 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA----------SDS 519

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
           L++     +   LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 520 LNDERIFTE-NNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 570

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGN+
Sbjct: 571 -------------KSNPYFKDLKINFGKDRCGNV 591

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 102/211 (48%), Gaps = 35/211 (16%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GN+ P    +++ + VR G+++ +K IPEK  +F++F++  +A+ F++++ +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            +    +++GWG  +   P   +   T GA+RNVY+       +E  + +          
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHLSE---------- 294

Query: 770 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEV 829
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 295 -----EQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIR---------- 339

Query: 830 IVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                     +  Y+   I YGKDRC  I K
Sbjct: 340 ----------NPYYQNKRIFYGKDRCAFITK 360

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  159 bits (402), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ + FVTFI+  +A QFYA S
Sbjct: 426 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 485

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV          F+ D     
Sbjct: 486 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGD----S 535

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
           L +     ++  LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 536 LRDERVFTES-NLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 586

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGN+
Sbjct: 587 -------------KSNPYFKDLKINFGKDRCGNV 607

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 102/211 (48%), Gaps = 35/211 (16%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GN+ P    +++ + VR G+++ +K IPEK  +FV+FI+  +A+ F++++ +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            +    +++GWG  +   P   +   T GA+RNVY+       +E  + +          
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSE---------- 310

Query: 770 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEV 829
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 311 -----EQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIR---------- 355

Query: 830 IVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                     +  Y+   I YGKDRC  I K
Sbjct: 356 ----------NPYYQNKRIFYGKDRCAFITK 376

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  158 bits (399), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 128/213 (60%), Gaps = 32/213 (15%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705
           ++GNRTIY+GN+    + E+ICNVVRGG+LQSIK + ++ + FVTFI+  +A Q YA + 
Sbjct: 382 NLGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMAS 441

Query: 706 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           +  + +H    ++GWG +SG L  +++LAV+ GASRN+Y+   +F    +  H P + + 
Sbjct: 442 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEH-PIFTE- 499

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
                    + LR  F  +G++EQIN+L + +CC++NF NIS+AI  ++++         
Sbjct: 500 ---------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI--------- 541

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                       K + ++  L IN+GKDRCGN+
Sbjct: 542 ------------KNNPQFSDLKINFGKDRCGNV 562

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 108/213 (50%), Gaps = 29/213 (13%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GNI P   A  + + VR G+++ I+ + EK  +F++F++  SA+ F++++ +  +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKQLHE 767
            + G  +++GWG  +   P   S     GA+RNVY+     + +F  +   DP+ + + E
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDEVVTE 265

Query: 768 TLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGG 827
                  ++LR+D S YG+IE +  +++    +++F +I SAI +V  +           
Sbjct: 266 -------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL----------- 307

Query: 828 EVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                       +  Y    I YGKDRC  I K
Sbjct: 308 ---------AAVNPYYANKKIFYGKDRCAFITK 331

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 124/213 (58%), Gaps = 32/213 (15%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSF 705
           ++GNRT+Y+GN+    + E+ICNVVRGG+LQ++K + ++ + FVTFI+  +A QFYA S 
Sbjct: 447 NLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSS 506

Query: 706 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           +  I +     RVGWG + G L  +++LAV+ GASRNVYV    F    K   DP + + 
Sbjct: 507 LHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR-EDPIFTE- 564

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHD 825
                      LR  F  +G++EQINYL + +CC++N+ NIS+AI  ++++    +    
Sbjct: 565 ---------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV---- 611

Query: 826 GGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                            +K L IN+GKDRCGN+
Sbjct: 612 -----------------FKDLKINFGKDRCGNV 627

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 102/214 (47%), Gaps = 30/214 (14%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           +T+Y+GN       +++ + VR G+++ ++ +P+K  +FV+F++  +A+ F++++ +  +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIG---ASRNVYVSLPEFAFKEKFIHDPQYKQLH 766
            + G  +++GWG    P P    +A  +    A+RNVY+   +     K     Q   + 
Sbjct: 270 HIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIG--QLNTGPKL--SSQVSPVD 322

