Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.2262.533ON47547513740.0
Smik_13.2492.533ON47345010411e-137
YMR070W (MOT3)2.533ON49045810311e-135
Suva_13.2462.533ON4191496553e-80
KNAG0C058102.533ON5541753831e-39
TDEL0A030702.533ON2391773352e-35
KAFR0A018602.533ON4901443483e-35
ZYRO0B02002g2.533ON2941473294e-34
NDAI0H014002.533ON5411473302e-32
CAGL0K03003g2.533ON6471473286e-32
NCAS0A048002.533ON5111493193e-31
NCAS0F009002.533ON5251443142e-30
SAKL0A09482g2.533ON3881432961e-28
TBLA0G022302.533ON2161562842e-28
Kpol_1018.332.533ON5891552976e-28
NDAI0K018602.533ON7301482933e-27
TBLA0I014802.533ON513802869e-27
TPHA0G035102.533ON3871482686e-25
AGL071C2.533ON396642609e-24
Ecym_72552.533ON544642631e-23
KLLA0E18547g2.533ON431702582e-23
Kwal_26.80212.533ON5071472541e-22
KLTH0D06842g2.533ON5061522433e-21
KAFR0J003402.533ON218632068e-18
KNAG0A070402.533ON3521411924e-15
TPHA0C041902.533ON417531901e-14
NCAS0A129102.598ON822671402e-08
NDAI0C005602.598ON972711393e-08
SAKL0B11330g2.598ON4991021374e-08
YKL062W (MSN4)2.598ON630571375e-08
Smik_11.1862.598ON641571375e-08
Skud_11.1672.598ON628571358e-08
TBLA0H028302.598ON746491359e-08
Kpol_185.32.598ON6471561341e-07
ZYRO0F01012g2.598ON584571331e-07
TBLA0G019202.598ON523571322e-07
NDAI0B013402.598ON769491322e-07
KLTH0D08734g2.598ON677571312e-07
Kwal_26.83512.598ON698571312e-07
Suva_11.1642.598ON639561313e-07
CAGL0M13189g2.598ON541491285e-07
ABR089C2.598ON571491295e-07
Ecym_23012.598ON767491295e-07
Suva_13.2062.598ON709481285e-07
KAFR0F020702.598ON370571266e-07
TDEL0B069102.598ON437571276e-07
KNAG0G012808.144ON472531268e-07
TPHA0N014602.598ON519571268e-07
KNAG0H005502.598ON620571278e-07
YMR037C (MSN2)2.598ON704481261e-06
NCAS0H030802.598ON730571261e-06
Skud_13.1932.598ON704481261e-06
Kpol_1013.212.598ON494571251e-06
ACR264W2.162ON769951251e-06
Smik_13.2072.598ON703481251e-06
YPL230W (USV1)6.256ON391741222e-06
KLLA0F26961g2.598ON694491232e-06
KNAG0M023102.598ON660481232e-06
Ecym_84038.144ON573581232e-06
TPHA0C025802.598ON365491212e-06
KAFR0A023202.598ON443491213e-06
CAGL0F05995g2.598ON597481214e-06
Skud_16.486.256ON398741204e-06
TDEL0B046708.144ON312851194e-06
Kwal_26.80112.531ON1901231155e-06
SAKL0H24816g8.144ON410541195e-06
CAGL0L06072g8.144ON300561176e-06
Ecym_54242.162ON775951196e-06
KAFR0F012106.256ON311661151e-05
KLTH0E06688g8.144ON397481161e-05
KAFR0B025508.234ON890771171e-05
Kpol_1031.428.144ON359981151e-05
CAGL0M00594g4.351ON1020601162e-05
TBLA0B061604.351ON1384571162e-05
TBLA0H006608.425ON1311611162e-05
Smik_6.4356.256ON386741142e-05
ACL057W8.144ON520531142e-05
Kwal_47.172418.144ON403531142e-05
TPHA0D010508.144ON4391281133e-05
Suva_13.247singletonOFF2121993e-05
NCAS0B046008.144ON547481143e-05
ZYRO0G19140g8.144ON557481133e-05
ZYRO0A09416g8.425ON1346691143e-05
CAGL0K02145g8.144ON317981114e-05
NDAI0C06260na 1ON582651134e-05
Skud_5.2488.144ON442481124e-05
KLLA0B04477g4.351ON1332641144e-05
Smik_5.2768.144ON442481124e-05
Suva_5.2518.144ON449481124e-05
KLLA0C17072g8.144ON474481125e-05
KNAG0D021208.144ON402501115e-05
TPHA0B003804.351ON1310451125e-05
YER130C8.144ON443481106e-05
TBLA0I027004.214ON737671117e-05
ADL198W2.303ON5471111107e-05
NCAS0A062504.351ON1341611117e-05
Suva_16.766.256ON392681107e-05
SAKL0H20416g8.116ON317681097e-05
SAKL0E10714g2.162ON819941118e-05
YML081W (TDA9)4.351ON1251911118e-05
TPHA0A04530singletonON501761099e-05
KLLA0F13046g8.425ON1379601109e-05
NDAI0B019308.144ON436481091e-04
NDAI0G034208.144ON484691091e-04
Ecym_62951.326ON663621091e-04
Kpol_1052.83.298ON386761081e-04
Kwal_47.166214.351ON1178991091e-04
TBLA0B012802.162ON823821091e-04
SAKL0G18062g4.351ON1238591091e-04
KNAG0H011803.281ON254731052e-04
Kpol_1001.14.351ON1341451082e-04
NCAS0C040708.144ON289651062e-04
KLTH0H08800g8.117ON1681001022e-04
KNAG0G018708.234ON875751082e-04
YPR013C8.116ON3171031062e-04
TBLA0E047704.351ON1655451082e-04
KNAG0M003504.351ON1076631082e-04
KLLA0F20636gsingletonON285501052e-04
Kpol_1072.582.162ON794841072e-04
CAGL0E04884g8.425ON1489451072e-04
TBLA0G032403.298ON511541062e-04
AGR117C8.234ON799811072e-04
TBLA0F003708.144ON687511072e-04
Skud_13.614.351ON1253911072e-04
SAKL0F01980g3.518ON385641052e-04
ADR308Cna 2ON278651042e-04
Suva_13.704.351ON777671062e-04
SAKL0H12958g8.425ON1129611072e-04
TBLA0F038308.234ON967531062e-04
AER159C4.351ON1191591063e-04
TDEL0F026904.80ON350561053e-04
TPHA0A019408.234ON912771063e-04
SAKL0H04070g4.214ON899691063e-04
Skud_13.3486.256ON216571023e-04
Smik_13.3876.256ON212571023e-04
KAFR0B021608.144ON453481053e-04
Kwal_47.178882.162ON786941053e-04
Suva_13.3636.256ON211571013e-04
YMR182C (RGM1)6.256ON211571013e-04
KLTH0D18062g4.351ON1128521054e-04
NDAI0D037504.80ON493561044e-04
Ecym_8011na 2ON276501024e-04
KAFR0E042704.351ON1255501054e-04
NCAS0F00910singletonON350521034e-04
KLTH0E09724g2.162ON768941044e-04
NCAS0B069602.162ON839721044e-04
Skud_8.555.586ON535991045e-04
CAGL0E06116g6.256ON613581045e-04
Kwal_14.22068.117ON254621015e-04
NCAS0F009202.531ON354521025e-04
TPHA0C021608.425ON1375881045e-04
Ecym_1383na 3ON381681035e-04
Ecym_26733.298ON301601025e-04
NCAS0B028408.425ON1152941045e-04
NCAS0C042308.117ON338881025e-04
AGR172W8.425ON1057621045e-04
TBLA0B060502.303ON762511036e-04
KAFR0B068104.351ON1155541036e-04
NDAI0J028504.351ON1537541036e-04
CAGL0J01595g8.117ON344641026e-04
Kpol_541.398.116ON291501016e-04
Suva_8.625.586ON545981027e-04
KNAG0I020702.162ON572481027e-04
NCAS0G012706.256ON274511007e-04
Kpol_472.104.214ON830681037e-04
NDAI0D032404.351ON1362451037e-04
ZYRO0B11770g8.234ON867531028e-04
KAFR0C04550singletonON467721018e-04
CAGL0L05786g8.116ON348511018e-04
ZYRO0B14894g4.351ON1119451028e-04
Smik_4.3378.234ON894581028e-04
CAGL0H04213g4.351ON1321471028e-04
KLLA0F23782g2.162ON7821081028e-04
TBLA0E04210singletonON454501019e-04
NDAI0B042902.162ON1064701029e-04
YDR096W (GIS1)8.234ON894581029e-04
KAFR0C003403.298ON394671010.001
Kpol_1032.528.234ON824531010.001
Suva_2.2558.234ON894581010.001
Kpol_529.138.425ON1410541020.001
Skud_4.3548.234ON916581010.001
TPHA0B029102.162ON717731010.001
AFR531Wna 4ON274127990.001
Smik_13.584.351ON1253911010.001
NDAI0C048608.425ON1350581010.001
Ecym_35208.234ON819781000.001
TDEL0D006704.351ON1199471010.001
Ecym_26543.281ON25761980.001
TDEL0A013008.234ON837531000.001
KAFR0C029808.144ON22548970.001
CAGL0L11880g8.234ON980531000.001
KNAG0C060305.586ON31480980.001
NCAS0B05750singletonON50557990.002
Suva_2.3838.425ON1319611000.002
KAFR0B063608.425ON62772990.002
Ecym_1475na 4ON34973980.002
YBR066C (NRG2)3.281ON22081960.002
TBLA0E042208.234ON51950980.002
CAGL0K12078g3.281ON463104980.002
Kwal_23.54007.543ON42956980.002
Smik_4.4638.425ON132461990.002
TDEL0B052502.162ON71464990.002
TDEL0F055008.425ON120762990.002
CAGL0A01628g4.80ON42458980.002
Ecym_4128na 5ON31265970.002
KLLA0B07909g4.214ON92271990.002
Smik_7.543.518ON38266980.002
TPHA0G002707.543ON47253980.002
TPHA0J006704.189ON66070980.002
SAKL0E07216g2.303ON54851980.002
YOR113W (AZF1)2.162ON91473980.002
Skud_7.593.518ON38366970.002
Suva_7.523.518ON40066970.002
KAFR0C031408.117ON37054970.002
SAKL0F16170g7.543ON43766970.002
TPHA0G008202.303ON53251980.002
NDAI0G007202.303ON70859980.002
KNAG0B067104.351ON105345980.002
KAFR0B045802.162ON72948980.002
TPHA0D034003.518ON33866970.002
Suva_16.3358.116ON317121960.003
NDAI0B060203.518ON42650970.003
Suva_7.2404.80ON51556970.003
NDAI0A075403.298ON37052970.003
Ecym_8379na 6ON30565960.003
KLTH0G10802g2.303ON52655970.003
KNAG0H034802.162ON79646970.003
AEL174W1.326ON66161970.003
NDAI0I009906.256ON40956960.003
TDEL0F011708.116ON16254920.003
Kpol_1026.84.80ON41288960.003
KLLA0E08713g2.303ON59638970.003
KNAG0A044608.425ON129070970.003
TPHA0K002105.586ON481126960.003
YHR006W (STP2)5.586ON54198960.003
Skud_10.3514.351ON132750970.003
TBLA0I020603.298ON83352970.004
KLTH0H15048gna 4ON29696950.004
TBLA0I032803.518ON33051950.004
YGL209W (MIG2)3.518ON38266960.004
Skud_15.2762.162ON91750970.004
TPHA0F018102.162ON42548960.004
Kpol_1023.1004.351ON91654960.004
ZYRO0B16148g2.162ON93050960.004
TPHA0A039103.298ON35152950.004
Smik_15.2912.162ON90950960.004
Suva_12.2184.351ON127050960.004
AGR186Cna 5ON28765940.004
AEL077Wna 3ON33651950.004
KAFR0F036004.80ON33556950.004
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.226
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   533   0.0  
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   405   e-137
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   401   e-135
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   256   3e-80
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   152   1e-39
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   133   2e-35
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   138   3e-35
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   131   4e-34
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   131   2e-32
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   130   6e-32
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   127   3e-31
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   125   2e-30
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   118   1e-28
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   114   2e-28
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   119   6e-28
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   117   3e-27
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   114   9e-27
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   107   6e-25
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   104   9e-24
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   105   1e-23
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   103   2e-23
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   102   1e-22
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    98   3e-21
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       84   8e-18
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    79   4e-15
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    78   1e-14
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    59   2e-08
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     58   3e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    57   4e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    57   5e-08
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    57   5e-08
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    57   8e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    57   9e-08
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    56   1e-07
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    56   1e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    55   2e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     55   2e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    55   2e-07
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    55   2e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    55   3e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    54   5e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    54   5e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    54   5e-07
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    54   5e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    53   6e-07
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    54   6e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    53   8e-07
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    53   8e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    54   8e-07
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    53   1e-06
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    53   1e-06
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    53   1e-06
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    53   1e-06
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    53   1e-06
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    53   1e-06
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    52   2e-06
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    52   2e-06
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    52   2e-06
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    52   2e-06
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    51   2e-06
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    51   3e-06
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    51   4e-06
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    51   4e-06
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    50   4e-06
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    49   5e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    50   5e-06
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    50   6e-06
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    50   6e-06
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    49   1e-05
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    49   1e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    50   1e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    49   1e-05
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    49   2e-05
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    49   2e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    49   2e-05
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    49   2e-05
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    49   2e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    49   2e-05
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    48   3e-05
Suva_13.247 Chr13 (391743..391805) [63 bp, 21 aa] {OFF} YMR070W ...    43   3e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    49   3e-05
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    48   3e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    49   3e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    47   4e-05
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             48   4e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    48   4e-05
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    49   4e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    48   4e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    48   4e-05
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    48   5e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    47   5e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    48   5e-05
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   6e-05
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    47   7e-05
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    47   7e-05
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    47   7e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    47   7e-05
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    47   7e-05
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    47   8e-05
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    47   8e-05
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             47   9e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    47   9e-05
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     47   1e-04
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    47   1e-04
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    47   1e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    46   1e-04
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    47   1e-04
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    47   1e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    47   1e-04
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    45   2e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    46   2e-04
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      45   2e-04
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    44   2e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    46   2e-04
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    45   2e-04
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    46   2e-04
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    46   2e-04
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    45   2e-04
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    46   2e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    46   2e-04
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     45   2e-04
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    46   2e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    46   2e-04
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    46   2e-04
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    45   2e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    45   2e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    45   2e-04
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    46   2e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    45   2e-04
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    45   3e-04
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    45   3e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    45   3e-04
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    45   3e-04
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    44   3e-04
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    44   3e-04
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    45   3e-04
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    45   3e-04
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    44   3e-04
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    44   3e-04
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    45   4e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      45   4e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    44   4e-04
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    45   4e-04
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               44   4e-04
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    45   4e-04
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    45   4e-04
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    45   5e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    45   5e-04
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    44   5e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     44   5e-04
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    45   5e-04
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    44   5e-04
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    44   5e-04
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    45   5e-04
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               44   5e-04
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    45   5e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    44   6e-04
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    44   6e-04
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    44   6e-04
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    44   6e-04
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    44   6e-04
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    44   7e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    44   7e-04
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      43   7e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    44   7e-04
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    44   7e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    44   8e-04
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               44   8e-04
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    44   8e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    44   8e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    44   8e-04
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    44   8e-04
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    44   8e-04
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             44   9e-04
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    44   9e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    44   9e-04
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    44   0.001
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    44   0.001
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    44   0.001
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    44   0.001
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    44   0.001
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    44   0.001
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    43   0.001
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    44   0.001
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    44   0.001
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    43   0.001
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    44   0.001
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    42   0.001
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    43   0.001
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    42   0.001
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    43   0.001
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    42   0.001
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    43   0.002
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    43   0.002
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    43   0.002
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    42   0.002
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    42   0.002
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    42   0.002
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    42   0.002
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    42   0.002
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    43   0.002
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    43   0.002
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    43   0.002
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    42   0.002
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    42   0.002
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    43   0.002
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    42   0.002
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    42   0.002
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    42   0.002
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    42   0.002
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    42   0.002
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    42   0.002
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    42   0.002
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               42   0.002
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    42   0.002
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   0.002
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    42   0.002
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    42   0.002
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    42   0.002
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    42   0.002
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    42   0.003
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    42   0.003
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    42   0.003
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    42   0.003
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    42   0.003
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    42   0.003
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    42   0.003
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    42   0.003
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    42   0.003
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    40   0.003
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    42   0.003
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    42   0.003
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    42   0.003
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    42   0.003
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    42   0.003
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    42   0.003
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     42   0.004
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    41   0.004
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    41   0.004
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    42   0.004
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    42   0.004
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    42   0.004
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    42   0.004
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    42   0.004
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    41   0.004
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    42   0.004
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    42   0.004
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    41   0.004
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    41   0.004
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    41   0.004
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    42   0.004
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    41   0.004
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    42   0.004
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    41   0.004
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    42   0.004
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    41   0.005
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    41   0.005
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    41   0.005
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    41   0.005
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    42   0.005
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    41   0.005
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    42   0.005
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    41   0.005
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    41   0.006
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    40   0.006
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    41   0.006
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    41   0.006
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    41   0.006
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    41   0.006
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    40   0.006
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    41   0.006
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    41   0.006
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    41   0.006
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               41   0.006
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    41   0.006
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    41   0.006
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    41   0.006
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    41   0.006
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    41   0.006
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.007
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    40   0.007
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    40   0.007
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    40   0.007
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    41   0.007
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    40   0.007
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    40   0.007
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                40   0.007
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    40   0.007
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    39   0.008
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    40   0.008
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    40   0.008
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     40   0.008
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    41   0.008
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    40   0.008
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    40   0.008
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    41   0.008
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    40   0.008
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    41   0.008
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    40   0.008
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    39   0.008
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    40   0.008
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    40   0.009
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    40   0.009
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    40   0.009
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    40   0.009
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      40   0.009
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    40   0.009
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    40   0.009
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    40   0.010
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    40   0.010
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    40   0.010
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    40   0.010
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                40   0.010
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    38   0.011
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    40   0.011
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    40   0.011
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    40   0.011
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    40   0.011
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    40   0.011
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    40   0.011
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    40   0.011
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    40   0.011
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    38   0.012
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    40   0.012
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    40   0.012
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    40   0.012
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    40   0.012
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    40   0.012
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    40   0.013
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    39   0.013
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    39   0.013
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    39   0.013
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    40   0.015
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    40   0.015
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    40   0.015
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    39   0.017
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    40   0.017
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                39   0.017
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    39   0.017
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    39   0.018
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    39   0.018
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    39   0.018
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    39   0.019
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    39   0.019
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    39   0.020
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    39   0.020
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    39   0.020
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    39   0.020
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    39   0.020
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    39   0.021
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    39   0.021
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    39   0.022
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    39   0.022
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    39   0.023
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    39   0.024
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    39   0.024
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    39   0.025
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    39   0.025
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    39   0.026
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    39   0.026
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    39   0.027
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    39   0.028
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    39   0.029
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    39   0.030
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    38   0.030
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    39   0.030
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    39   0.031
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    39   0.031
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    37   0.031
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    39   0.031
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    39   0.032
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    39   0.033
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    38   0.034
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    39   0.035
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    39   0.036
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    38   0.038
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    39   0.038
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    38   0.038
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    39   0.041
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    36   0.041
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    38   0.043
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    39   0.044
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    39   0.044
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    39   0.045
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    39   0.046
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     38   0.047
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    38   0.047
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    38   0.048
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    38   0.048
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    38   0.048
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    38   0.049
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    38   0.049
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      37   0.049
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    38   0.050
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    37   0.050
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    38   0.051
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    38   0.052
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    38   0.054
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      37   0.054
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    38   0.055
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    38   0.055
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    37   0.055
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    38   0.059
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    37   0.059
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     38   0.061
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    38   0.061
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      37   0.061
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    37   0.061
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     38   0.065
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    37   0.065
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    37   0.065
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    38   0.066
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    38   0.067
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    37   0.068
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    37   0.069
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                37   0.070
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    37   0.071
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    37   0.076
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    37   0.077
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    37   0.081
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    37   0.083
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.084
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    37   0.087
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    37   0.088
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    36   0.089
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    37   0.090
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    37   0.092
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    37   0.092
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    37   0.094
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    37   0.095
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    37   0.096
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    36   0.099
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    37   0.100
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    37   0.100
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    37   0.11 
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    37   0.11 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    37   0.11 
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    37   0.12 
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    37   0.12 
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    37   0.13 
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    37   0.13 
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    35   0.13 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.14 
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    37   0.14 
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    37   0.15 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    37   0.15 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    37   0.15 
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     36   0.15 
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    37   0.16 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    36   0.16 
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    36   0.17 
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               36   0.17 
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    35   0.18 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    36   0.18 
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    36   0.20 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    36   0.20 
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    36   0.21 
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                35   0.21 
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    36   0.21 
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    36   0.22 
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    35   0.23 
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    35   0.24 
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    36   0.24 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    35   0.25 
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    35   0.25 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    36   0.26 
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  35   0.27 
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    35   0.33 
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    35   0.34 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    35   0.35 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    35   0.36 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    35   0.36 
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    35   0.37 
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    35   0.37 
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    35   0.40 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    35   0.40 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    35   0.40 
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       33   0.41 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    35   0.44 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    35   0.45 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    35   0.46 
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    35   0.47 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    34   0.50 
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    35   0.50 
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    35   0.51 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    33   0.52 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    35   0.53 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    35   0.54 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    34   0.54 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    34   0.57 
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  34   0.59 
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    35   0.64 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                34   0.65 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    35   0.65 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      34   0.66 
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    35   0.66 
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    35   0.67 
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    34   0.75 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    34   0.77 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    34   0.77 
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    33   0.79 
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    34   0.82 
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    34   0.83 
Suva_3.126 Chr3 complement(189914..190462) [549 bp, 182 aa] {ON}...    33   0.86 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    34   0.87 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    34   0.92 
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    33   0.94 
TDEL0E01860 Chr5 (353978..354790) [813 bp, 270 aa] {ON} Anc_4.18...    33   1.0  
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    33   1.0  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      33   1.1  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    33   1.2  
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     34   1.2  
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    33   1.4  
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    33   1.4  
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    33   1.4  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    33   1.4  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   1.5  
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    32   1.5  
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    33   1.5  
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    33   1.6  
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    32   1.6  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    33   1.7  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    32   1.7  
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    33   1.7  
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    33   1.9  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    33   1.9  
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    32   2.0  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    33   2.0  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    32   2.0  
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    32   2.1  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    32   2.3  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    33   2.3  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    33   2.4  
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    32   2.4  
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    33   2.4  
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    32   2.6  
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    32   2.6  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    32   2.8  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    32   2.8  
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    32   2.8  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    32   2.8  
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    32   2.9  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    32   3.1  
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    32   3.1  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    32   3.4  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    31   3.6  
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    32   3.8  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    32   3.9  
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    32   4.0  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    32   4.4  
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    32   4.5  
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    32   4.6  
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    31   4.7  
CAGL0K01727g Chr11 complement(153398..154897) [1500 bp, 499 aa] ...    32   4.8  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    32   4.8  
KLLA0E07283g Chr5 complement(661677..662738) [1062 bp, 353 aa] {...    31   5.1  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    32   5.1  
ZYRO0A12936g Chr1 complement(1023335..1024135) [801 bp, 266 aa] ...    31   5.2  
Smik_3.188 Chr3 complement(272204..272752) [549 bp, 182 aa] {ON}...    31   5.5  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    30   5.6  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    31   6.3  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    31   6.4  
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    31   6.7  
TDEL0D04500 Chr4 (825355..826758) [1404 bp, 467 aa] {ON} Anc_3.1...    31   6.8  
Skud_3.164 Chr3 complement(257055..257603) [549 bp, 182 aa] {ON}...    30   6.8  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    31   8.0  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    31   8.2  
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     31   8.4  

