Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.1526.20ON1090109057230.0
Suva_13.1606.20ON1090109046890.0
Smik_13.1576.20ON1090109046080.0
YML002W6.20ON73773732510.0
TDEL0G044906.20ON1093109021670.0
ZYRO0C07810g6.20ON1099107820530.0
Sklu_YGOB_Anc_6.20b6.20ON1088109718730.0
NCAS0H008206.20ON1146112216740.0
CAGL0L07634g6.20ON1130108416700.0
Kpol_1037.256.20ON1105108216290.0
Ecym_30246.20ON1079108916220.0
ACR006C6.20ON1071107415830.0
Sklu_YGOB_Anc_6.20singletonOFF84986215630.0
Kwal_56.224246.20ON1089110515610.0
KLTH0C11242g6.20ON1097110915330.0
TPHA0J003306.20ON1107110615070.0
KNAG0M011606.20ON1131113814780.0
NDAI0D008006.20ON1193119314540.0
YML003WsingletonOFF29028913171e-174
KLLA0D01133g6.20ON1067110512951e-160
TBLA0A072606.20ON1204121411121e-132
KAFR0L004006.20ON9428458451e-96
Kwal_56.230843.270ON762236791.1
TBLA0D043301.424ON26675734.3
KLLA0D10263g8.876ON43781727.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.152
         (1090 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...  2209   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...  1810   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...  1779   0.0  
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...  1256   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   839   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   795   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   726   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   649   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   647   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   632   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   629   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   614   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   606   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   605   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   595   0.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   585   0.0  
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   573   0.0  
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   564   0.0  
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   511   e-174
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   503   e-160
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   432   e-132
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   330   1e-96
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   1.1  
TBLA0D04330 Chr4 complement(1072027..1072827) [801 bp, 266 aa] {...    33   4.3  
KLLA0D10263g Chr4 complement(868131..869444) [1314 bp, 437 aa] {...    32   7.8  

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 2209 bits (5723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1076/1090 (98%), Positives = 1076/1090 (98%)

Query: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60
            MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL
Sbjct: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60

Query: 61   PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120
            PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR
Sbjct: 61   PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120

Query: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180
            QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS
Sbjct: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180

Query: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240
            NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM
Sbjct: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300
            KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300

Query: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360
            KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE
Sbjct: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360

Query: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420
            LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL
Sbjct: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420

Query: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480
            EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG
Sbjct: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480

Query: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540
            QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI
Sbjct: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540

Query: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600
            GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI
Sbjct: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600

Query: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660
            FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK
Sbjct: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660

Query: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720
            LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK
Sbjct: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720

Query: 721  IGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTIQGLLRSILKD 780
            IGERGARDSLFGLVYLHSLRYH              DKPFLTTVINMKTIQGLLRSILKD
Sbjct: 721  IGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTIQGLLRSILKD 780

Query: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
            NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA
Sbjct: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900
            SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI
Sbjct: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900

Query: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960
            FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC
Sbjct: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960

Query: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020
            TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE
Sbjct: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020

Query: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080
            TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT
Sbjct: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080

Query: 1081 TNIGIFQEYI 1090
            TNIGIFQEYI
Sbjct: 1081 TNIGIFQEYI 1090

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1810 bits (4689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1090 (81%), Positives = 977/1090 (89%)

Query: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60
            MS+YHLPTLLNPLINAIFNCPEPEKSPLKKLFANL+TRRFILLAPP   LLNYHDVKTKL
Sbjct: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60

Query: 61   PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120
            PLHELCYN DFINSHILLTTENSY+NTTLRD HYETLDGK VV+QWKNN+IH LNGFP+R
Sbjct: 61   PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120

Query: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180
            +RLKIL+TK+LPNFNDYF+GA  FAIL+IDQPL CE  PNDYL CF+SYEE  K A++  
Sbjct: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180

Query: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240
            NL +++ + ERSSF+NILHIH A L QLGQLFSNYRR A NDDPSKKMFE++V+Q+FDGM
Sbjct: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300
            KSDSLFKNFSNLYDLIHDYFELNLY+DIWSRL  HFKGYEV+TE  +YFSVNQLL D++S
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300

Query: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360
            KDF+ FKLSDITFIERRV+VASKHFQKL L+HSYAEKSKILVETLQ LSG T++ SH+ +
Sbjct: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360

Query: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420
            L NG N+LTMDADTL+SLFVLVVCRSEQKH++SHLYYLQNFSNN SS+KFGILGYAISTL
Sbjct: 361  LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAISTL 420

Query: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480
            EAVVCYFE+F+KNN N+AKAN+   KTR+LLDKLS ENPTNE+ +LATY+D L YRNEQG
Sbjct: 421  EAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG 480