Query: 767 ETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDG 826
            T  +   ++LR D   +G+I+ I  + +    +++F +I +AI  V  +          
Sbjct: 323 VTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANL---------- 372

Query: 827 GEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                        +  Y+   I YGKDRC  I K
Sbjct: 373 ----------ANINPYYRNKKIFYGKDRCAFITK 396

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/214 (38%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ + FVTFI+  +A QFYA S
Sbjct: 439 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 498

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV          F+ D     
Sbjct: 499 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSD----S 548

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
           L +     ++  LR  F  YG++EQIN+L + +CC++N+ NIS+AI  ++++        
Sbjct: 549 LRDERIFTES-NLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI-------- 599

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGN+
Sbjct: 600 -------------KSNPYFKDLKINFGKDRCGNV 620

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 102/211 (48%), Gaps = 35/211 (16%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GN+ P    +++ + VR G+++ +K I EK  +F++F++  +A+ F++++ +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            +    +++GWG  +   P   +   T GA+RNVY+         +   D +   L E  
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHLSE-- 323

Query: 770 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEV 829
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +             
Sbjct: 324 -----EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIR---------- 368

Query: 830 IVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                     +  Y+   I YGKDRC  I K
Sbjct: 369 ----------NPYYQNKRIFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  155 bits (393), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 127/214 (59%), Gaps = 32/214 (14%)

Query: 645 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANS 704
           +++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ + FVTFI+  +A QFYA S
Sbjct: 428 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 487

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQ 764
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV      +    + D +   
Sbjct: 488 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDYVSDSVRDER--- 542

Query: 765 LHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH 824
                 +    +LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 543 ------IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 588

Query: 825 DGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNI 858
                        K +  +K L IN+GKDRCGN+
Sbjct: 589 -------------KSNPYFKDLKINFGKDRCGNV 609

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 102/211 (48%), Gaps = 35/211 (16%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPI 709
           RT+Y+GN+ P    +++ + VR G+++ +K IPEK  +F++F++  +A+ F++++ +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 710 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETL 769
            +    +++GWG  +   P   +   T GA+RNVY+       +E  +            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 770 ALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEV 829
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +   ++        
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRNL-------- 359

Query: 830 IVKTAGEEKFDGRYKGLLINYGKDRCGNINK 860
                        Y+   I YGKDRC  I K
Sbjct: 360 ------------YYQNKRIFYGKDRCAFITK 378

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 124/286 (43%), Gaps = 75/286 (26%)

Query: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFV-DNDKNDDLE 254
            +  Y ILP G+D YR+RSLL  NV+   D+   ++   K   +ES Y + D D  DD+E
Sbjct: 215 IQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIE 274

Query: 255 DGETEN--------------------------------------------LSVLISFLTR 270
           +  T N                                             S L+SF T+
Sbjct: 275 NLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTK 334

Query: 271 SDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLSTFVEGEKPKEVDEQVHAAN 330
             CL+FYNN+LQR +E K  +KS  L + FV +  + E +                    
Sbjct: 335 ESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWM-------------------- 374

Query: 331 DSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRKRLQFLDESKNKRYILESIDLVN 390
                 A+L  +V +  ATRS+ +EF      ++     L FL  S   +Y++  +D+V 
Sbjct: 375 ------ANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFLKNS--GKYVVIDVDVVT 426

Query: 391 TDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISKCFYVS 436
           TD     F  +Y +L FL++ MA+EV + L+   ++  +S+  +V+
Sbjct: 427 TDERRKNFGLHYCLLHFLSVTMALEVKELLETGDEA--VSRVSFVT 470

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 48/93 (51%), Gaps = 20/93 (21%)

Query: 28  VGNQMMYHPVDFINGVGQYGSSQHPA---YYTN--SPLP-----------NVPPTPFDTA 71
           VG +   + V   NG    GS+ HP    YYT+    +P           ++P TPFD  
Sbjct: 21  VGYEQQVYDVAGRNG----GSNHHPPQYIYYTHRGGSMPGSIPGSIPGTVSIPQTPFDPV 76

