Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.2252.532ON25425411171e-156
Smik_13.2482.532ON2552558781e-119
YMR069W (NAT4)2.532ON2852558311e-112
Suva_13.2442.532ON2572587437e-99
KAFR0A018502.532ON2562673362e-37
NCAS0D026402.532ON2602232803e-29
CAGL0K02981g2.532ON2782082501e-24
TDEL0A030602.532ON2442192296e-22
Kpol_1018.342.532ON2922092291e-21
NDAI0I022702.532ON2772252281e-21
TPHA0C041802.532ON2642182271e-21
SAKL0A09460g2.532ON2402482155e-20
KNAG0C058202.532ON2711431991e-17
ZYRO0B01980g2.532ON1881541924e-17
KLTH0D06820g2.532ON2601751832e-15
TBLA0G022202.532ON2781391833e-15
Kwal_26.80162.532ON2401541374e-09
TDEL0C022407.322ON120192800.14
Ecym_72562.532ON243166760.27
Smik_7.263.554ON91046730.85
ZYRO0F11110g7.322ON120169712.0
YGL233W (SEC15)3.554ON91046659.8
NOTE: 2 genes in the same pillar as Skud_13.225 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532 KLLA0E18569g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.225
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   434   e-156
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   342   e-119
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   324   e-112
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   290   7e-99
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   134   2e-37
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   112   3e-29
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   100   1e-24
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    93   6e-22
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    93   1e-21
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...    92   1e-21
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    92   1e-21
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...    87   5e-20
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    81   1e-17
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    79   4e-17
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    75   2e-15
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    75   3e-15
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    57   4e-09
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    35   0.14 
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    34   0.27 
Smik_7.26 Chr7 (53924..56656) [2733 bp, 910 aa] {ON} YGL233W (REAL)    33   0.85 
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    32   2.0  
YGL233W Chr7 (59122..61854) [2733 bp, 910 aa] {ON}  SEC15Essenti...    30   9.8  

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  434 bits (1117), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 222/254 (87%)

Query: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYN 60
           MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYN
Sbjct: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYN 60

Query: 61  LHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN 120
           LHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN
Sbjct: 61  LHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN 120

Query: 121 GALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEGV 180
           GALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHV                  CEGV
Sbjct: 121 GALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEGV 180

Query: 181 ARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRXXXXXXXXXXXXXXTRHGRKRVVV 240
           ARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCR              TRHGRKRVVV
Sbjct: 181 ARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRAPGSPAPAAPALRPTRHGRKRVVV 240

Query: 241 ARDPLYYVYCLHMP 254
           ARDPLYYVYCLHMP
Sbjct: 241 ARDPLYYVYCLHMP 254

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  342 bits (878), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/255 (66%), Positives = 191/255 (74%), Gaps = 1/255 (0%)

Query: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPE-ENGEVDSIDGPQCTNY 59
           MF +FL IC+ +FPETLEYT ++ N    TTTVLKRE+++IPE ++   D+I+ P C NY
Sbjct: 1   MFHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNY 60

Query: 60  NLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG 119
            LHKS G+H+LDSCVQL+DEHLG KYRRASRTMYGNR PWKANKLAEMKS  L+YVSYW 
Sbjct: 61  RLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWD 120

Query: 120 NGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEG 179
           NGAL AFASFMLTEETGLVEGDAAHEVSVPVIYLYE+HV                  CEG
Sbjct: 121 NGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEG 180

Query: 180 VARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRXXXXXXXXXXXXXXTRHGRKRVV 239
           VAR VR +  +FFGVALTVF DNTRARRLYEA+GF R              TRHG +RVV
Sbjct: 181 VARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPAAGAPTTRPTRHGGERVV 240

Query: 240 VARDPLYYVYCLHMP 254
           V RDPLYYVYCLHMP
Sbjct: 241 VPRDPLYYVYCLHMP 255

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  324 bits (831), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 189/255 (74%), Gaps = 2/255 (0%)

Query: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGE-VDSIDGPQCTNY 59
           MF+ FL++C+++FPE++E+ +++ N    TT +L+REI+YIPE++ + +DS+D  +C NY
Sbjct: 32  MFQHFLNLCVEKFPESIEHKDTDGNGNF-TTAILEREIIYIPEDDTDSIDSVDSLKCINY 90

Query: 60  NLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG 119
            LHKS GD VLD+CVQL+D+HLG KYRRASR MYGNR PWKANKLAEMKSAGL+YV YW 
Sbjct: 91  KLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD 150