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 292/475 (61%)

Query: 1   EISRQQQNADXXXXXXXXXXXXXXXXXXXXXTILQNVPNTNNVGADLLASQHFNATAVSS 60
           EISRQQQNAD                     TILQNVPNTNNVGADLLASQHFNATAVSS
Sbjct: 1   EISRQQQNADHHIQQHQQRQQHQQRQQHQQHTILQNVPNTNNVGADLLASQHFNATAVSS 60

Query: 61  NKEDVMVNPGGRELPMPLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVIHXXXXXXX 120
           NKEDVMVNPGGRELPMPLH                              PVIH       
Sbjct: 61  NKEDVMVNPGGRELPMPLHQQQYIYPYYQYANNSSNSTSVATANNTSASPVIHSNSNNSN 120

Query: 121 XXXXXXXXXXXXXXXXXXXIHTNQFXXXXXXXXXXXXXXXXXXFPPSNMPIPQQEQQYMF 180
                              IHTNQF                  FPPSNMPIPQQEQQYMF
Sbjct: 121 NSASDPSAANNNNNNNNNNIHTNQFAAAAGNMNANAAAAAYYAFPPSNMPIPQQEQQYMF 180

Query: 181 NPASYIGHYYSAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           NPASYIGHYYSAV                                               
Sbjct: 181 NPASYIGHYYSAVNNNNNNNNNGNNGGSNPPNPVPPPPHHQQQQHHHHSSGHNNLNNSTV 240

Query: 241 XXXXGPPHHPTIITDQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSN 300
               GPPHHPTIITDQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSN
Sbjct: 241 NTNNGPPHHPTIITDQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSN 300

Query: 301 HPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW 360
           HPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW
Sbjct: 301 HPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW 360

Query: 361 CLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXX 420
           CLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNK                      
Sbjct: 361 CLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNKTSTNSNDNNNSTSTRTSASASS 420

Query: 421 XXXXXXXXXXXXXXXPENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHNK 475
                          PENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHNK
Sbjct: 421 GGGGGGGGGAAAAAAPENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHNK 475