Query: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540
            QSILS+CITN KN ILLDVL+EYE LFP+EDILEDET+DGSTLLIESIK GN+EA KILI
Sbjct: 481  QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI 540

Query: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600
             IML NC++ ELV+YVNK DKYAR+VAHYLTHEMDILKSIGSY++WK+KNSSGQTPLFSI
Sbjct: 541  RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI 600

Query: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660
            FR+YDQPNYEEMVK+AFNIA+SWYQ+HN+SF Y DHTD+KGNSLLH+LK+DVSILLQL+K
Sbjct: 601  FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK 660

Query: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720
            L+ING NYKGLTPLM+YVKYKR+SNIDAITKD RLILEKVQNSTFFTCFDYAKD  VLSK
Sbjct: 661  LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK 720

Query: 721  IGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTIQGLLRSILKD 780
            IGERGA DS+FGL+YLHSLRYH              ++PF+T VINMKTIQGLLRSI+KD
Sbjct: 721  IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD 780

Query: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
            N FTFLP+++YID ISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA
Sbjct: 781  NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900
            SVLYWMRINTS+RNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEI SFKASLNILRKILI
Sbjct: 841  SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI 900

Query: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960
            FLSLKS+DFED Y SL +MG K+ NG+AADAF  I  NH MFSDL+L ELLEHV FLE+C
Sbjct: 901  FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC 960

Query: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020
            TIQL   +QTILFD+I  WWKHYGEFL L KNYRKAFPS VKPKS   T SHIPLG FIE
Sbjct: 961  TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE 1020

Query: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080
            TKREQSEQRL+VQIKASSKILKELGSEIF+AHE LAEELSNYMEFRKACLDQRTIVAFA 
Sbjct: 1021 TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI 1080

Query: 1081 TNIGIFQEYI 1090
             NI + QE I
Sbjct: 1081 KNISVLQECI 1090

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1779 bits (4608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 850/1090 (77%), Positives = 965/1090 (88%)

Query: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60
            MS+ HLPTLLNPLINAIFNCPEPEKSPLKKLFA LKT RFILLAPP  +LLNYHDVKTKL
Sbjct: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60

Query: 61   PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120
            PLHELCYN +FINSHILL TENS++NT  RDSHYETLDGK VVIQWKNN+IHALNGF +R
Sbjct: 61   PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120

Query: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180
            +RLKIL TK+LPNFNDYFEGA DF I++I+QPL+CE  PNDYL+CF SY+++PK+  SV 
Sbjct: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180

Query: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240
            NL ++S +QERSSF+NILHIH  RL QLG++FSNYR LAP+DDPS+K+FE IVQQ+F+GM
Sbjct: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300
            KSDSLFK F NLYDLIH+YFELNLYDDIWSRL +HFK YEV TE+YKYFS+N LLADF+S
Sbjct: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS 300

Query: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360
            KDF+EFKL D+TFIE+RV++ASKHFQKLTLTHSY EKSKILVETLQ+LSG T++ SHQ +
Sbjct: 301  KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD 360

Query: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420
            +P  LN+L MDADTL+SLFVLV+CRSEQKHLKSHLYYLQNFSNN SS+KFGILGYA+STL
Sbjct: 361  VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTL 420

Query: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480
            EAVVCYFEDF KN++N+AKANV  QKT+ L++ LS EN TN++ENLATY+D L YRN QG
Sbjct: 421  EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG 480

Query: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540
            QSILSICI+N KN ILLD+L+EY+ +FP+ED+LEDET+DGSTLLIESIK+GN+EAAKILI
Sbjct: 481  QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI 540

Query: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600
             IM+LNC+E EL+SY+N+ DKY+RTVAHYLTHE+DILKSIG+YVDWKRKNS GQTPLFSI
Sbjct: 541  RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI 600

Query: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660
            FR+YDQPNYE MVKIAFNIAN+WY+K N SFDY DHTD+KGN LLH+LK+D SILLQL+K
Sbjct: 601  FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660

Query: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720
            LDING NYKGLTPLM+YVKYKR++NI+AI KD RL+LEK+Q STFFTCFDYAKDH+VLSK
Sbjct: 661  LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK 720

Query: 721  IGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTIQGLLRSILKD 780
            +GERGA+DSLFGL+Y HSLRYH              +KPF  TVINMKTIQGLLRSILKD
Sbjct: 721  VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD 780

Query: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
            N FTFLPLN YIDEIS L+RSD+TIIGKADV SLLHKL+NCFNVLLFLKKVP++LFTDEA
Sbjct: 781  NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA 840