Query: 72  YGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN 104
           YG +LLPSHLL+GSPFV++P   G  S    +N
Sbjct: 77  YGITLLPSHLLVGSPFVNTPQTGGPMSAGTGAN 109

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 3/64 (4%)

Query: 1065 SFQDSRNAETANNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNA 1124
            SF      E ANN   ++ S+   + I GSDVM +YL Q+ H+TF+YAANILGA+ +   
Sbjct: 1089 SFVPVAQHEGANNGNPRKSSM---KPIAGSDVMTRYLEQLHHNTFVYAANILGATQDPVF 1145

Query: 1125 YSEE 1128
            Y E+
Sbjct: 1146 YDED 1149

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 18/132 (13%)

Query: 599 IPQQLIAAPSPLSSNL-----QINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIY 653
           IP  +  A   L++NL     Q  Q  L   +T +L  N N+       +GS+  N TI+
Sbjct: 256 IPPLIKTANDLLTNNLNAVQEQTAQLALSTVVTGNLRSNGNIR----QGLGSNSKNSTIF 311

Query: 654 IGNINPRSRAEDICNVVRG-GILQSIKYIPEKRISFVTF---IEAPSAVQFYANSFIDPI 709
           +G ++     +++  + R  G +  +K    K+  FVTF   I+A +A++      +   
Sbjct: 312 VGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIK-----GLHGF 366

Query: 710 VLHGNMLRVGWG 721
           ++ G  +R+ WG
Sbjct: 367 LVRGCPIRLSWG 378

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 12/77 (15%)

Query: 776 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAG 835
           ++R  FS  GDI++I Y+ D +C ++ F   ++A     E  KESM++       +    
Sbjct: 159 RIRFVFSRLGDIDRIRYVEDKNCAFVKFKYQANA-----EFAKESMSNQ-----TLLLPS 208

Query: 836 EEKFDGRYK--GLLINY 850
           ++++DGR +  GLL+ +
Sbjct: 209 DKEWDGRREGTGLLVKW 225

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 776 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHH---------DG 826
           ++R  FS  GDI++I Y+ D  C ++ F + +SA    E M+ +++  H         +G
Sbjct: 159 RVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASAEFAKEAMSNQTLLLHSDKEWDDRKEG 218

Query: 827 GEVIVKTAGEE 837
             ++VK A E+
Sbjct: 219 TGLLVKWANED 229

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 760 PQYKQLH---ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAIGLVEE 815
           P+ +QLH   + L   D + LR+DF  +G+I +I+  +S   C  ++F ++ SAI  +E 
Sbjct: 330 PRSRQLHSNRQNLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALES 389

Query: 816 MNK-ESMAH 823
             + +S  H
Sbjct: 390 FGEPDSFMH 398

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 767 ETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAIGLVEEMNK 818
           + L   D + LR+DF  +G+I +I+  +S   C  + F ++SS+IG +E   K
Sbjct: 343 QNLCPLDIKDLRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESFEK 395

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 120/303 (39%), Gaps = 62/303 (20%)

Query: 583 NEQMFMNDSNQSNGAVIP------QQLIAAPSPLSSNLQ-INQRVLPNAITQSLEQNFNV 635
           N+Q      + S G   P      +Q  AA +    N + +NQ ++      S E    V
Sbjct: 90  NDQQLWKRQHHSQGCFFPIDDDSNKQTEAAVNKFYENGEYVNQDLIFKGKVYSEESEV-V 148

Query: 636 SAKVASSMG-SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSI---KY-IPEKRISFVT 690
             K A S   + +  R+I + +I   +    + + VRGG L+ I   +Y  PE+ +  V 
Sbjct: 149 DEKTAGSQNPALLKTRSISLNDIPRGTGISSVLSQVRGGSLERIIVYRYDTPERSLHKVD 208

Query: 691 --FIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVT---IGASRNVYV 745
             F+    A  F   +  +   ++G  L+          P+ I L  T   I   ++V  
Sbjct: 209 LFFLNYEGAQSFMRYAKTNIFKVNGVQLK----------PEWIFLESTYENIMKEQSVNR 258