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  405 bits (1041), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 241/450 (53%), Positives = 255/450 (56%), Gaps = 21/450 (4%)

Query: 33  ILQNVPNTNNVGADLLASQHFNATAVSSNKEDVMVNPGGRELPMPLHXXXXXXXXXXXXX 92
           ILQNVPNT NVG +  ASQ FN T+ SSNK+DV VN G RELPMPLH             
Sbjct: 38  ILQNVPNTTNVGNEPQASQPFNPTSTSSNKDDVTVNSGARELPMPLHQQQYIYPYYQYTG 97

Query: 93  XXXXXXXXXXXXXXXXXPVIHXXXX-------XXXXXXXXXXXXXXXXXXXXXXIHTNQF 145
                            P++H                                 IHTNQF
Sbjct: 98  NASGNNNAAAGNNTSASPIVHNNSNNSNNSNIAAAPDYTAVNSNTSNNSNNNNNIHTNQF 157

Query: 146 XXXXXXXXXXXXXXXXXXFPPSNMPIPQQEQQYMFNPASYIGHYYSAVXXXXXXXXXXXX 205
                             FP +NMPIPQQ+QQYMFNPASYIGHYYSAV            
Sbjct: 158 AAAANINTSAAAAAYYT-FPTANMPIPQQDQQYMFNPASYIGHYYSAVNNSNNGNNAANN 216

Query: 206 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPPHHPTIITDQFQFQLQQNA 265
                                                   P HHPTIITDQFQFQLQQN 
Sbjct: 217 SGSNPPHPAPPPPPPHHHHHHRSNPHNNLNNGTVNSNN-APQHHPTIITDQFQFQLQQNH 275

Query: 266 PSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHR 325
           PS+LNLNINPAQPLHLPPGWK+NTMPQPHPA   NHP    PPSNSVAL+++   SS H+
Sbjct: 276 PSNLNLNINPAQPLHLPPGWKINTMPQPHPATTPNHPPAPVPPSNSVALNSVTAPSSDHK 335

Query: 326 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD 385
           YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD
Sbjct: 336 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLD 395

Query: 386 ELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYD 445
           ELKKNNIIFNYN                                      PENEDG+SYD
Sbjct: 396 ELKKNNIIFNYNN------------SSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYD 443

Query: 446 PNIKTLINDGVLNKDDVKRVLNNLIVSHNK 475
           PNIKTLINDGVLNKDDVKRVLNNLIVSHNK
Sbjct: 444 PNIKTLINDGVLNKDDVKRVLNNLIVSHNK 473

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  401 bits (1031), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 248/458 (54%), Gaps = 18/458 (3%)

Query: 32  TILQNVPNTNNVGADLLASQHFNATAVSSNKEDVMVNPGGRELPMPLHXXXXXXXXXXXX 91
           TILQNV NTNN+G+D LASQ FN T VSSNK+DVMVN G RELPMPLH            
Sbjct: 37  TILQNVSNTNNIGSDSLASQPFNTTTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYT 96

Query: 92  XXXXXXXXXXXXXXXXXXPVIHXXXXXXXXXXXXXXXXXXXXXXXXXX------------ 139
                             P++H                                      
Sbjct: 97  SNNSNNNNVTAGNNMSASPIVHNNSNNSNNSNISASDYTVANNSTSNNNNNNNNNNNNNN 156

Query: 140 -IHTNQFXXXXXXXXXXXXXXXXXXFPPSNMPIPQQEQQYMFNPASYIGHYYSAVXXXXX 198
            IH NQF                  FP +NMPIPQQ+QQYMFNPASYI HYYSAV     
Sbjct: 157 NIHPNQFTAAANMNSNAAAAAYYS-FPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNN 215

Query: 199 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-GPPHHPTIITDQF 257
                                                           P HHPTIITDQF
Sbjct: 216 GNNAANNGSNNSSHSAPAPAPGPPHHHHHHSNTHNNLNNGGAVNTNNAPQHHPTIITDQF 275

Query: 258 QFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHAL 317
           QFQLQQN   +LNLNINPAQPLHLPPGWK+NTMPQP P    NHP    P SN VA + +
Sbjct: 276 QFQLQQNPSPNLNLNINPAQPLHLPPGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLV 335

Query: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           P  SS H+YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL
Sbjct: 336 PAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 395

Query: 378 KHTNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPE 437
           KHTNYLLDELKKNNIIFNYN                                      PE
Sbjct: 396 KHTNYLLDELKKNNIIFNYNN---SSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPE 452

Query: 438 NEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHNK 475
           NEDG+ YD NIKTLINDGVLNKDDVKRVLNNLIVSHNK
Sbjct: 453 NEDGNGYDTNIKTLINDGVLNKDDVKRVLNNLIVSHNK 490

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  256 bits (655), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 133/149 (89%)

Query: 246 PPHHPTIITDQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVA 305
           PPH PTIITDQFQFQLQQN   +LN+++N AQPLHLPPGWK+NTMPQPHPAA SNHP + 
Sbjct: 245 PPHQPTIITDQFQFQLQQNGSPNLNMSMNQAQPLHLPPGWKINTMPQPHPAAASNHPPLP 304

Query: 306 APPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ 365
             P NSVA +A+P  SS  +YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ
Sbjct: 305 PQPPNSVAPNAMPAPSSDQKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ 364

Query: 366 KRKDNLLQHMKLKHTNYLLDELKKNNIIF 394
           KRKDNLLQHMKLKHTNYLLDELKKNNIIF
Sbjct: 365 KRKDNLLQHMKLKHTNYLLDELKKNNIIF 393

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 74/171 (43%), Gaps = 10/171 (5%)

Query: 32  TILQNVPNTNNVGADLLASQHFNAT-AVSSNKEDVMVNPGGRELPMPLHXXXXXXXXXXX 90
           TILQN PN  + GAD L S+ FNA+ A SSNK+DV+VNP  RELPMPLH           
Sbjct: 15  TILQNAPNNISAGADPLTSRTFNASVASSSNKDDVIVNPNTRELPMPLHQQQYIYPYYQY 74

Query: 91  XXXXXXXXXXXXXXXXXXXPVIHXXXXXXXXX-------XXXXXXXXXXXXXXXXXIHTN 143
                              P+IH                                 IHTN
Sbjct: 75  SNNNNNSSNVAAANNTSASPIIHSNSNAPATDFGGAGGPNNNNTTTTTTTNNNTNNIHTN 134

Query: 144 QF--XXXXXXXXXXXXXXXXXXFPPSNMPIPQQEQQYMFNPASYIGHYYSA 192
           Q+                    FP SN+PIPQQ+Q YMFNPASYI HYYSA
Sbjct: 135 QYAAATTANMNANAAAAAAYYAFPNSNIPIPQQDQPYMFNPASYINHYYSA 185

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  152 bits (383), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 99/175 (56%), Gaps = 30/175 (17%)

Query: 302 PSVAAPPSNSVALHALPTS--SSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP 359
           PS     +N + +  L  S  SS   +IH+C  CEKSFKR+SWLKRHLLSHS +RH+LCP
Sbjct: 408 PSEQDTSNNKLTITTLTNSDNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCP 467

Query: 360 WCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXX 419
           WCLSR KRKDNLLQHMKLKH+NYLLDELK  N+ FN+                       
Sbjct: 468 WCLSRHKRKDNLLQHMKLKHSNYLLDELKNANVSFNWG---------------------- 505

Query: 420 XXXXXXXXXXXXXXXXPENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN 474
                           P+   G   D +IK L+  G+LNKDDVKRVLN +I   N
Sbjct: 506 -----TYDGQNSTDSMPKTLSGYP-DSSIKKLLYRGILNKDDVKRVLNKIIERSN 554

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  133 bits (335), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 99/177 (55%), Gaps = 51/177 (28%)

Query: 305 AAPPSNSVALHALPTSSS-------THRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFL 357
           + P   +VA+ +L ++S+          Y+H+C  C KSFKRKSWL+RHLLSHS  RHF 
Sbjct: 104 SIPGQRAVAVASLSSNSADDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFS 163

Query: 358 CPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXX 417
           CPWCLS+ KRKDNLLQHMKLKHT+Y+L EL+ NN+                         
Sbjct: 164 CPWCLSKHKRKDNLLQHMKLKHTDYVLQELRLNNVYV----------------------- 200

Query: 418 XXXXXXXXXXXXXXXXXXPENEDGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN 474
                               + +GS  + NI+TL+ +G LNKD+VK+VLN+LI  HN
Sbjct: 201 --------------------STEGSCKN-NIRTLLYEGRLNKDEVKKVLNSLIDRHN 236

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  138 bits (348), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 84/144 (58%), Gaps = 37/144 (25%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           IH C  CEKSF+RKSWLKRHLLSHS +R FLCPWCLSR KRKDNLLQHMKLKH+NYL+ E
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411

Query: 387 LKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDP 446
           LKKNN +F                                           N +  +   
Sbjct: 412 LKKNNAVF-------------------------------------SCVNGGNREKLNDTD 434

Query: 447 NIKTLINDGVLNKDDVKRVLNNLI 470
           +I+ LI+ GV+NKDDVK+V+N LI
Sbjct: 435 DIRNLISLGVINKDDVKKVINKLI 458

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  131 bits (329), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 83/147 (56%), Gaps = 45/147 (30%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           H C  C+KSFKRKSWL+RHLLSHS +RHF CPWCLS+ KRKDNLLQHMKLKHT Y+L++L
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251

Query: 388 KKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDPN 447
           +  N+                                               DG   + N
Sbjct: 252 RNQNVGI---------------------------------------------DGEVRNDN 266

Query: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474
           I+TL+ +G LNK+DVK+VLN LI S+N
Sbjct: 267 IRTLLCEGRLNKEDVKKVLNGLIDSYN 293

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  131 bits (330), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 86/147 (58%), Gaps = 6/147 (4%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           ++C+ CEK FKR+SWLKRHLLSHS +RH+LCPWCLSR KR+DNLLQHMKLKH N L++EL
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459

Query: 388 KKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDPN 447
           K  N I   ++                                     P  E G +    
Sbjct: 460 KLRNFI--SSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGIT---- 513

Query: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474
           IK LI++G++NK+DVKR+LN LI  +N
Sbjct: 514 IKDLISEGLINKEDVKRLLNILIDEYN 540

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  130 bits (328), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 83/147 (56%), Gaps = 33/147 (22%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           H+C  C K FKRKSWLKRHLLSHSQQRHFLCPWC SR KR+DNLLQHMKLKH   LL E+
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEI 593

Query: 388 KKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDPN 447
              N+ FN+                                        +  DG+   P+
Sbjct: 594 NSRNMRFNW---------------------------------PILERLSKQIDGTIEYPD 620

Query: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474
            KTLI++G+LNKD++K +LN +I  HN
Sbjct: 621 TKTLIHEGLLNKDELKNILNTVIDKHN 647

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 88/149 (59%), Gaps = 35/149 (23%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           ++QC  C KSF+R SWLKRHLL+HS QRH+ CP C+S+ KRKDNLLQH+KLKHT ++L++
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 387 LKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDP 446
           L+++NI     K                                      E + G++ + 
Sbjct: 446 LRQDNIDIKTAKDEG-----------------------------------EEDQGTASNT 470

Query: 447 NIKTLINDGVLNKDDVKRVLNNLIVSHNK 475
           NIKTL+ +G LNK+DVK+VLN LI S N+
Sbjct: 471 NIKTLLVEGRLNKEDVKKVLNRLIDSANQ 499

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  125 bits (314), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 85/144 (59%), Gaps = 12/144 (8%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           ++ C  C K+FKR+SWLKRHLLSHS +RH+ CPWCLSR KR+DNLLQHMKLKH+  L++E
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446

Query: 387 LKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDP 446
           LK  N+IF+++                                      P N +    + 
Sbjct: 447 LKFRNVIFDWHN---------YHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINS---EF 494

Query: 447 NIKTLINDGVLNKDDVKRVLNNLI 470
            I+TL+ +GV+NK+DVKRVLN L+
Sbjct: 495 TIRTLVTNGVVNKEDVKRVLNQLV 518

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 77/143 (53%), Gaps = 19/143 (13%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           HQC  C+KSFKRKSWLKRHLLSHS  + F CPWC SR KRKDNLLQHMKLKHT  +L EL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 388 KKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDPN 447
           +   +                                           P + D S    +
Sbjct: 318 QSAGV------------------HPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMT-S 358

Query: 448 IKTLINDGVLNKDDVKRVLNNLI 470
           IKT+I+DG LNKDDVKRVLN LI
Sbjct: 359 IKTMIDDGTLNKDDVKRVLNMLI 381

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  114 bits (284), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 83/156 (53%), Gaps = 45/156 (28%)

Query: 317 LPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           L  SS      H+C  CEK FKRKSWLKRH+LSHS++R + CPWC+SR KRKDNLLQHMK
Sbjct: 102 LYNSSMNEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMK 161

Query: 377 LKHTNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 436
           LKHT+ +L +LK    +                                           
Sbjct: 162 LKHTDEVLKKLKMTCYL------------------------------------------- 178