Query: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900
            S+LYWMRINTSKRNQK PSK+N KTMEPEEINMIQSFLRFNFDEISSFKASL+ILRKILI
Sbjct: 841  SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI 900

Query: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960
            F+SLKSNDF+D  D+L EMG+ I N +AADAFA   TNHNMF+D +LA+LLEHV FLE+C
Sbjct: 901  FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC 960

Query: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020
            TIQLS  VQ IL +KI  WWKHYGE + L KNYRKAFPSVVKPKS TDT  HI LG FIE
Sbjct: 961  TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE 1020

Query: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080
            TKREQSEQRLAVQIK SSK LKELGSEIF AHEKLAEELSNYMEFRKACL+QR IVAFA 
Sbjct: 1021 TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA 1080

Query: 1081 TNIGIFQEYI 1090
            TNI + QE I
Sbjct: 1081 TNISVLQENI 1090

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score = 1256 bits (3251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/737 (81%), Positives = 666/737 (90%)

Query: 354  ISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGIL 413
            + SHQ ELP+GLN++TMDADTL+SLFVLVVCRSEQKHLKSHLYYLQNFSNN SSTKFGIL
Sbjct: 1    MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60

Query: 414  GYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNL 473
            GYA+STLEAVVCYFEDF+KN  N+AKAN   +KT+ LLDKLS ENPTNE+E+LATY+D L
Sbjct: 61   GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120

Query: 474  QYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNI 533
             YRNEQGQSILSICITN KN ILLD+L+EYE+ FP+ED+LEDET+DGSTLLIESIK GN+
Sbjct: 121  TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180

Query: 534  EAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSG 593
            EAAK+LI IML NC+E ELVSY+NK DKYARTVAHYLTHEMDILKSIG+Y+DWKRKNSSG
Sbjct: 181  EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240

Query: 594  QTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVS 653
            QTPLFSIFR+YDQPNYEEMVK AF+IAN+WY+KHNS FDYLDHTD+KGNSLLH+LK+++ 
Sbjct: 241  QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300

Query: 654  ILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAK 713
            ILLQL+KLDIN  NYKGLTPLM+YVKYKR+SNIDAITKD RLILEKVQNSTFFTCFDYAK
Sbjct: 301  ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360

Query: 714  DHSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTIQGL 773
            DHSVLSKIGERG +DSLFGL+Y HSLRYH              +KPF TTVINMKTIQGL
Sbjct: 361  DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420

Query: 774  LRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833
            LRSILKDN FTFLPLN+YIDEISHLNRSDLTIIGK DV SLLH+LTNCFNVLLFLKK+P+
Sbjct: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480

Query: 834  NLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLN 893
            NLFTDEAS+LYWMRINTSKRNQKP  K+NPKTMEPEEINMIQSFLRFNFDEISSFKASLN
Sbjct: 481  NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540

Query: 894  ILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEH 953
            ILRK+LIF++LKS+DFED Y  L EMGRK+IN EA+ AF  I TNHNMFS+L+LA LLE+
Sbjct: 541  ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600

Query: 954  VSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHI 1013
            V FLEQCTIQLS+FVQ ILF+KI  WWKHYGEFLAL K+YRKAFP++VKPKSA+DT S  
Sbjct: 601  VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660

Query: 1014 PLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQR 1073
            PLG FIETKREQSEQRLAVQIKASSK+LKELGSEIF AHE+LAEELSNYMEFRKACLDQR
Sbjct: 661  PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720

Query: 1074 TIVAFATTNIGIFQEYI 1090
            ++VAFATTNI + QE +
Sbjct: 721  SLVAFATTNISVLQECV 737

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1090 (40%), Positives = 684/1090 (62%), Gaps = 19/1090 (1%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            YHLP LLNPL+NA+FNCP P  S LKKLF+NLK R+FILL PP   LL+ +D  +  PL 
Sbjct: 3    YHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQ 62

Query: 64   ELCYNVDFINSHILLTTE-NSYLNTTLRDSH--YETLDGKAVVIQWKNNIIHALNGFPIR 120
            ELCY+ +F+ SH+LL  E N+   TT   S   ++TL+GK V+++ +N II   +GF ++
Sbjct: 63   ELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVK 122

Query: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180
            +R  I +T +  NFN+Y      F IL ID+P+  E      ++   +     +  +  S
Sbjct: 123  KRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGS 182

Query: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240
            +  ++S +  +SSFDNIL IH     +  +LF+ YR     DDP  ++F DI+++++  M
Sbjct: 183  SPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAM 242