Query: 120 NGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEG 179
           NG LGAF SFMLTEETGLVEGDA HEVSVPVIYLYE+HV                  C+G
Sbjct: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210

Query: 180 VARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRXXXXXXXXXXXXXXTRHGRKRVV 239
           VAR  RR+  +FFGVALTVF DNTRARRLYEA+GF R              TRHG  RVV
Sbjct: 211 VARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGGGRVV 270

Query: 240 VARDPLYYVYCLHMP 254
           V  DPLYYVYCLHMP
Sbjct: 271 VPCDPLYYVYCLHMP 285

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  290 bits (743), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 171/258 (66%), Positives = 195/258 (75%), Gaps = 7/258 (2%)

Query: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYN 60
           MF++FLSIC++EFP+TL+YT S++     TTT+L+R++MY+PE++G+   ID P+C NY 
Sbjct: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYK 60

Query: 61  LHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN 120
           LHK+ GD  L SCVQLVDEHLG KYRRASRTMYGNR+PWKANKLAEMKSAGL+YV YWGN
Sbjct: 61  LHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGN 120

Query: 121 G-----ALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXX 175
                 ALGAFASFMLTEETGLVEGD AHE SVPVIYLYE+H                  
Sbjct: 121 DAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHX--XHRGRGLGRRLLAKA 178

Query: 176 XCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRXXXXXXXXXXXXXXTRHGR 235
            CEGVA RVRR   D FGVALTVFGDNTRARRLYE+                        
Sbjct: 179 LCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXXXXXG 238

Query: 236 KRVVVARDPLYYVYCLHM 253
           +   VARDPLYYVYCL +
Sbjct: 239 RAAAVARDPLYYVYCLRL 256

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  134 bits (336), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 127/267 (47%), Gaps = 30/267 (11%)

Query: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIP---EENGEVDSIDGPQCT 57
           +F  FL I  DEFP+ L     N          LKR+I+YI    EEN E DS+   Q  
Sbjct: 6   IFNGFLKIVSDEFPKELRTKGQN----------LKRKILYIASEDEENKESDSVINEQDD 55

Query: 58  NYNLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSY 117
                +  G  +LDS ++++D +LG+KY + SR +Y N   WK NKL EMKS GL+YVSY
Sbjct: 56  LTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSY 115

Query: 118 WGNGA----LGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXX--XXXXXXXX 171
           W   A       F SFMLTEE  +V  D   + S  VIYLYEI +               
Sbjct: 116 WKEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIK 171

Query: 172 XXXXXCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIG--FCRXXXXXXXXXXXXX 229
                C+    ++R       G+ LTVF DN RA + YE IG  F               
Sbjct: 172 GLSNVCQIAQVKIRPA-FPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR 230

Query: 230 XTRHG--RKRVVVARDPLYYVYCLHMP 254
            TR    RK + V R P+YY+  L++P
Sbjct: 231 KTRTSVNRKTLKVVRKPIYYL--LYLP 255

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 105/223 (47%), Gaps = 25/223 (11%)

Query: 2   FKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNL 61
           F+ F  + ++EFP TLE T   +         LKR+I+ I  +N      +         
Sbjct: 4   FEAFSHMILEEFPLTLEVTLQEQ------LKCLKRKILIIEPDNC-TSGKNSQDVVYMKC 56

Query: 62  HKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNG 121
               GD +LD  + ++D +LG+KY + S+ +Y N  PWK NKL EM+S GL+YVSYW   
Sbjct: 57  STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEE 116

Query: 122 ALGA--FASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEG 179
           +     F SFMLTEE G  E D      + V+YLYEI +                   E 
Sbjct: 117 SDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQI----LPSLRNRKLGTRLLAEH 168

Query: 180 VARRVRRVRCD--------FFGVALTVFGDNTRARRLYEAIGF 214
           +     R+R +          G+ LTVF DN  A + Y++IG 
Sbjct: 169 LQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGM 211

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 92/208 (44%), Gaps = 25/208 (12%)

Query: 62  HKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG-- 119
           H     ++L S ++L+D++LG KY  +S+ MYGN+ PWK NK+ EM + G++YVSYW   
Sbjct: 71  HIKESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKV 130

Query: 120 ---NGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXX 176
              +     F SFMLTEE  L   D        VI+LYEI +                  
Sbjct: 131 DDEHTVPLLFLSFMLTEEENLTHNDPVSS----VIFLYEIQISKELRKQGLGQYFLSNCL 186