Query: 437 ENEDGSSY--DPNIKTLINDGVLNKDDVKRVLNNLI 470
           E +DG       NI+T++ +G+L+KD+VK+VLN L+
Sbjct: 179 EGDDGEEMMNRDNIRTMLYEGLLDKDEVKKVLNELL 214

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  119 bits (297), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 85/155 (54%), Gaps = 36/155 (23%)

Query: 320 SSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           +S+   + H C  C K FKRKSWL+RHLLSHS +R+F CPWCLS+ KRKDNLLQHMKLKH
Sbjct: 469 ASNLKNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKH 528

Query: 380 TNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENE 439
              +L++L+ N    N N                                      P  E
Sbjct: 529 AENVLEQLRINLKANNPND----------------------------------NSEPTLE 554

Query: 440 DGSSYDPNIKTLINDGVLNKDDVKRVLNNLIVSHN 474
                D NI+TL+ +G+LNKD+VK++LN+L+  HN
Sbjct: 555 GNG--DHNIRTLMGEGILNKDEVKKLLNSLVAQHN 587

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  117 bits (293), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 81/148 (54%), Gaps = 10/148 (6%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           + QC +C KSFKR SWLKRHLL+HS +RH+ CPWCLS+ KRKDNLLQH+KLKHT  +L +
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 387 LKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDP 446
           L+  NI  +  +                                        + G+    
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVK------QPGT---- 668

Query: 447 NIKTLINDGVLNKDDVKRVLNNLIVSHN 474
           NIKTL+ DG LNK+DVK+VLN L+   N
Sbjct: 669 NIKTLLYDGRLNKEDVKKVLNKLLDGTN 696

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  114 bits (286), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 63/80 (78%)

Query: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           P S+     I QC  CEKSFKRKSWLKRHLLSHS++R+F CP CLS+ KRKDNL+QH+KL
Sbjct: 330 PQSAINQDIIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKL 389

Query: 378 KHTNYLLDELKKNNIIFNYN 397
           KH +Y+L +L K+++I  YN
Sbjct: 390 KHLDYILKKLNKDDLIIKYN 409

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 448 IKTLINDGVLNKDDVKRVLNNLIVSHNK 475
           +K LIND  +NKD++KRV+N +I   NK
Sbjct: 486 VKKLINDAKVNKDELKRVINYIISEANK 513

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  107 bits (268), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 76/148 (51%), Gaps = 18/148 (12%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 384
           +YI +C  C K FKRKSWLKRHLLSHS  R + CPWCLS+ KRKDNLLQHMKLKH   +L
Sbjct: 251 KYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVL 310

Query: 385 DELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSY 444
            E+ K                                                ++ GSS 
Sbjct: 311 QEMDK----------------LSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSS 354

Query: 445 DPNIK--TLINDGVLNKDDVKRVLNNLI 470
           + N+    ++++G L K++VK+VLN++I
Sbjct: 355 NDNVSIIAMVDNGTLKKENVKKVLNSII 382

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  104 bits (260), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 50/64 (78%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 387 LKKN 390
           L  N
Sbjct: 244 LSSN 247

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 50/64 (78%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 387 LKKN 390
           L  N
Sbjct: 345 LSSN 348

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 51/70 (72%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           +QC  CEK F+RKSWLKRHLLSHS  + F CPWC S  KRKDNLLQH+KLKHT YLL E 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

Query: 388 KKNNIIFNYN 397
               I+ N N
Sbjct: 366 TLFGILMNVN 375

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 72/147 (48%), Gaps = 34/147 (23%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           ++C  C+KSFKR+SW KRHLLSHS  + + CPWC SR KR+DNL QHMK KH  +++ EL
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448

Query: 388 KKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDPN 447
            +   +                                              D S+ +P+
Sbjct: 449 LEVGDV----------------------------------DGSVMSGMQVTSDESAPEPS 474

Query: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474
           IKTLI DG + K+ VK VLN +I   N
Sbjct: 475 IKTLIQDGQVKKERVKAVLNAVIARVN 501

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 72/152 (47%), Gaps = 34/152 (22%)

Query: 320 SSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           + S+   +++C  CEKSFKRKSW +RHLLSHS  + + CPWC SR KR+DNL QHMK KH
Sbjct: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439

Query: 380 TNYLLDELKKNNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENE 439
            + +L EL +   +                                              
Sbjct: 440 VHQVLQELMEAGDLDGSMGTNVRLAI---------------------------------- 465

Query: 440 DGSSYDPNIKTLINDGVLNKDDVKRVLNNLIV 471
           D     P+I+TL+ DG + K+ VK VLN +I 
Sbjct: 466 DDMVAGPSIRTLVQDGRVKKERVKTVLNAVIA 497

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 84.0 bits (206), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           +++C  C K F+R++WL+RH LSH+  R+FLCPWC S+ KR+DNL +H+KLKH   L+  
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177

Query: 387 LKK 389
           +++
Sbjct: 178 IRE 180

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 64/141 (45%), Gaps = 47/141 (33%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  C KSF+R +WLKRH ++H+    F C WC S  KR+DN+ +HMKLKH N L+     
Sbjct: 252 CPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLM----- 306

Query: 390 NNIIFNYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPENEDGSSYDPNIK 449
             +I NY                                        E +D       +K
Sbjct: 307 -KVIRNYYPLAEF----------------------------------EGKD-------LK 324

Query: 450 TLINDGVLNKDDVKRVLNNLI 470
            L+ DG L+K+DVKRVL +++
Sbjct: 325 GLLADGRLHKEDVKRVLVDIV 345

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 40/53 (75%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
            ++C+ C K+FKR SWLKRH  SHS+ ++F C WC  + KRKDNL+QH++ KH
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 311 SVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKD 369
           + A  ++  + S      +C+ C K+F+R   LKRH+ S HS +R F CP C  +  R D
Sbjct: 748 TTAKRSVSYNFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSD 807

Query: 370 NLLQHMK 376
           NL QH+K
Sbjct: 808 NLAQHIK 814

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 320 SSSTHRYIHQ-----CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQ 373
           SS+T  Y  Q     C  CEK+F+R   LKRH  S HS +R F C +C  R  R DNL Q
Sbjct: 902 SSTTTIYDDQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQ 961

Query: 374 HMKL--KHTNY 382
           H+K   KH ++
Sbjct: 962 HLKTHKKHGDF 972

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 284 GWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWL 343
           G     M QP   A    PS + P + S +    P       +  +CQ C K+F+R   L
Sbjct: 404 GSSAIAMSQPVNLAKKKRPSASRPRNKSTS----PAEEEEKPF--KCQECTKAFRRSEHL 457

Query: 344 KRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           KRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 458 KRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C+ CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C+ CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 585 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C+ CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 572 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +C  C K+F+R   LKRH+ S HS +R F C  CL +  R DNL QH+K
Sbjct: 690 KCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 67/156 (42%), Gaps = 30/156 (19%)

Query: 254 TDQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVA 313
           T+Q+   L    P+SL+LN  P Q    PP     ++   + ++ + H S  +  + S +
Sbjct: 495 TNQYDLTLN---PTSLSLNKTPTQKFFSPPIKTQKSITPVNFSSTTRHTSSKSVGNGSSS 551

Query: 314 LHALPTS------------------------SSTHRYIHQCQFCEKSFKRKSWLKRHLLS 349
              L T                         +       +C  CEK+F+R   LKRH+ S
Sbjct: 552 ASNLNTVENPRPATSSRRRKSSSKSTTPVNLADDESKPFKCTDCEKAFRRSEHLKRHIRS 611

Query: 350 -HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
            HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 612 VHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C+ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 528 KCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C  CEK+F+R   LKRH+ S HS +R F C +C  R  R DNL QH+K   KH ++
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           QC  C KSF+R   LKRH+ S HS++R F C  C  +  R DNL QH+K
Sbjct: 713 QCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +CQ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 621 KCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +CQ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 698

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           C+ C+K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           QC  C+K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHF 356
           C FCEK F R   L +HL +H +   F
Sbjct: 515 CMFCEKKFSRSDNLSQHLKTHKRHGDF 541

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +CQ C K+F+R   LKRH+ S HS  R F C +C  +  R DNL QH+K
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +CQ C K+F+R   LKRH+ S HS  R F C +C  +  R DNL QH+K
Sbjct: 699 KCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C  CEK FKR   LKRH  S HS +R F C  C  +  R DNL QH+K   KH ++
Sbjct: 314 KCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C+ C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           C++C + FKR+  LKRH+LS H  ++ F CP C     R DNL QH+K  H+N
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK-THSN 453

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C  CEK+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C  C K+FKR   LKRH+ S HS  R F C  C  +  R DNL QH+K   KH ++
Sbjct: 564 KCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C  C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K   KH ++
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKL--KHTNY 382
           +C  C K F+R   LKRH+ S HS++R F C +C  +  R DNL QH+K   KH ++
Sbjct: 438 KCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 16/95 (16%)

Query: 303 SVAAPPSNSVALHALPT-----SSSTHRYIH----------QCQFCEKSFKRKSWLKRHL 347
            V  P S  V  H  P      + STH  +H          QC++C K F +   L+ H+
Sbjct: 475 GVEKPKSRGVKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHV 534

Query: 348 LSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 382
             H+ +R + C  C  R  RK NL  HM L H NY
Sbjct: 535 RLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENY 568

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 300 NHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP 359
           + PS+  PPS  V     P S    +  H+C +C K F + + L+ H+ SH   + F C 
Sbjct: 461 DAPSIIPPPSQLVGGVEKPKSRGVKQ--HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCE 518

Query: 360 WCLSRQKRKDNLLQHMKLKHTN---YLLDELKK 389
           +C  R  +  NL  H++L HT    Y  D+  K
Sbjct: 519 YCGKRFTQGGNLRTHVRL-HTGERPYECDKCGK 550

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           ++C  C K F RK  L  H+L+H   + F C
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQC 573

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C  C KSFKR   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 309 SNSVALHALPTSSSTHRYIHQC---QFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ 365
           +NSVA      S S  R   +C     C  SF R   L RH+  H+ ++ F CP CL   
Sbjct: 22  TNSVAASTPKRSKSARRKTFKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLKFF 81

Query: 366 KRKDNLLQHMKLKH 379
            R DNL QH +  H
Sbjct: 82  SRVDNLKQHRESVH 95

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +C  C K+F+R   LKRH+ S HS +R F C +C  +  R DNL QH+K
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLSHSQ 352
           ST R  H CQFC+K F R   L +HL +H +
Sbjct: 645 STERPFH-CQFCDKKFSRSDNLSQHLKTHKK 674

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C+ C K+FKR   LKRH+ S HSQ+R + C  C  +  R DNL QH+K
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           C+FCE+ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K  HTN   D+
Sbjct: 516 CEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK-THTNGNFDD 572

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +C  CEK FKR   LKRH+ S HS +R + C +C     R DNL QH+K
Sbjct: 309 KCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHF 356
           ST R  H CQFCEK+F R   L +HL +H +   F
Sbjct: 332 STERPYH-CQFCEKNFSRSDNLSQHLKTHKRHGDF 365

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 329 QCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +C  C K+F+R   LKRH+ S HS +R F C  C  +  R DNL QH+K
Sbjct: 387 KCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C  C K+FKR   LKRH+ S HS  R F C  C  +  R DNL QH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 309 SNSVALHALPTSSSTHRYIHQC---QFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ 365
           S SVA  A   S S  R   +C     C  SF R   L RH+  H+ ++ F CP CL   
Sbjct: 22  SKSVAASAPKRSKSARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFF 81

Query: 366 KRKDNLLQHMKLKH 379
            R DNL QH +  H
Sbjct: 82  SRVDNLKQHRESVH 95

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 5/85 (5%)

Query: 293 PHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HS 351
           P PAA +   S + P +       +P +S        C+FC++ FKR+  LKRH+ S H 
Sbjct: 227 PAPAAIAKRRSGSMPKTRGRKPSPIPDASKQF----GCEFCDRRFKRQEHLKRHVRSLHM 282

Query: 352 QQRHFLCPWCLSRQKRKDNLLQHMK 376
            ++ F C  C  +  R DNL QH+K
Sbjct: 283 CEKPFNCHICDKKFSRSDNLNQHIK 307

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (47%), Gaps = 18/123 (14%)

Query: 272 NINPAQPLHLPPGWKVNTMPQ------PHPAAPSNHPSVA---APPSNSVALHALPTSSS 322
           + +P+ PL   P  + +T P+      P  +A  +HP      A  ++   +  +PT + 
Sbjct: 56  SASPSTPLFYDPSNRFSTGPREIQDPPPVTSACMSHPDTGTDLASAASVTTVKPMPTVTV 115

Query: 323 THRYI-------HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQ 373
             ++        +QCQ C K F R S L+ HLL+H+  R F CP+  C      K N+++
Sbjct: 116 DFQHAQPAVHPKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVR 175

Query: 374 HMK 376
           H+K
Sbjct: 176 HLK 178

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 382
           C+FC++ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K    +Y
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKTHGGDY 409

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           I +C  CE+ FKR+  LKRH+ S H  +R + C  CL    R DNL QH K  H N
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH-KRTHNN 271