Query: 746 SLPEFAFKEKFIHDPQYKQLHETLALP--------------DAEQLREDFSTYGDIEQIN 791
            + E    EKFI      +   T A+P              D ++L +DF  +G++ +I 
Sbjct: 259 IIEE----EKFISRCLIVKKSSTTAMPNKSNLNKGQTLENIDIQELEKDFQNFGEVLEIT 314

Query: 792 -YLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINY 850
             +S   C  I F +ISSA+  +EE  ++               G   ++  +K   I Y
Sbjct: 315 PIVSRKLCVSIFFYDISSAMRAMEEYEQK---------------GSYLYNKYFKTWTIWY 359

Query: 851 GKD 853
           GKD
Sbjct: 360 GKD 362

>SAKL0F15070g Chr6 (1213643..1215403) [1761 bp, 586 aa] {ON} similar
           to uniprot|P27614 Saccharomyces cerevisiae YJL172W CPS1
           Vacuolar carboxypeptidase yscS expression is induced
           under low-nitrogen conditions
          Length = 586

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 50/85 (58%), Gaps = 6/85 (7%)

Query: 355 EFKSALEKTELFRKRLQFLDESKNKR--YIL---ESIDLVNTDVPSNQFPENYAVLTFLN 409
           +F  A++  +   + +++L E+  K+  Y+L   ++ID+++  + +N  PE  A LT   
Sbjct: 360 DFLHAMDDADANDRVIKYLIETGGKKTEYLLRTTQAIDIIHGGIKANALPETVAFLTDSR 419

Query: 410 IFMAVEVLDYLKKF-SKSLEISKCF 433
           I +   + + L+KF +K+L+ISK +
Sbjct: 420 ISIESSIDETLQKFLNKTLDISKKY 444

>TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.466
           YDL209C
          Length = 322

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 12/80 (15%)

Query: 776 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAG 835
           +LR  FS  G+IE I Y+   +C ++ +   ++A     E  KE+M++       + T  
Sbjct: 157 RLRFAFSRLGEIETIRYIEAKNCAFVTYRFQANA-----EFAKEAMSNQ-----TLLTPS 206

Query: 836 EEKFDGRY--KGLLINYGKD 853
           ++K+D R    GLL+ +  D
Sbjct: 207 DKKWDERKDGTGLLVKWAND 226

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 12/163 (7%)

Query: 664 EDICNVVRGGILQSIKYIPEKRISFVTFIE----APSAVQFYANSFIDPIV-LHGNMLRV 718
           + + N V+GG L+ I    +K  + +  +E     P   Q +       +  ++G  LR 
Sbjct: 181 KSVLNQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQHFMEYGRHAVFQINGVHLRP 240

Query: 719 GWGHYSGPLPKSISLAVTIGASRNVYV-SLPEFAFKEKFIHDPQYKQLH-----ETLALP 772
            WG  S       SL        N+Y  S      K++   +P++   H       +   
Sbjct: 241 RWGIQSLSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSKNPKHSTCHYPSPRSHICDL 300

Query: 773 DAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAIGLVE 814
           + ++L++DFS +G+I  I+  +S   C  INF +I SA+  ++
Sbjct: 301 NVQELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQ 343

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 85/179 (47%), Gaps = 15/179 (8%)

Query: 650 RTIYIGNINPRSRAEDICNV-VRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDP 708
           RT+Y+GNI+PR   ED+  + V+ G ++ I Y P  ++  +   +  + ++F  +S +D 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINY-PRDKV--LDTHQGYAFIEFLNDSTVDY 63

Query: 709 IV-LHGNMLRVGWGHYSGPLPKSISL--AVTIGASRNVYVSLPEFAFKEKFIHDPQYKQL 765
           ++ L GN   V     S  + KS +   A   G ++N+ V +   A   K I     K +
Sbjct: 64  VLKLFGNTNLVSLYERSLKIRKSENGKEANANGTNKNIDVDMLPIA---KII----VKNV 116

Query: 766 HETLALPDAEQLREDFSTYGDIEQINYLSDS-HCCWINFMNISSAIGLVEEMNKESMAH 823
            E++ +    ++   F        I  +S+   C +++F +   +   ++++N E + +
Sbjct: 117 DESVDIMKLNKICSKFGKLARDSDIVTMSNGMRCGFVHFRDYKDSDLAIDKLNNELIVN 175