Query: 177 CEGVARRVR----RVRCDFFGVALTVFGDNTRARRLYEAIGFCRXXXXXX---------- 222
            +   R +      +   F G+ LTVF DN  A  LY+ +G                   
Sbjct: 187 FQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRR 246

Query: 223 -XXXXXXXXTRHGRKRVVVARDPLYYVY 249
                     ++   R+++ + PLYY+Y
Sbjct: 247 RTRNSRKINNKNESPRILIKK-PLYYMY 273

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 92.8 bits (229), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 101/219 (46%), Gaps = 24/219 (10%)

Query: 15  ETLEYTESNENATVVTTTV-LKREIMYIPEENGEVDSIDGPQCTNYNLHKSHGDHVLDSC 73
           + ++Y   N   T+    + L R+++ I  E   V++    QC +Y       + +L   
Sbjct: 8   DVVKYANQNFPTTINAAGIQLTRKLLAIDTEEYPVET---DQCISYVHSPREAEKLLWQL 64

Query: 74  VQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG----------NGAL 123
           ++++DE+LG KY  +SR +Y N  PW+ NK  EM + GL+YV Y            N   
Sbjct: 65  LEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPF 124

Query: 124 GA--FASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCE--- 178
               F SFMLTEE GLV  D     +  V+YLYE+ +                   +   
Sbjct: 125 SPLLFLSFMLTEEDGLVADDPTEVWT--VLYLYELQLLPRVRRLGLAARLLGDHLAQCGR 182

Query: 179 ---GVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214
                +R  R  +  FFG+ LTVF DN  A RLYE++G 
Sbjct: 183 QLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGM 221

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 92.8 bits (229), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 98/209 (46%), Gaps = 10/209 (4%)

Query: 13  FPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNLHKSHGDHVLDS 72
           FPETLE    N  +T     VL R+++ I  +N ++D  +     +Y       D VL+ 
Sbjct: 15  FPETLELLNDNS-STSNQKKVLHRQLIAIDSKNNQIDVRNN--VLSYYKDNVKCDVVLNK 71

Query: 73  CVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGALGA--FASFM 130
            + ++D +LG  Y   S  +Y N  PWK NK+ EMKS GLLYV Y  +       F SFM
Sbjct: 72  LLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFM 131

Query: 131 LTEETGLV--EGDAAHEVS---VPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEGVARRVR 185
           +T++  LV    + ++E+S     VIYLYEI +                   + +    +
Sbjct: 132 ITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNK 191

Query: 186 RVRCDFFGVALTVFGDNTRARRLYEAIGF 214
             + +   + LTVF +N  A   Y+ IG 
Sbjct: 192 DYQKNIIALELTVFSNNINAINFYKKIGM 220

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 101/225 (44%), Gaps = 23/225 (10%)

Query: 5   FLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSID-GPQCTNYNLHK 63
            L+I  +EFP  L+  +          T  +R I + P  +     I+   +  N +   
Sbjct: 9   LLNIVCEEFPTILQSADG--------VTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDP 60

Query: 64  SHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGAL 123
                VL+  + ++D +LG KY + S+T+Y N   WK+NKL EM S GL+YVSYW     
Sbjct: 61  QQRSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120

Query: 124 GA--FASFMLTEETGLV-------EGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXX 174
               F SFMLTE  G +       + +  ++  + VIYLYEI +                
Sbjct: 121 EPLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSV 180

Query: 175 XXCEGVARRVRRVRCDFF-----GVALTVFGDNTRARRLYEAIGF 214
              +  +  V +   DF      G+ LTVF DN +A   Y++IG 
Sbjct: 181 HLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGM 225

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 92.0 bits (227), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 101/218 (46%), Gaps = 19/218 (8%)

Query: 4   KFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDS----IDGPQCTNY 59
           KF+ I    +P+ + Y   N        T L ++I+ +  E  ++ +     +G   T Y
Sbjct: 6   KFVKIVDSHYPDEI-YVNKN-------LTKLVKKIIVVDSETEDIKNSAELYNGRYLT-Y 56

Query: 60  NLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYW- 118
           + +K   +      + ++D +LGD Y   ++ +YGN  PWK NK+ EMK+ GL+YV Y  
Sbjct: 57  SQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHL 116