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 42/95 (44%), Gaps = 16/95 (16%)

Query: 303 SVAAPPSNSVALHALPT-----SSSTHRYIH----------QCQFCEKSFKRKSWLKRHL 347
            V  P S  V  H  P      + STH  +H          QC++C K F +   L+ H+
Sbjct: 479 GVEKPKSRGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHV 538

Query: 348 LSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 382
             H+ +R + C  C  R  RK NL  HM L H N+
Sbjct: 539 RLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENH 572

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 302 PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           PS+  PPS  V     P S    +  H+C +C K F + + L+ H+ SH   + F C +C
Sbjct: 467 PSIIPPPSQLVGGVEKPKSRGVKQ--HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYC 524

Query: 362 LSRQKRKDNLLQHMKLKHTN---YLLDELKK 389
             R  +  NL  H++L HT    Y  D+  K
Sbjct: 525 GKRFTQGGNLRTHVRL-HTGERPYECDKCGK 554

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           ++C  C K F RK  L  H+L+H   + F C
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQC 577

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNI 392
           C  +F R   L RH+  H+ ++ F C  C     R DNL QH +  H N  +DE+  N  
Sbjct: 26  CHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFIDEMSNNTP 85

Query: 393 IFNYNK 398
           I   NK
Sbjct: 86  INIKNK 91

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C FC++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 342 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 303 SVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWC 361
           S+  PP +  +   +  S +   YI  CQ C++ F     L RH  S HS ++ F CP C
Sbjct: 758 SIIHPPQSKFSEEEVVVSKNGKVYI--CQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKC 815

Query: 362 LSRQKRKDNLLQHMKLK 378
             R KR+D++LQH+  K
Sbjct: 816 GKRFKRRDHVLQHLNKK 832

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 15/98 (15%)

Query: 286 KVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKR 345
           K+ TMP+     P       +P  + + L A             C+ C++ FKR+  LKR
Sbjct: 274 KITTMPKRIGTLPKTRGRKPSPILDPLKLFA-------------CEHCDRRFKRQEHLKR 320

Query: 346 HLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY 382
           H+ S H  ++ F C  C  +  R DNL QH+K  H+N+
Sbjct: 321 HVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK-THSNF 357

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  C + F R+  LKRH  SH+ ++ FLC  C     RKD +L+H++  H +Y  ++L K
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDK 88

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           CQ C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H +  H++ + ++
Sbjct: 107 CQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTND 163

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%)

Query: 319 TSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           T+ S    +  C FC+++F R+  L RH  SH+ ++ FLC  C     R+D L++H +  
Sbjct: 143 TTPSGKLRLFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKI 202

Query: 379 H 379
           H
Sbjct: 203 H 203

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 309 SNSVALHALPTSSSTHRYIHQC---QFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ 365
           +N+VA      S S  R   +C     C  SF R   L RH+  H+ ++ F CP CL   
Sbjct: 22  TNNVAGSTPKRSKSARRKSFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFF 81

Query: 366 KRKDNLLQHMKLKH 379
            R DNL QH +  H
Sbjct: 82  SRVDNLKQHRESVH 95

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           C++CE+ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K  H+N
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIKT-HSN 513

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           C FC++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K  HT+
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK-THTD 399

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (44%), Gaps = 24/128 (18%)

Query: 250 PTIITDQFQFQLQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPS 309
           P+I  + F+   +   P+    + N AQ + LP   K+  +P+     PS          
Sbjct: 331 PSIFVEDFKIDKKTRIPNKTTDHSN-AQSIILPK--KIGILPKTRGRKPS---------- 377

Query: 310 NSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRK 368
                   P   S+ ++   C +CE+ FKR+  LKRH+ S H   + + C  C  +  R 
Sbjct: 378 --------PILDSSKQF--GCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRS 427

Query: 369 DNLLQHMK 376
           DNL QH+K
Sbjct: 428 DNLSQHIK 435

>Suva_13.247 Chr13 (391743..391805) [63 bp, 21 aa] {OFF} YMR070W
           (HSP)
          Length = 21

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/21 (100%), Positives = 21/21 (100%)

Query: 455 GVLNKDDVKRVLNNLIVSHNK 475
           GVLNKDDVKRVLNNLIVSHNK
Sbjct: 1   GVLNKDDVKRVLNNLIVSHNK 21

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C +CE+ FKR+  LKRH+ S H  ++ + C  C     R DNL QH+K
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C++C++ FKR+  LKRH+ S H  ++ F C  C  +  R DNL QH+K
Sbjct: 505 CEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM-KLKHTNYLLDELK 388
           CQ C ++F R+  L RH  SH++++ + C  C  +  R+D LL+H  K+   NY    +K
Sbjct: 88  CQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNYGDTIIK 147

Query: 389 KNNIIFNYN 397
           +NN+  N N
Sbjct: 148 QNNVKENSN 156

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 9/98 (9%)

Query: 288 NTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHR--------YIHQCQFCEKSFKR 339
           NT  Q       +  +  +P    + ++ LP  +   +            C+FC++ FKR
Sbjct: 216 NTESQYSEKTAYDSSTTNSPEGKKIRINGLPPRTRGRKPSLVPDLSKQFGCEFCDRRFKR 275

Query: 340 KSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 276 QEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNY 382
           R   QC  C KS  R S L+ H+L H+  R F C W  C  R   K N+ +H KL     
Sbjct: 488 RKSRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQ 547

Query: 383 LLDEL 387
           L +E+
Sbjct: 548 LANEV 552

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  C + F R+  L+RH  SH+ ++ FLC +C     R+D +L+H +  H + L+D+ K 
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDKD 143

Query: 390 NNII 393
            +I+
Sbjct: 144 ADIV 147

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 397 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C++C++ FKR+  LKRH+ S H  ++ + C  C  +  R DNL QH+K
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           + C++CE+ FKR+  LKRH+ S H   + + C  C  +  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           C  C + F R+  LKRH +SH+ ++ FLC +C     RKD +L+H
Sbjct: 36  CSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C+FC++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           H C FC ++F R    KRH  SH   + F C  C     R+D L +H+K  H  +LL+  
Sbjct: 5   HVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLEHG 64

Query: 388 KKNNIIF 394
           + N+ +F
Sbjct: 65  QDNSQLF 71

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 49/111 (44%), Gaps = 13/111 (11%)

Query: 279 LHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVA-----LHALPTSSSTHR-------Y 326
           LH+P     N++  P    PS  P+  + P++  A       AL  S +T R        
Sbjct: 366 LHIPNSSSANSL-SPTSLGPSTGPAETSSPADHSAPLDEGETALNLSGNTRRKSLQKNPA 424

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           I+ C  C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H    H   + +EL++
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNELQQ 133

Query: 390 N 390
           N
Sbjct: 134 N 134

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 320 SSSTHRYIHQC---QFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           + S  R   +C     C  SF R   L RH+  H+ ++ F CP CL    R DNL QH +
Sbjct: 36  TKSARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRE 95

Query: 377 LKHTNYLL 384
             H +  L
Sbjct: 96  SVHAHKQL 103

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 311 SVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRK 368
           + A ++ PT S + R   QC  C K   R S LK H L H+    F CPW  C      K
Sbjct: 241 TAANNSGPTDSLSARLKRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVK 300

Query: 369 DNLLQHMK 376
            N+L+H K
Sbjct: 301 SNMLRHYK 308

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 303 SVAAPPSNSVALHALPT-----SSSTHRYIH----------QCQFCEKSFKRKSWLKRHL 347
            V  P +  V  H  P      + STH  +H          QC++C K F +   L+ H 
Sbjct: 528 GVEKPKARGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHT 587

Query: 348 LSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
             H+ ++ + C  C  R  RK NL  HM L H N
Sbjct: 588 RLHTGEKPYSCEKCGKRFSRKGNLAAHM-LTHEN 620

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 302 PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           PS+  PPS  V     P +    +  H+C +C K F + + L+ H+ SH   + F C +C
Sbjct: 516 PSLIPPPSELVGGVEKPKARGVKQ--HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYC 573

Query: 362 LSRQKRKDNLLQHMKL 377
             R  +  NL  H +L
Sbjct: 574 GKRFTQGGNLRTHTRL 589

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           + C+ C K F RK  L  H+L+H   + + C
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHC 626

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 288 NTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYI----HQCQFCEKSFKRKSWL 343
           +T+    P A S  P V A  ++ + +  +P  S T +        C  C + F R+  L
Sbjct: 17  STIYADRPPALSAPPCVGATGNDKIQVLPIPKKSRTIKTDKPRPFLCHICTRGFVRQEHL 76

Query: 344 KRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           KRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 77  KRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 310 NSVALHALPTSS------STHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--C 361
           ++V+L  LP +          R IHQC  C +   R   L  H+L H++ + F C W  C
Sbjct: 402 DNVSLSKLPITDRKGKKKKKKRAIHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDC 461

Query: 362 LSRQKRKDNLLQHMKL 377
                 K NL +HMK+
Sbjct: 462 GKAFSIKSNLSRHMKI 477

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C+ C ++F R+  L RH  SH++++ ++C  C  R  R+D L++H +  H     D +++
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLHGGNCGDYIRR 186

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C++CE+ FKR+  LKRH+ S H   + + C  C     R DNL QH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 388
           C  C + F+R+  +KRH+ + H Q+R + C  C     R DNL QH++    NY +    
Sbjct: 415 CTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNYEV---- 470

Query: 389 KNNIIFNYN 397
           K+  +FNY+
Sbjct: 471 KHPPLFNYD 479

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 388
           +CQFC+K F   S L+ H+ +H+ ++   C  C  R     NL +HMK+    Y+    K
Sbjct: 575 KCQFCDKRFTTSSSLRIHIRTHTGEKPLACNVCGKRFNESSNLSKHMKIHERKYMCKHCK 634

Query: 389 KN 390
           ++
Sbjct: 635 RS 636

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           +C  C K+F  +  L +H+ +HS +R F C +C  R     +L  H++
Sbjct: 547 KCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIR 594

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 313 ALHALPTSSSTHRYIHQCQF--CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDN 370
           A+H +PT  S++    QC++  C K F ++  L RH+  H+  + F CP C      +D 
Sbjct: 506 AIH-VPTGQSSY----QCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCPHCSKTFSTEDI 560

Query: 371 LLQHMK 376
           L QH++
Sbjct: 561 LSQHIR 566

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 37/76 (48%), Gaps = 10/76 (13%)

Query: 319 TSSSTHRYIHQ----CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLL 372
           TS+ST   I +    C  C K FKR S L  H+  H+  + F CP+  C      K N+L
Sbjct: 292 TSTSTGGNIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNML 351

Query: 373 Q----HMKLKHTNYLL 384
           +    H KL   NY+L
Sbjct: 352 RHYKLHFKLSSGNYIL 367

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 4/99 (4%)

Query: 287 VNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIH----QCQFCEKSFKRKSW 342
           +N       ++P+  P V    +++ A   +P  S T +        C  C + F R+  
Sbjct: 33  INVSGTSSRSSPTISPPVIGQKASTPATMPIPKKSRTIKTDRPRPFLCSICTRGFARQEH 92

Query: 343 LKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           LKRH  +H+ ++ FLC +C     R+D +L+H +  H+ 
Sbjct: 93  LKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHST 131

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%)

Query: 296 AAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRH 355
            +P   P ++  P   V     PT S T +  HQC +C + F + + L+ H+ SH   + 
Sbjct: 485 TSPMGSPLLSTSPQTPVNNDLSPTRSRTKKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKP 544

Query: 356 FLCPWCLSRQKRKDNLLQHMKL 377
           + C +C  +  +  NL  H +L
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRL 566

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 14/84 (16%)

Query: 320 SSSTHRYIH----------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           S STH  +H          QC FC K F +   LK H   H+ ++ + C  C  R  RK 
Sbjct: 527 SQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKG 586

Query: 370 NL----LQHMKLKHTNYLLDELKK 389
           NL    L H KLK     LD   K
Sbjct: 587 NLTAHVLTHKKLKPYFCKLDNCNK 610

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 388
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H +  H + L+D+ K
Sbjct: 75  CPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDK 132

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNY 382
           R  + C  C K F     L RH   H+ +++ LCP+  C  R  R+DN LQH +    N+
Sbjct: 182 RRKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFKNF 241

Query: 383 LLDEL--KKNNII 393
               L  KK   I
Sbjct: 242 TFTNLANKKGTCI 254

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           C  C + F R   LKRH +SH+ ++ FLC +C     RKD +L+H
Sbjct: 38  CSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 388
           C  C+K FKR   LKRH  + H + R F C  C  R  R DNL QH+++     +++ ++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEPIR 284

Query: 389 KNNII 393
           K + +
Sbjct: 285 KRSSV 289

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 280 HLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKR 339
           H PP   V+T P P  A P  H +  A P+        P S++    +H+C  C K+F R
Sbjct: 69  HTPP--MVHTPPLPQSALPFAHMAPLAHPAALAVPARAPPSAT----LHECHVCGKTFSR 122