>TDEL0A01860 Chr1 (341309..342271) [963 bp, 320 aa] {ON} Anc_2.412
           YMR126C
          Length = 320

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 60/150 (40%), Gaps = 22/150 (14%)

Query: 212 TRSLLIENVDRSTDLHSLV---KNFVKFNTLESAYFVDNDKNDDLEDGETENLSVLISFL 268
           +R L++EN+DRS DL +L    K+ V    LE     DN K +               +L
Sbjct: 97  SRKLILENMDRSKDLSALFKMPKDPVIHAGLEPPARCDNTKEEKF----------FPEYL 146

Query: 269 TRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECLSTFVEGEKPKEVDEQVHA 328
               C+    ++  R+    +FL +  L++K        E  S  V  +  K+ D++V  
Sbjct: 147 NYQSCI---KSLADRMRYQGVFLNNMELDMKL------DETFSDVVRNQFMKDTDDEVQL 197

Query: 329 ANDSMMISASLHHDVENKDATRSIIIEFKS 358
            N    I          ++ TR   ++F S
Sbjct: 198 QNAQRFIEIYETVRFSGQEVTRKQFVDFVS 227

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 89/214 (41%), Gaps = 25/214 (11%)

Query: 650 RTIYIGNINPRSRAEDICNVVRGGILQSI---KY-IPEKRISFVT--FIEAPSAVQFYAN 703
           R++ I +I   +    + + VRGG L+ I   +Y  PE+ +  V   F+    A  F   
Sbjct: 163 RSVSINDIPRGTGIASVLSQVRGGSLERIVVYRYDTPERSLHKVDLFFLNYDGAQSFMKY 222

Query: 704 SFIDPIVLHGNMLRVGWGHYSGP---LPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDP 760
           +  +   ++G  LR  W         + K  S+   +   + +   L       K I + 
Sbjct: 223 ATTNIFKVNGTHLRPEWIFLESTYENIMKEQSVNRILDEEKLISRCLIVKKSSSKTIVNK 282

Query: 761 QYKQLHETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAIGLVEEMNKE 819
             +   ++L   D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE  ++
Sbjct: 283 PSQDKSQSLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQK 342

Query: 820 SMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKD 853
                          G   ++  +K   I YGKD
Sbjct: 343 ---------------GSYLYNKYFKTWTIWYGKD 361

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 646 DVGNRTIYIGNINPRSRAEDICNVVRG-GILQSIKYIPEKRISFVTF---IEAPSAVQFY 701
           D  N T+++GN+N +   +++  V    G ++ +K  P K+  FV F   I+A +++   
Sbjct: 318 DPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGL 377

Query: 702 ANSFIDPIVLHGNMLRVGW 720
              F+      G+ +R+ W
Sbjct: 378 QGYFV-----AGSPIRISW 391

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 37/212 (17%)

Query: 651 TIYIGNINPRSRAEDICNV-VRGGILQSIKYIPEKRI------SFVTFIEAPSAVQFYAN 703
           T+Y+GNI+P+   E++  + V+   + +I+Y  +K +      +FV F   P   Q+   
Sbjct: 11  TVYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFY-TPEDCQYVVQ 69

Query: 704 SFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK 763
              + + L+   L+V   +       S ++ VTI     V+V                 K
Sbjct: 70  LLNNTVQLYDRFLKVRKANVQS--SGSDTIDVTIQPIAKVFV-----------------K 110

Query: 764 QLHETLALPDAEQLREDFSTYGDIEQINYLSDSH--CCWINFMNISSAIGLVEEMNKESM 821
            L  ++  P   +L   F       +I YLSD    C +I F N   +   +  +N + +
Sbjct: 111 NLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSDGQLRCAYIYFKNYDHSDLALATLNGQLV 170

Query: 822 AHHDGGEVIVKTAGEEKFDGRYKGLLINYGKD 853
            +    +V V  A +E   G  K     YG+D
Sbjct: 171 VNK---KVTVDYAFKENGKGNAK-----YGED 194