Query: 119 --GNGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXX 176
                 +  + SF LT+E+G +      +V  PVIYLYEI +                  
Sbjct: 117 EDEKKTVSLYLSFTLTKESGFL---PDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYL 173

Query: 177 CEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214
            + +      +  D  G+ LTVF DNT A R YE IG 
Sbjct: 174 KDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGM 211

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score = 87.4 bits (215), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 107/248 (43%), Gaps = 19/248 (7%)

Query: 5   FLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNLHKS 64
            L   +D FP ++         T+   ++  R+++ I E +  + +  G  CT ++  + 
Sbjct: 9   LLPYVLDSFPTSI---------TLKDGSLATRKVLVIDEPSSGI-APSGQVCT-WSGDRQ 57

Query: 65  HGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGALG 124
             + +L   ++++D +LG KYR  S T+YGN   W  NKL EM++ GL+YV Y+   +  
Sbjct: 58  SSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSPL 117

Query: 125 AFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEGVARRV 184
            F SF+LT+E   +         V V+YLYEI +                   +     +
Sbjct: 118 MFLSFLLTDEPDFLPD------PVKVVYLYEIQL-LPEVQGQRLGTQMLQVYLKNTVHSL 170

Query: 185 RRVRCDFFGVALTVFGDNTRARRLYEAIGFCRXX-XXXXXXXXXXXXTRHGRKRVVVARD 243
            R+     G+ LTVF DN  A  LY +IG                  TRH    +     
Sbjct: 171 SRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTRHSTTDLQTVSR 230

Query: 244 PLYYVYCL 251
           P YY+  L
Sbjct: 231 PDYYLMFL 238

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 81.3 bits (199), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 72/143 (50%), Gaps = 13/143 (9%)

Query: 74  VQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYW-GNGALGAFASFMLT 132
           ++++D +LG  Y R SR +YGN   W+ NK  EM SA L+YVSYW  +     + SFMLT
Sbjct: 87  LEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYWVSDSEPVLYTSFMLT 146

Query: 133 EETGLVEGDAAHEVSVPVIYLYEIH-VXXXXXXXXXXXXXXXXXXCEGVARRVRRVRCDF 191
           EE G+    ++ E +  V+YLYEI  +                  C   +  V       
Sbjct: 147 EENGI----SSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECALESPEVA------ 196

Query: 192 FGVALTVFGDNTRARRLYEAIGF 214
             VALTVF DN +A + YE + F
Sbjct: 197 -AVALTVFSDNEKALKFYERLNF 218

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 78.6 bits (192), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 75/154 (48%), Gaps = 20/154 (12%)

Query: 66  GDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG--NGAL 123
            D +L+  +QL++ +LG  Y + ++T+Y N   W++NK  EM S  L +VSYW   +  L
Sbjct: 17  NDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNEL 76

Query: 124 GAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEGVARR 183
             F S M  EE+ +VEG+ ++     +IYLYEIHV                   + +   
Sbjct: 77  VCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFG---------KSILNA 121

Query: 184 VRRVRCD---FFGVALTVFGDNTRARRLYEAIGF 214
           ++   C      G+ LTVF  N RA   Y   GF
Sbjct: 122 LKEKLCPKAHLSGIELTVFSSNERAINFYRNNGF 155

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 77/175 (44%), Gaps = 19/175 (10%)

Query: 42  PEENGEVDSIDGPQCTNYNLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYG-NRIPWK 100
           P    E DS+  P              +LD  + LV  +LG  Y R +R +YG  R  W 
Sbjct: 61  PTPASECDSVPRPPA-----------DLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWP 109

Query: 101 ANKLAEMKSAGLLYVSYWGNGALG-AFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVX 159
           A K AEM++ GL+YV Y  + +    F S +LT+E  L       E++  V+YL+EIHV 
Sbjct: 110 ARKRAEMETPGLVYVVYSDSHSQPLVFMSLLLTDEPEL-----GQELAARVLYLFEIHVS 164

Query: 160 XXXXXXXXXXXXXXXXXCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214
                              G    + R      G  LTVF +N RA RLY A+G 
Sbjct: 165 DIIRGQGLGTHLLRDC-LGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGM 218

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 72/139 (51%), Gaps = 8/139 (5%)

Query: 75  QLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG--NGALGAFASFMLT 132
           QL+DE+LG  Y++ S+ +Y N + W  NK  EM ++ ++Y++YW     ++  F S +  
Sbjct: 76  QLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSILSC 135