Query: 340 KSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKL 377
            S L  H L H+  + F+C  P C  R   K NL++H K+
Sbjct: 123 PSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKI 162

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 13/75 (17%)

Query: 317 LPTSSSTHRY------------IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLS 363
           LP  + +HR+            ++ CQ C++ F     L RH  S HS ++ + CP C  
Sbjct: 737 LPPGTVSHRFGVNEVIMNEYGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGK 796

Query: 364 RQKRKDNLLQHMKLK 378
           R KR+D++LQH+  K
Sbjct: 797 RFKRRDHVLQHLNKK 811

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 3/103 (2%)

Query: 277 QPLHLPPGWKV-NTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEK 335
           +P  +PPG+ V  TM +       + P      S + +     T  S+ +   QC  C K
Sbjct: 202 RPKSVPPGYGVLPTMQEASNGRTKSEPGAVLNGSATFSDWKTDTRISSTKLRKQCPVCGK 261

Query: 336 SFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
              R S LK H L H+    F C W  C      K N+L+H+K
Sbjct: 262 ICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           CQ C + F R+  L+RH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 89  CQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 133

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  C ++F R+  LKRH  SH+ ++ F+C +C     R+D +L+H    H+  +  EL  
Sbjct: 54  CSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTELHH 113

Query: 390 NNI 392
            N+
Sbjct: 114 ENV 116

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           C  C K F R S L+ H+L HS  + F C W  C  +   K NL++H+KL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 14/84 (16%)

Query: 320 SSSTHRYIH----------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           + STH  +H          QC++C K F +   L+ H   H+ +R + C  C  +  RK 
Sbjct: 518 TQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKG 577

Query: 370 NL----LQHMKLKHTNYLLDELKK 389
           NL    L H KLK     LDE  K
Sbjct: 578 NLAAHFLTHQKLKPYVCKLDECNK 601

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%)

Query: 307 PPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQK 366
           PPSN +        S+     H+C +C + F + + L+ H+ SH   + F C +C  R  
Sbjct: 487 PPSNQLVGGVEKPKSAHGIKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFT 546

Query: 367 RKDNLLQHMKL 377
           +  NL  H +L
Sbjct: 547 QGGNLRTHQRL 557

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           CQ C ++F R+  L RH  SH++++ + C  C  R  R+D LL+H
Sbjct: 32  CQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 326 YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           + + C  C K F+R S LK H+  H+  + +LCP+  C      K N+L+H KL
Sbjct: 413 FKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKL 466

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 299 SNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFL 357
           +  P  A  P++ ++   +  S     Y+  CQ C++ F     L RH  S HS ++   
Sbjct: 705 AGRPERATSPTSKISAEEIIISDKGKAYV--CQECQRQFSSGHHLTRHKKSVHSGEKPHS 762

Query: 358 CPWCLSRQKRKDNLLQHMKLK 378
           CP C  + KR+D++LQH+  K
Sbjct: 763 CPKCGKKFKRRDHVLQHLNKK 783

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           I  C +C + FKR+  LKRH  S H  ++ F C  C  +  R DNL QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 288 NTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYI----HQCQFCEKSFKRKSWL 343
           +T P   P A S  P V +  ++   +  +P  S T +        C  C + F R+  L
Sbjct: 17  STGPADRPPAFSAPPCVISTGNDEAQVLPIPKKSRTIKTDKPRPFLCHICTRGFVRQEHL 76

Query: 344 KRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           KRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 77  KRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTNYLLD 385
           ++C+ C K F R    +RH+ +H+ ++   C  P C+ R  R D L +H+++ HTN    
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI-HTNTSKR 83

Query: 386 ELKK 389
           + +K
Sbjct: 84  KTRK 87

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKL-KHTNYLLDE 386
           C+ C +  +R S LK H+L+H+ QR F C  P C      + N+L+H +L    + L+D 
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGSELVDT 265

Query: 387 LKKNN 391
             +N+
Sbjct: 266 HSQNS 270

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL----LD 385
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H    H+  +    +D
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESVD 122

Query: 386 ELKKNNI 392
              KN I
Sbjct: 123 SRDKNEI 129

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C+ C ++F R+  L RH  SH++++ + C  C  R  R+D LL+H    H     + +KK
Sbjct: 61  CKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLHGGNCGETIKK 120

Query: 390 N 390
            
Sbjct: 121 G 121

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           I+ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 858 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 388
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H +  H + L+D+ K
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHAS-LMDQDK 139

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 381
           H C  C+++F+R     RHL +H+ ++   C  P C  R  R D L +H ++ HTN
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI-HTN 83

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 303 SVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWC 361
           +  + P N      +  S +   YI  CQ C++ F     L RH  S HS ++   CP C
Sbjct: 754 TAGSIPQNKFGSDEIVISENGKVYI--CQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKC 811

Query: 362 LSRQKRKDNLLQHMKLK 378
             R KR+D++LQH+  K
Sbjct: 812 GKRFKRRDHVLQHLNKK 828

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 321 SSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 380
           +S  +YI  C FC K+F R     RH  SH+  + F C  C     R+D L +H++  H 
Sbjct: 3   ASQRKYI--CSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHR 60

Query: 381 NYLLDELKK 389
            +LL   K+
Sbjct: 61  TFLLQCTKE 69

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           C++C++ FKR+  LKRH+ S H  ++ F C  C     R DNL QH+K
Sbjct: 400 CEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 302 PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           PS+  P S  V     P +    +  H+C +C K F + + L+ H+ SH   + F C +C
Sbjct: 479 PSIIPPASELVGGVEKPKARGAKQ--HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYC 536

Query: 362 LSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFN 395
             R  +  NL  H++L HT     E +K    F+
Sbjct: 537 GKRFTQGGNLRTHVRL-HTGEKPYECEKCGRRFS 569

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 303 SVAAPPSNSVALHALPT-----SSSTHRYIH----------QCQFCEKSFKRKSWLKRHL 347
            V  P +     H  P      + STH  +H          QC++C K F +   L+ H+
Sbjct: 491 GVEKPKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHV 550

Query: 348 LSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
             H+ ++ + C  C  R  RK NL  H +L H N
Sbjct: 551 RLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHEN 583

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDIDLVSLRR 83

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  SF R   L RH+  H+ ++ F C  CL    R DNL QH    H++  L  L++
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H +  H++
Sbjct: 34  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSS 85

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 381
           H C  C+++F R     RHL +H+ ++  +C  P C+ R  R D L +H ++ HTN
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI-HTN 97

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKL 377
           C+ C +  +R S LK H+L+H+ QR F C  P C      + N+L+H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           C  C + F R+  LKRH  SH+++R FLC  C     RKD +L+H +  H
Sbjct: 51  CPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLH 100

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
           +H C  C KS  R + L+ H+L H+  R F C W  C +    K N+ +H K
Sbjct: 284 LHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 302 PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           PS+  P S  V     P +    +  H+C +C K F + + L+ H+ SH   + F C +C
Sbjct: 462 PSIIPPASELVGGVEKPKARGAKQ--HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYC 519

Query: 362 LSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFN 395
             R  +  NL  H++L HT     E +K    F+
Sbjct: 520 GKRFTQGGNLRTHVRL-HTGEKPYECEKCGRRFS 552

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 303 SVAAPPSNSVALHALPT-----SSSTHRYIH----------QCQFCEKSFKRKSWLKRHL 347
            V  P +     H  P      + STH  +H          QC++C K F +   L+ H+
Sbjct: 474 GVEKPKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHV 533

Query: 348 LSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
             H+ ++ + C  C  R  RK NL  H +L H N
Sbjct: 534 RLHTGEKPYECEKCGRRFSRKGNLAAH-RLTHEN 566

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           TH+ +H      +C+ C+K F RK  L  HLL+H + + F+C   L    R    L +MK
Sbjct: 560 THQRLHTGEKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICK--LDNCNRSFTQLGNMK 617

Query: 377 LKHTNYLLDELK 388
                + LD LK
Sbjct: 618 AHQNRFHLDTLK 629

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           +QC +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + + C +C  R  +  NL  H +L
Sbjct: 515 HKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQRL 564

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 15/99 (15%)

Query: 297 APSNHPSV-AAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRH 355
            P++  SV  +P S+ V       SS T  Y+  C +C+  F+ + +L RH+  H++++ 
Sbjct: 175 TPASKKSVDESPLSDEVPQGTADESSETLPYV--CHYCDARFRIRGYLTRHIKKHAKRKA 232

Query: 356 FLCPW---CLSRQ---------KRKDNLLQHMKLKHTNY 382
           + CP+    +S++          R+D    H+K +H NY
Sbjct: 233 YHCPFFDDSISQELRCHTSGGFSRRDTYKTHLKSRHFNY 271

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKN 390
           CE SF R   L RH+  H+ ++ F C  CL    R DNL QH   K T +  D +K N
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQH---KDTVHAKDNVKNN 87

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHM 375
           P S++T    H+C+ C K+F R S L  H L H+  + + C  P C  R   K NL++H 
Sbjct: 184 PRSAATSSTHHECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHR 243

Query: 376 KL 377
           K+
Sbjct: 244 KI 245

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
           IH+C  C+K   R + L+ HLL H+ ++ + C W  C +    K N+ +H K
Sbjct: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 13/88 (14%)

Query: 292 QPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHS 351
           + H   P N       PS  V L               C  C ++F R+  L RH  SH+
Sbjct: 21  KKHKDLPDNLRLNGKTPSGKVRLFV-------------CSICTRAFARQEHLTRHERSHT 67

Query: 352 QQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           +++ + C  C  +  R+D LL+H +  H
Sbjct: 68  KEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 313 ALHALPTSSSTHRYIH-QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKD 369
            +  LPT +   + +  QC  C K   R S L+ H+  H+ +R FLC W  C  R   K 
Sbjct: 280 GVDKLPTPNKRRKCVRNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKS 339

Query: 370 NLLQHMKL 377
           N+++H +L
Sbjct: 340 NMVRHYRL 347

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 320 SSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           +S+ HRYI  C  C K F R S L+ H   H+  R F CP+  C      + N+L+H KL
Sbjct: 201 ASNLHRYI--CSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 258

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 9/94 (9%)

Query: 292 QPHPAAPSNH------PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKR 345
           QP   +PSN+        +   P N + LH    S     ++  C  C ++F R+  L R
Sbjct: 39  QPRTISPSNNMNSRINKRMKDLPDN-LKLHGTTPSGKPRLFV--CDVCSRAFARQEHLDR 95

Query: 346 HLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           H  SH+ ++ + C  C  +  R+D LL+H +  H
Sbjct: 96  HARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 9/88 (10%)

Query: 307 PPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSR 364
           PPS S     L  +S   R   QC  C K   R S LK H L H+    F CPW  C   
Sbjct: 252 PPSRSAIQKNLNLAS---RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKS 308

Query: 365 QKRKDNLLQHMKLKH----TNYLLDELK 388
              K N+L+H+K         Y+++E K
Sbjct: 309 FNVKSNMLRHLKSHQKKGAKTYVINERK 336

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C  C ++F R+  L RH  SH+ ++ ++C  C  R  R+D LL+H    H     D L K
Sbjct: 51  CHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCGDALLK 110

Query: 390 NN 391
             
Sbjct: 111 KG 112

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           I+ C+ C+K F R   LK HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDL 700

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 383
           C  C + F R+  LKRH  +H+ ++ FLC +C     R+D +L+H    H++ +
Sbjct: 56  CSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLI 109

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 383
           C  C + F R   LKRH  SH+Q++ +LC +C     R+D +L+H    H++ L
Sbjct: 47  CPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSSIL 100

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKH 379
           +T R   QC  C K   R S LK H+L H+    F C W  C      K NLL+H+K   
Sbjct: 278 ATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHE 337

Query: 380 TNYL 383
            N L
Sbjct: 338 KNSL 341

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
           QC  C+K   R + LK HLL H+    F CPW  C      K N+L+H+K
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 14/98 (14%)

Query: 297 APSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHF 356
            P++  SV   P +         SS T  YI  C +C+  F+ + +L RH+  H++++ +
Sbjct: 175 TPASKKSVDDSPLSDSVQGNTDESSETLPYI--CHYCDSRFRIRGYLTRHIKKHAKRKAY 232

Query: 357 LCPW---CLSRQ---------KRKDNLLQHMKLKHTNY 382
            CP+    +S++          R+D    H+K +H NY
Sbjct: 233 HCPFFDGSISQELRCHNSGGFSRRDTYKTHLKSRHFNY 270

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           ++C +C K F +   LK H+  H+ ++ F C +C  R  RK NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           C+FC K F RK  L  HL++H + R F+C    C+    +  N+  H    H N L +  
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTELT 505

Query: 388 KK 389
           ++
Sbjct: 506 RR 507

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           H+C  C K F + + L+ HL SH   + + C WC     +  NL  H++L HT 
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL-HTG 440

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%)

Query: 333 CEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 383
           C  +F R   L RH+  H+ ++ F C  CL R  R DNL QH +  H   +
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHATVV 77