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 43/84 (51%), Gaps = 9/84 (10%)

Query: 642 SMGSDVGNRTIYIGNINPRSRAEDICNVVRG-GILQSIKYIPEKRISFVTF---IEAPSA 697
           +M + V + T+++G +NP      +  + +  G +  +K  P K+  FV +   +EA +A
Sbjct: 437 AMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAA 496

Query: 698 VQFYANSFIDPIVLHGNMLRVGWG 721
           +     + +   ++ G+ +R+ WG
Sbjct: 497 I-----NGLQGFIIMGSPIRLSWG 515

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 649 NRTIYIGNINPRSRAEDICNV-VRGGILQSIKYIPEKRI------SFVTFIEAPSAVQFY 701
           N+T+Y+GNI+P+   + +  + V+   + SIKY  +K +      +F+ F      VQ+ 
Sbjct: 11  NKTVYVGNIDPQVTLDILYELFVQVAPISSIKYPKDKVLQAYQGYAFIDFF-TEDDVQYV 69

Query: 702 ANSFIDPIVLHGNMLRVGWGHYS 724
                + + L+G +L+V   +Y+
Sbjct: 70  IKVMNNTVRLYGKLLKVRLSNYA 92

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 15/177 (8%)

Query: 622 PNAITQSLE-QNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICN--VVRGGILQSI 678
           P A  QS E Q  +V    A+  G +  +R +Y+GN++ +S  ED+       GG +  +
Sbjct: 54  PAAGEQSAENQESSVVPASATQGGRETSDRVLYVGNLD-KSINEDLLKQYFQVGGQITDV 112

Query: 679 KYIPEKR-----ISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKS-IS 732
           K + +K+      +F+ ++++  A    A   ++ I + G  +R+ W   S     S  +
Sbjct: 113 KIMVDKKNNNVNYAFIEYLKSHDAN--VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDT 170

Query: 733 LAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQ 789
             + +G   ++ V + +      F   P Y Q H    +         F ++ D EQ
Sbjct: 171 FNLFVG---DLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 71/165 (43%), Gaps = 24/165 (14%)

Query: 589 NDSNQSNGAVIPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVG 648
           ND  QSN  ++P   I    P+ S    N  V  N    S            ++  SD  
Sbjct: 310 NDLIQSNSNMLPLNAIQNGPPMPSKEGGNSNVRANEFLPS------------NTYNSDPT 357

Query: 649 NRTIYIGNINPRSRAEDICNVVRG-GILQSIKYIPEKRISFVTF---IEAPSAVQFYANS 704
           N T+++G + P++    + ++ +  G + +++    K   FV F   I+A +++Q     
Sbjct: 358 NTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQ----- 412

Query: 705 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIG---ASRNVYVS 746
            +   ++ G+ +R+ WG  S    K+ S  +  G   +S NV  S
Sbjct: 413 GLQGFIVGGSPIRLSWGRPSSSNAKAASTVMGTGQYLSSNNVRAS 457

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 15/162 (9%)

Query: 666 ICNVVRGGILQSI--KYIPEK---RISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 720
           + N V+GG L+ I  +Y  E    +   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKW 242

Query: 721 GHYSGPLPKSISLAV-TIGASRNVYV-SLPEFAFKEKFIHDPQYKQLH-----ETLALPD 773
           G  S  L ++   ++ T   S NVY  S      K++   +P++   H       +   +
Sbjct: 243 GIQS--LSENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNPKHSTCHYPSPRSHICDLN 300

Query: 774 AEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAIGLVE 814
            + L+ DF  +GDI  I+  +S   C  INF +I +A+  ++
Sbjct: 301 IQDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQ 342

>CAGL0J03740g Chr10 (358554..359663) [1110 bp, 369 aa] {ON} weakly
           similar to uniprot|Q08646 Saccharomyces cerevisiae
           YOR242c SSP2
          Length = 369

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 87/223 (39%), Gaps = 28/223 (12%)