Query: 133 EETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEGVAR--RVRRVRCD 190
           EET ++E +   E    V+YLYEIH+                   E + +  ++ R   +
Sbjct: 136 EETYILENNDQGE----VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNN 191

Query: 191 FFGVALTVFGDNTRARRLY 209
           F G+ LTVF +N  A+  Y
Sbjct: 192 FIGLELTVFSENNDAQNFY 210

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 68/154 (44%), Gaps = 15/154 (9%)

Query: 69  VLDSCVQLVDEHLGDKYRRASRTMYGNRI-PWKANKLAEMKSAGLLYVSYWG-------N 120
           +L+  + LVD +LG  Y + ++ +YG++   WK  K  EM + GL+YV Y          
Sbjct: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111

Query: 121 GALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVXXXXXXXXXXXXXXXXXXCEGV 180
           G   AF S +LT+E  L    AA      V+YL EIHV                    G 
Sbjct: 112 GLPLAFLSLLLTDEPELGPAPAA------VVYLMEIHVADIIRGLGLGGTLLREGVA-GT 164

Query: 181 ARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214
            R  RR      G  LTVF DN  A RLY  +G 
Sbjct: 165 VRGARRAHPFIQGTELTVFTDNEGALRLYLRLGM 198

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 6/92 (6%)

Query: 66  GDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGALGA 125
           GDHV  S +Q + E+ GD     + T + +    +AN  +++ S  L Y      G   A
Sbjct: 715 GDHVKLSKMQAIAENRGDYASLVANTFFSDSASLRANVFSQLGSLPLAYAISKARGDKAA 774

Query: 126 FASFM----LTEETGLVEGDAAHE--VSVPVI 151
            ASF+    ++EE  ++  +++ +    VPV+
Sbjct: 775 AASFLEQAEISEEDVVLPDNSSTQGFAKVPVL 806

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 60/166 (36%), Gaps = 36/166 (21%)

Query: 78  DEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYW---GNGALGAFASFMLTEE 134
           D H    Y R +R+      PW+A+K AE++  G  +V Y      GA+  F S +  +E
Sbjct: 63  DVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDE 117

Query: 135 TGLVEGDA---------------------AHEVSVP-----VIYLYEIHVXXXXXXXXXX 168
                G+                      A E + P     V+Y+ EIHV          
Sbjct: 118 PHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQNQGLG 177

Query: 169 XXXXXXXXCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214
                      + + ++       G+ LTVF  N +A  LY   GF
Sbjct: 178 SCMLLCA--RQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGF 221

>Smik_7.26 Chr7 (53924..56656) [2733 bp, 910 aa] {ON} YGL233W (REAL)
          Length = 910

 Score = 32.7 bits (73), Expect = 0.85,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 102 NKLAEMKSAGLLYVSYWGNGALGAFASFMLTEETGLVEGDAAHEVS 147
           NK  E++   L+Y   W     GA+    L   TG   G A+HE+S
Sbjct: 333 NKEYELRKTKLIYPLIWKKNKTGAYQMDSLLRGTGTTSGPASHEIS 378

>ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 66  GDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNGALGA 125
           GD    S ++ + E+ GD +   S T Y N    +A   AE  S  L Y     +G   A
Sbjct: 715 GDTEKLSKMEAISENRGDIFDLISDTFYNNSTSTRARAFAEAGSLPLAYAVAKTSGDESA 774

Query: 126 FASFMLTEE 134
            ASF+  +E
Sbjct: 775 AASFLEQDE 783

>YGL233W Chr7 (59122..61854) [2733 bp, 910 aa] {ON}  SEC15Essential
           113kDa subunit of the exocyst complex (Sec3p, Sec5p,
           Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which
           mediates polarized targeting of vesicles to active sites
           of exocytosis; Sec15p associates with Sec4p and vesicles
          Length = 910

 Score = 29.6 bits (65), Expect = 9.8,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 20/46 (43%)

Query: 102 NKLAEMKSAGLLYVSYWGNGALGAFASFMLTEETGLVEGDAAHEVS 147
           NK  E++   L+Y   W      A+    L   TG   G  AH+VS
Sbjct: 333 NKEYELRKTKLMYPLIWKKNKTAAYQMDSLLRGTGTTPGSTAHDVS 378

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,895,959
Number of extensions: 856946
Number of successful extensions: 2077
Number of sequences better than 10.0: 22
Number of HSP's gapped: 2088
Number of HSP's successfully gapped: 22
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)