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           S+  + H C +C ++F R     RH  SH+  + + C  CL    R+D L +H++  H +
Sbjct: 3   SSTNWKHICSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKS 62

Query: 382 YLLDELKK 389
            LL +  K
Sbjct: 63  LLLSKASK 70

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H
Sbjct: 73  CSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 117

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           ++ CQ C++ F     L RH  S HS ++ + CP C  + KR+D++LQH+  K
Sbjct: 787 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 11/72 (15%)

Query: 320 SSSTHRYIH----------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           S STH  +H          QCQFC K F +   L+ H   H+ ++ + C  C  R  RK 
Sbjct: 312 SQSTHLEVHIRSHIGYKPFQCQFCGKKFTQGGNLRTHQRLHTGEKPYQCESCGRRFSRKG 371

Query: 370 NLLQHMKLKHTN 381
           NL  H+ L H N
Sbjct: 372 NLAAHI-LTHKN 382

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + F C +C  +  +  NL  H +L
Sbjct: 302 HECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQFCGKKFTQGGNLRTHQRL 351

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 8/71 (11%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQH 374
           TH+ +H      QC+ C + F RK  L  H+L+H   + F+C    C     +  N+  H
Sbjct: 347 THQRLHTGEKPYQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAH 406

Query: 375 MKLKHTNYLLD 385
               H N L++
Sbjct: 407 QNRFHLNTLIE 417

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           QC  C K   R S LK H L H+    F CPW  C      K N+L+H+K 
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H
Sbjct: 77  CSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 121

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           S H  I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           H C  C + F R   LKRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 79

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 44/108 (40%), Gaps = 21/108 (19%)

Query: 303 SVAAPPSNSVALHALPT-----SSSTHRYIH----------QCQFCEKSFKRKSWLKRHL 347
            V  P S  V     P      + STH  +H           C+FC K F +   L+ H+
Sbjct: 511 GVEKPKSKGVKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHI 570

Query: 348 LSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNY-----LLDELKKN 390
             H+ ++ + C  C  +  RK NL  H KL H N       LD+  KN
Sbjct: 571 RLHTGEKPYECERCGRKFSRKGNLAAH-KLTHDNLKPFECKLDDCNKN 617

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 302 PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           PS+  P S  V     P S    ++  QC +C K F + + L+ H+ SH   + F C +C
Sbjct: 499 PSIIPPLSQLVGGVEKPKSKGVKQF--QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFC 556

Query: 362 LSRQKRKDNLLQHMKL 377
             R  +  NL  H++L
Sbjct: 557 GKRFTQGGNLRTHIRL 572

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           C  C +SF     L RH  + H  ++ F CP C  R KR+D++LQH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 11/70 (15%)

Query: 320 SSSTHRYIH----------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           S STH  +H          QC FC K F +   L+ H   H+ ++ + C  C  R  RK 
Sbjct: 610 SQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKG 669

Query: 370 NLLQHMKLKH 379
           NL  H KL H
Sbjct: 670 NLAAH-KLTH 678

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQH 374
           TH+ +H      +C+ C+K F RK  L  H L+H   + F+C    C     +  N+  H
Sbjct: 645 THQRLHTGEKPYRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAH 704

Query: 375 MKLKHTNYLLDELKK 389
               H   LL+   K
Sbjct: 705 QNKFHLQTLLELTSK 719

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           S H  I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 313 ALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDN 370
           ++  L  S ST +  + C+ C K FKR S L  H+  H+  + + CP+  C      K N
Sbjct: 263 SIQDLEISPSTDKVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSN 322

Query: 371 LLQHMKL 377
           +L+H KL
Sbjct: 323 MLRHYKL 329

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           ++ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           S H  I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 822 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM-KLKHTNY 382
           C  C ++F R+  L RH  SH++++ + C  C  +  R+D LL+H  K+   NY
Sbjct: 120 CSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRHAHKIHGGNY 173

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 322 STHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           S H  I+ C+ C + F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 844 SDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 14/73 (19%)

Query: 320 SSSTHRYIH----------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           + STH  +H          QC+FC K F +   L+ H   H+ ++ + C  C  R  RK 
Sbjct: 419 TQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKG 478

Query: 370 NL----LQHMKLK 378
           NL    L H KLK
Sbjct: 479 NLAAHALTHQKLK 491

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%)

Query: 307 PPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQK 366
           PPSN +        SS     H+C +C + F + + L+ H+ SH   + F C +C  R  
Sbjct: 388 PPSNQLVGGVEKPKSSHGMKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFT 447

Query: 367 RKDNLLQHMKL 377
           +  NL  H +L
Sbjct: 448 QGGNLRTHQRL 458

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 323 THRYIHQ------CQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           TH+ +H       C+ C K F RK  L  H L+H + + ++C
Sbjct: 454 THQRLHTGEKPYNCEMCGKRFSRKGNLAAHALTHQKLKPYIC 495

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 17/127 (13%)

Query: 279 LHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHR--YIHQCQFCEKS 336
           +HL P     T  +      S+ P ++  P + VA+ A   S +  R   +++C +C  +
Sbjct: 110 VHLSP----CTQDEQASGDSSDAPQISETPVD-VAVEAPAQSPTFARDSAVYRCSYCPSN 164

Query: 337 FKRKSWLKRHLLSHSQQRHFLCPW------CLSRQK--RKDNLLQHMKLKHTNYLLDELK 388
           FK + +L RHL  H   + F CP+      C S  +  RKD    H+K  H  Y +   K
Sbjct: 165 FKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIHFVYPVGTTK 224

Query: 389 --KNNII 393
             +NN +
Sbjct: 225 AQRNNSV 231

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 288 NTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYI----HQCQFCEKSFKRKSWL 343
           +T+    P + S  P V +   +   +  +P  S T +        C  C + F R+  L
Sbjct: 17  STILVDRPPSLSAPPCVGSTGDDETQVLPIPKKSRTIKTDKPRPFLCHICTRGFVRQEHL 76

Query: 344 KRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           KRH  +H+ ++ FLC +C     R+D +L+H
Sbjct: 77  KRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           C+ C ++F R+  L RH  SH++++ + C  C  +  R+D L++H +  H   ++D +
Sbjct: 118 CEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVVDTV 175

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 302 PSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPW 360
           P   A P + ++   +  S     YI  CQ C++ F     L RH  S HS ++   CP 
Sbjct: 728 PDRPASPISKISAEEIIISEKGKAYI--CQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK 785

Query: 361 CLSRQKRKDNLLQHMKLK 378
           C  + KR+D++LQH+  K
Sbjct: 786 CGKKFKRRDHVLQHLNKK 803

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           + C  C + F R+  LKRH  SH+ ++ FLC +C     R+D +L+H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 103

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK--LKHT 380
           R  H+CQ C+K F     L RH   H+ +++  C  P C  R  R DN LQH +  LK T
Sbjct: 190 RRKHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQHYRTHLKKT 249

Query: 381 N 381
           +
Sbjct: 250 S 250

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           ++ CQ C++ F     L RH  S HS ++ + CP C  + KR+D++LQH+  K
Sbjct: 755 VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           CQ+C + F+R+  +KRH+ S H  ++ + C  C     R DNL QH K
Sbjct: 173 CQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           I+ CQ C++ F     L RH  S HS ++   CP C  R KR+D++LQH+  K
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 15/80 (18%)

Query: 316 ALPTSSSTHR-YIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ--------- 365
           A P+SSS    ++  C +C+  F+ + +L RH+  H+ ++ F CP+    Q         
Sbjct: 50  ARPSSSSAMEPFV--CHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPS 107

Query: 366 ---KRKDNLLQHMKLKHTNY 382
               R+D    H+K+KH  Y
Sbjct: 108 GGFSRRDTYKTHLKVKHVLY 127

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 323 THRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           T +   QC+ C K   R S L+ H+L H+  R F C W  C      K N+ +H+KL
Sbjct: 442 TRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 35/61 (57%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C+ C ++F R+  LKRH  SH+ ++ + C  C     R+D L++H +  H+  L + + +
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETISQ 165

Query: 390 N 390
           N
Sbjct: 166 N 166

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 310 NSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           +++ L+ L  S +   ++  C  C+K+F R+  L RHL SH+ ++ F C  C     R+D
Sbjct: 33  DNLKLNGLTPSGNKRTFL--CFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRD 90

Query: 370 NLLQHMKLKHTN 381
            L++H    H++
Sbjct: 91  LLIRHSNKLHSD 102

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 10/73 (13%)

Query: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CL----SRQKRKD 369
           PT+ ST   I++C +C  SFK + +L RHL  H   + F CP+    C         RKD
Sbjct: 226 PTTESTT--IYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKD 283

Query: 370 NLLQHMKLKHTNY 382
               H+K  H  Y
Sbjct: 284 TFRTHLKSIHFVY 296

>YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}
           NRG2Transcriptional repressor that mediates glucose
           repression and negatively regulates filamentous growth;
           has similarity to Nrg1p
          Length = 220

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 298 PSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFL 357
           P +   ++ P    + L +  T+++  R  H C+ C   F     L RH   H+ +++ +
Sbjct: 123 PYSSIKISKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHI 182

Query: 358 CP--WCLSRQKRKDNLLQHMK 376
           CP   C  R  R DN  QH +
Sbjct: 183 CPHEGCGQRFSRHDNCNQHYR 203

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 330 CQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 378
           C  C +SF     L RH  + H  ++ F CP C  R KR+D++LQH+  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 276 AQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTH-RYIHQCQFCE 334
           ++ L +P   K++  PQ H     +  S      +S++  +L  S     R  + C+ C 
Sbjct: 351 SKSLTVPSKTKISASPQKHKKHGQSRKSKLQQKKHSIS--SLCNSDDIELRRKYLCKVCG 408

Query: 335 KSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
           K F     L RH   H+ ++  +CP+  C  R  R DN LQH K
Sbjct: 409 KGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLL 384
           QC  C + F RK+ L+RH+ SHS+ + F C +C      K  L +H ++ HT   +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRH-EITHTRSFV 136

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 35/61 (57%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C+ C ++F R+  LKRH  SH+ ++ + C  C     R+D L++H +  H+  L + + +
Sbjct: 112 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETISQ 171

Query: 390 N 390
           N
Sbjct: 172 N 172

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 10/64 (15%)

Query: 322 STHRYIH----------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNL 371
           STH  +H          QCQ+C K F +   L+ H   H+ ++ + C  C  R  RK NL
Sbjct: 436 STHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNL 495

Query: 372 LQHM 375
             H+
Sbjct: 496 AAHV 499

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + F C +C  R  +  NL  H +L
Sbjct: 424 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRL 473

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           CQ C ++F R+  L RH  SH++++ + C  C     R+D LL+H    H     D + +
Sbjct: 61  CQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVHGGNSGDSIIR 120

Query: 390 NN 391
           +N
Sbjct: 121 HN 122

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTNYL 383
           H C  C ++F R     RH+ +H+ ++   C  P C+ R  R D L +H ++ HTN L
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTNPL 99

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 317 LPTSSSTHR---YIHQ-CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLL 372
           LP+ +S++R   ++ + C  C KSF R+S L+ HLL H+  + F C +C      K NL 
Sbjct: 156 LPSQTSSNRGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLN 215

Query: 373 QHMKL 377
           +H ++
Sbjct: 216 RHERI 220

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 321 SSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHT 380
           +S  +YI  C FC K F R     RH  SH+  + F C  C     R+D L +H++  H 
Sbjct: 3   ASQRKYI--CSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVHK 60

Query: 381 NYLLDELKKNN 391
           + L   LK  N
Sbjct: 61  SSLNSMLKTGN 71

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQR--HFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           +C  C + F R    KRHL +H+ ++  H   P C     R D L +HM+  HT      
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT-HTGQSQRR 76

Query: 387 LKKNNI 392
           LKK+++
Sbjct: 77  LKKSSV 82

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 328 HQCQF--CEKSFKRKSWLKRHLLSHSQQ 353
           H C F  C KSF R   LKRH+ +H+ Q
Sbjct: 45  HHCAFPGCGKSFSRSDELKRHMRTHTGQ 72

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC----LSRQKRKDNLLQHMK 376
           H C  C   F RKS L+RHL+SHS ++ F C +C     +RQ+ K + + H K
Sbjct: 108 HSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFCDKGLTTRQQLKRHEITHSK 160

>TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {ON}
           Anc_4.189 YGR044C
          Length = 660

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHF-----LCPWCLSRQKRKDNLLQHMKLKH 379
           R  ++C  C ++F       +H+ S   +R +     LCPW +    R+ +L +H  ++H
Sbjct: 508 RGYYKCTHCPETFASIFEYAKHMDSFGIRREYKCPFELCPWKILGLPRRSDLRRHCAIQH 567

Query: 380 TNYLLDELKK 389
            + L D LKK
Sbjct: 568 KDELSDTLKK 577

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           I+ C+ C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L
Sbjct: 423 IYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 307 PPSNSVALHALPTSSSTHRYI--HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSR 364
           P S  V     P  +   R +  H+C +C + F + + L+ H+ SH   + F+C +C  R
Sbjct: 570 PKSELVGGVEKPKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKR 629