Query: 642 SMGSDVGNRT-IYIGNINPRSRAEDICNVVRGGILQSIKYIPEK------RISFVTFIEA 694
           S+GSD  + T I   NI      E I   ++GG +  I+ +P +      +   V F  +
Sbjct: 155 SLGSDTKDITDIVFDNIPANIGLESIVYQLQGGPIAKIQAVPHESNVDQLKKLHVKFTTS 214

Query: 695 PSAVQFYANSFIDPIVLHGNMLRVGWGHYS-GPLPKSISLAVTIGASRNVY--VSLPEFA 751
            +A  F      +   ++G  LR  W  +      K     +    S+NV   + L  + 
Sbjct: 215 KAASDFMKLGTRNMFKVNGVYLRPKWVQFCETKTDKWYQDLIKQNTSKNVCRCIILKRYP 274

Query: 752 FKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAI 810
            K    +    KQ    L   D   +R DF  YG+I  I   +S   C  I + +I SA+
Sbjct: 275 TKNNMRYIQSTKQ--PPLENIDVNAIRRDFENYGNILDITPVISRKLCISIVYYDIFSAM 332

Query: 811 GLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKD 853
                  K  M++ D    +      E + G++    I YGKD
Sbjct: 333 -------KAMMSYEDNTSFL-----HENYYGKWA---IWYGKD 360

>KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON}
           Anc_8.466 YDL209C
          Length = 330

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 8/78 (10%)

Query: 776 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAG 835
           +LR  F+  G I++I Y+++ +C ++ F N  +A    E M  ++M   +  E   +T  
Sbjct: 151 RLRFMFNKLGPIDKIRYVANKNCAFVKFRNARNAEFAKEAMTNQTMLLPNDDEWENRTES 210

Query: 836 EEKFDGRYKGLLINYGKD 853
                    GLL+ +  D
Sbjct: 211 --------TGLLVKWAND 220

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 600 PQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP 659
           P+++I  P  +S  ++ +     NA  ++ +   +V    A+  G +  +R +Y+GN++ 
Sbjct: 13  PEEVIEKPEEVSQEVEGD-----NASQENDDDKPSVVPASATKGGRETSDRVLYVGNLD- 66

Query: 660 RSRAEDICN--VVRGGILQSIKYIPEKR-----ISFVTFIEAPSAVQFYANSFIDPIVLH 712
           +S  ED+       GG +Q++K I + +      +FV +I +  A    A   ++ + L 
Sbjct: 67  KSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDAN--VALQTLNGVQLE 124

Query: 713 GNMLRVGW 720
              L++ W
Sbjct: 125 NKTLKINW 132

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 776 QLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAIGLVEE 815
           ++++DF T+G+I +I   +S   C  INF N+ SA+  ++E
Sbjct: 317 EIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAMKE 357

>KNAG0C05890 Chr3 (1147381..1149960) [2580 bp, 859 aa] {ON}
           Anc_4.134 YLR318W
          Length = 859

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 81/172 (47%), Gaps = 34/172 (19%)

Query: 201 KILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND---KNDDLEDGE 257
           +++  G +A+ +  +LI+N   +   ++ +   V+F   ++A +VDN    + D L  G 
Sbjct: 558 RLVVNGSEAFLSSDVLIDNCRTTYFTNADILKIVEFELYKTALWVDNKCYLRKDGLFQGS 617

Query: 258 TENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSL-------------------NL 298
           +  LS L+  L        Y+++L+   EF+  LK +SL                   N+
Sbjct: 618 S--LSALLVDLI-------YDDMLETYKEFRCKLKEESLIVRIADDFLIISTDGAQINNI 668

Query: 299 KFVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATR 350
           K + L   +E  +T V+ EK   +D Q  +  ++++   ++H D++N +  +
Sbjct: 669 KKLALGGFTEYHAT-VKREKIVTMDSQ--SQTETIIQFCAIHIDMQNLEVWK 717

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 111,273,057
Number of extensions: 5010211
Number of successful extensions: 15979
Number of sequences better than 10.0: 115
Number of HSP's gapped: 16526
Number of HSP's successfully gapped: 191
Length of query: 1128
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1008
Effective length of database: 39,721,479
Effective search space: 40039250832
Effective search space used: 40039250832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)