Query: 365 QKRKDNLLQHMKL 377
             +  NL  H +L
Sbjct: 630 FTQGGNLRTHERL 642

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           C +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           TH  +H       C  C+K F RK  L  HL++H + + F+C
Sbjct: 638 THERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 679

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQR--HFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           +C  C + F R    KRHL +H+ ++  H   P C     R D L +HM+  HT      
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT-HTGQSQRR 76

Query: 387 LKKNNI 392
           LKK++I
Sbjct: 77  LKKSSI 82

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 328 HQCQF--CEKSFKRKSWLKRHLLSHSQQ 353
           H C F  C KSF R   LKRH+ +H+ Q
Sbjct: 45  HHCAFPGCGKSFSRSDELKRHMRTHTGQ 72

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           +C  C + F R    KRHL +H+ ++   C  P C     R D L +HM+  HT      
Sbjct: 18  RCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRT-HTGQSQRR 76

Query: 387 LKKNNI 392
           LKK+ I
Sbjct: 77  LKKSGI 82

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
           R   QC  C K   R S LK H L H+    F CPW  C      K N+L+H K
Sbjct: 295 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK 348

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELK 388
           +C  CE++F +KS L+RH+ +HS  + F C +C      K  L +H ++ HT     E +
Sbjct: 87  KCDHCERTFAKKSHLERHMFTHSDNKPFHCSYCGKGVTTKQQLKRH-EITHTKSFKCEYE 145

Query: 389 KNNIIF 394
             N  F
Sbjct: 146 GCNECF 151

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           I+ C  CEK F R   L+ HL +H+ +R F+C  C     R+ +  +H  L
Sbjct: 419 IYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 319 TSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           T  ST  YI  C+ C K+F R   LK HL +H+ ++ F+C  C     R+ +  +H  L
Sbjct: 573 TRQSTGGYI--CELCNKTFTRPYNLKSHLRTHTNEKPFICKICNKAFARQHDRKRHEDL 629

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           C  C + F R   LKRH  SH++++ +LC +C     RKD +L+H
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRH 68

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           +QCQ+C K F +   L+ H   H+ ++ + C  C  R  RK NL  H+
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNLAAHV 568

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%)

Query: 307 PPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQK 366
           PPSN +         S     H+C++C + F + + L+ H+ SH   + + C +C  +  
Sbjct: 472 PPSNEIVGGVEKPFGSHGVKQHECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFT 531

Query: 367 RKDNLLQHMKL 377
           +  NL  H +L
Sbjct: 532 QGGNLRTHERL 542

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTNYLLDEL 387
           C  C K F+R    KRH+ +H+ ++   C +  C+ +  R D L +H+K+ H N   +  
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI-HVNKKKNRA 73

Query: 388 KKNNII 393
            KN I+
Sbjct: 74  SKNRIM 79

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 52/121 (42%), Gaps = 7/121 (5%)

Query: 261 LQQNAPSSLNLNINPAQPLHLPPGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHAL--- 317
           L   A S+  +++   +P  +PP + +  +   H  A S   S     SNS A  +    
Sbjct: 186 LSMVATSNTTIDVCQNRPKSVPPKYSI--ISGVHEDANSRTKSEPGTTSNSSAAFSDWKN 243

Query: 318 PTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHM 375
            +  S+ +   QC  C K   R S LK H L H+    F C W  C      K N+L+H+
Sbjct: 244 GSRISSAKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHL 303

Query: 376 K 376
           K
Sbjct: 304 K 304

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMK 376
           +CQFC + F R    KRH+ +H+ ++  +C  P C     R+D L +H++
Sbjct: 22  RCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIR 71

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 381
           H C  C+++F R     RH+  H+ ++   C  P C+ R  R D L +H ++ HTN
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           + C+ C K FKR S L  H+  H+  + ++CP+  C      K N+L+H KL
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 315 HALPTSSSTHRYIHQ-CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNL 371
           H  P   S++R     C+ C K FKR S L+ H++ H+  + + C    C  R   K N+
Sbjct: 235 HKCPKRCSSYRKSGSICEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNM 294

Query: 372 LQHMK 376
           L+HM+
Sbjct: 295 LRHMR 299

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 381
           ++ C+ C+K F R   LK HL +H+ +R F C  C     R+ +  +H  L HT 
Sbjct: 407 VYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL-HTG 460

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQH 374
           +CQFC K F +   L+ H   H+ ++ + C  C  R  RK NL  H
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH 546

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 303 SVAAPPSNSVALHALPTSS-STHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           S+A+P S+     + P  +    +  H+C +C   F + + L+ H+ SH   + F C +C
Sbjct: 446 SMASPMSSQSPNESFPAQTPQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQFC 505

Query: 362 LSRQKRKDNLLQHMKL 377
             R  +  NL  H +L
Sbjct: 506 GKRFTQGGNLRTHQRL 521

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 323 THRYIHQ------CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQH 374
           TH+ +H       CQ C K F RK  L  H L+H + + FLC    C     +  N+  H
Sbjct: 517 THQRLHTGEKPYACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNH 576

Query: 375 MKLKHTNYLLD 385
               H+  +L+
Sbjct: 577 QNRFHSQTVLE 587

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKK 389
           C +C K F   S L+ H+ +H+ ++   C  C  R     NL +HMK+    Y+    K+
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHERKYMCKLCKR 633

Query: 390 N 390
           +
Sbjct: 634 S 634

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 327 IHQC---QFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           + QC   + C   F R+  L RH+  H+ ++ F C  CL    R DNL QH +  H
Sbjct: 14  LFQCTGYKECSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVH 69

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 325 RYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMK 376
           R   QC  C K   R S LK H L H+    F C W  C      K N+L+H+K
Sbjct: 98  RLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 12/88 (13%)

Query: 305 AAPPSNSVALHALPTSSSTHRYI---------HQCQFCEKSFKRKSWLKRHLLSHSQQRH 355
            A PS ++     PT+++ +  +         H C  C ++F R     RH+ +H+ ++ 
Sbjct: 7   GAKPSKNIPNSTRPTAATANNTVAKPKEKPRPHVCPICNRAFHRLEHQTRHMRTHTGEKP 66

Query: 356 FLC--PWCLSRQKRKDNLLQHMKLKHTN 381
             C  P C+ +  R D L +H ++ HTN
Sbjct: 67  HECDFPGCVKKFSRSDELTRHRRI-HTN 93

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 324 HRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWC 361
           H  ++ C  C+K F R   LK HL SH+ +R ++C  C
Sbjct: 465 HPAVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVC 502

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 310 NSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKD 369
           +++ L+ +  S    R++  C+ C ++F R   L+RH  SH+ ++ + C  C     R+D
Sbjct: 59  DNLKLNGVTPSGKPRRFV--CKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRD 116

Query: 370 NLLQHMKLKH 379
            LL+H    H
Sbjct: 117 LLLRHALKTH 126

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query: 271 LNINPAQPLHLP--PGWKVNTMPQPHPAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIH 328
           + I+  + +++P  P   ++  P     +PSN  SV +    S++L++     +   ++ 
Sbjct: 49  MTIDAKKFVYIPETPASAISGTPSSDMKSPSNR-SVGS----SLSLYS--NQKTMGEFV- 100

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW----CLSRQK--------RKDNLLQHMK 376
            C +C+  F+ + +L RH+  H+ Q+ F CP+      S+ K        R+D    H+K
Sbjct: 101 -CHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHLK 159

Query: 377 LKHTNY 382
           ++H  Y
Sbjct: 160 IRHFMY 165

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 14/98 (14%)

Query: 297 APSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHF 356
            P++  S+   P +         SS T  YI  C +C+  F+ + +L RH+  H++++ +
Sbjct: 175 TPASKKSIDESPLSDEVQGIADESSETLPYI--CHYCDARFRIRGYLTRHIKKHAKRKAY 232

Query: 357 LCPW---CLSRQ---------KRKDNLLQHMKLKHTNY 382
            CP+    +S++          R+D    H+K +H  Y
Sbjct: 233 HCPFFDNSISQELRCHTSGGFSRRDTYKTHLKSRHFTY 270

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           C  C + F R+  LKRH  SH++++ +LC +C     R+D +L+H +  H
Sbjct: 106 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLH 155

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKL 377
           ++C++C K F+R S LK HL  H+  + F CP   C      + N+L+H KL
Sbjct: 714 NKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKL 765

>KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 296

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 13/96 (13%)

Query: 295 PAAPSNHPSVAAPPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQR 354
           PA+P++     +  +   AL     S +  +   QC FC  SFK K +L RH+  H   +
Sbjct: 148 PASPASSTECGSAGAKPAAL-----SGAAMQQPFQCAFCPSSFKVKGYLTRHMKKHLVTK 202

Query: 355 HFLCPW------CLSRQK--RKDNLLQHMKLKHTNY 382
            F CP+      C +  +  RKD    H+K  H  Y
Sbjct: 203 DFQCPFWSEDCRCHASGEFSRKDTYKTHLKSVHFVY 238

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKL 377
           +C  C + F R    KRH+ +H+ ++  LCP   C     R D L +HMK+
Sbjct: 17  KCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQR--HFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386
           +C  C + F R    KRHL +H+ ++  H   P C     R D L +HM+  HT      
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT-HTGQSQRR 76

Query: 387 LKKNNI 392
           LKK ++
Sbjct: 77  LKKASV 82

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%)

Query: 328 HQCQF--CEKSFKRKSWLKRHLLSHSQQ 353
           H C F  C KSF R   LKRH+ +H+ Q
Sbjct: 45  HHCAFPGCGKSFSRSDELKRHMRTHTGQ 72

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + F+C +C  R  +  NL  H +L
Sbjct: 594 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 643

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           C +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 624 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 669

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           TH  +H       C  C+K F RK  L  HL++H + + F+C
Sbjct: 639 THERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 680

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           H+C+FC   F +   LK H   H+ ++ F C  C  +  RK NL  H+
Sbjct: 279 HKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEICNKKFSRKGNLASHI 326

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 306 APPSNSVALHALPTSSSTHRYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQ 365
           +PPS    +       ST R   QC FC K F + S  + H+ SH   +   C +C    
Sbjct: 230 SPPSTDAGMGKKSRRRSTARQT-QCSFCLKVFNQASHFEVHIRSHIGYKPHKCRFCNVCF 288

Query: 366 KRKDNLLQHMKL 377
            +  NL  H KL
Sbjct: 289 TQSGNLKTHEKL 300

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 9/80 (11%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 376
           TH  +H      +C+ C K F RK  L  H+ +H++ R  +C +     K+    L +MK
Sbjct: 296 THEKLHTSEKDFECEICNKKFSRKGNLASHIATHNRLRLHICKF--DHCKKSFTQLGNMK 353

Query: 377 LKHTNYLLDELKK-NNIIFN 395
             H  +  + + + +NI+ N
Sbjct: 354 AHHNKFHRETMARLSNILLN 373

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYL 383
           C  C + F R+  LKRH  +H++++ F+C +C     R+D +++H    H + L
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLHFDIL 96

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + FLC  C  R  +  NL  H +L
Sbjct: 562 HECPYCHRFFTQSTHLEVHVRSHIGYKPFLCECCGKRFTQGGNLRTHQRL 611

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQH 374
           TH+ +H      +C+ C K F RK  L  H+++H + + F+C    C     +  N+  H
Sbjct: 607 THQRLHTGEKPYECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAH 666

Query: 375 MKLKHTNYL 383
               H N L
Sbjct: 667 QNRFHLNTL 675

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCP--WCLSRQKRKDNLLQHMKL 377
           + C  C K FKR S L  H+  H+ Q+ + CP   C      K N+L+H KL
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKL 377
           H+C +C + F + + L+ H+ SH   + F+C +C  R  +  NL  H +L
Sbjct: 583 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 632

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHM 375
           C +C K F +   L+ H   H+ ++ + C  C  +  RK NL  H+
Sbjct: 613 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 658

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 323 THRYIH------QCQFCEKSFKRKSWLKRHLLSHSQQRHFLC 358
           TH  +H       C  C+K F RK  L  HL++H + + F+C
Sbjct: 628 THERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVC 669

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%)

Query: 330 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKH 379
           C  C + F R+  LKRH  SH++++ +LC +C     R+D +L+H +  H
Sbjct: 38  CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLH 87

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 317 LPTSSSTHR---YIHQ-CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLL 372
           LP+ +S++R   ++ + C  C KSF R+S L+ HLL H+  + F C +C      K NL 
Sbjct: 152 LPSQTSSNRGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLN 211

Query: 373 QHMKL 377
           +H ++
Sbjct: 212 RHERI 216

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 329 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKL 377
           QC  C K   R S L+ H+  H+ +R FLC W  C  R   K N+++H +L
Sbjct: 275 QCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRL 325

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTN 381
           H C  C+++F R     RH+ +H+ ++   C  P C+ R  R D L +H ++ HTN
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,446,946
Number of extensions: 1352121
Number of successful extensions: 7009
Number of sequences better than 10.0: 613
Number of HSP's gapped: 6864
Number of HSP's successfully gapped: 770
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)