Query: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300
            +SD+LF +  +L DLI+DY ELNLYDDIW R+  HFK  EV++   +Y S++QL    + 
Sbjct: 243  RSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYP 302

Query: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360
              F+EF L  +  +E  + +A   F +L L H++A+K+  L++TL+ LS    +    QE
Sbjct: 303  DKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS---RVDKSIQE 359

Query: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420
            +    + + + ADTLLSLFVLV+CR++ ++LK  L+YLQNF+ N +S  FG+LGYAISTL
Sbjct: 360  V----SPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTL 415

Query: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480
            EA VCYF++  K ++ +++     +  R L+DKLSSE+ +    NL  Y+  L YR EQG
Sbjct: 416  EAAVCYFDEL-KGSKKMSRLESECENARSLVDKLSSESSS---VNLIHYQKTLSYRTEQG 471

Query: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540
            +S+LSICI N KN IL ++L++ E  FP+EDILED+T +G TLL++S+K GN +AA +++
Sbjct: 472  ESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIV 530

Query: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600
             ++  +C++ E+ +Y N++DK  RT AHYLTHE++IL+ IG++ DW  K+SSG T LF+I
Sbjct: 531  DLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTI 590

Query: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660
            FR+YDQPNY++M++ +F  A  WY      F +  H D K N+LLHILK  +SILL+   
Sbjct: 591  FRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYES 650

Query: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720
            +D+N RN KGLTPLM+Y KY R+ N  +I  D R+IL K+Q+       DYAK+  +L +
Sbjct: 651  VDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHE 710

Query: 721  IGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTIQGLLRSILKD 780
            I ++ A D+ FG  ++H+L+Y                  F T   ++KT+Q   R++L+ 
Sbjct: 711  IAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRT 770

Query: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840
               TFLPL+S +++++ L ++ L+ IGK +    L  LTNCFNVL+  +++P+++  +E+
Sbjct: 771  CPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANES 830

Query: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900
             +L W+++   K  +   +    K +EPEE+++IQ FLRFN  E+S+ ++ L++++K+ I
Sbjct: 831  KLLSWIKVQY-KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAI 889

Query: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960
            FL LKS+D E + + L  +G + + G+        F+   ++ + ++  L+E +  + +C
Sbjct: 890  FLRLKSSDVEQSVELLLPLGSEGM-GDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKC 948

Query: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020
            TI+L   +  +L  KI +WWK YGE L  +K Y + FP +VK    T T + I +G  +E
Sbjct: 949  TIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVK-NGETSTDAGI-IGKILE 1006

Query: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080
             K+E+ E+RL+  I  + + + + G+ I   HE LAE+LS +MEF+ A + +  I  +  
Sbjct: 1007 GKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVR 1066

Query: 1081 TNIGIFQEYI 1090
             NI   +E +
Sbjct: 1067 ENIKELKERL 1076

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1078 (40%), Positives = 658/1078 (61%), Gaps = 36/1078 (3%)

Query: 3    VYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPL 62
             YH+P LLNPL+N++FNC  P  S  KKLF  LKT RFILL PP   LL + D ++   +
Sbjct: 2    AYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSM 61

Query: 63   HELCYNVDFINSHILLTTENSY----LNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFP 118
            ++LC N DF+ SHILL  +++Y     N +   + Y+TL+ K V ++  +  I    GFP
Sbjct: 62   NDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFP 121

Query: 119  IRQRLKILETKVLPNFNDYFEGAADFAILFIDQPL-NCEVAPNDYLKCF--DSYEEVPKN 175
            +R+R +I   +++ NFNDY  G+  FA++ ID PL    +   D  +     ++  V   
Sbjct: 122  LRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDAK 181

Query: 176  AQSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQ 235
               V +L   S+    SSF+NIL +H      L   F+ YR     + P +++F  IV+Q
Sbjct: 182  GSLVRDLTQKSW----SSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQ 237

Query: 236  SFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLL 295
                M +D LF+   +LYDLI DY ELNL+DD+W R+V  ++  E+DTE  K+ S+N+L 
Sbjct: 238  VHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELE 297

Query: 296  ADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEIS 355
             + + K +++F+L D+T +E+ +++A   F  L LTH++AEK+  L+ TLQ LS   E  
Sbjct: 298  TELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQD 357

Query: 356  SHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGY 415
               Q LP     +TMDADTL+S FVLVVCR++ K++KSHL+YL+ FS + +S KFGILGY
Sbjct: 358  MDIQTLP-----ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGY 412

Query: 416  AISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQY 475
            AISTLEAVV YF+   K  + L K      K +EL   +S ++    + +++ +  NL++
Sbjct: 413  AISTLEAVVFYFDGL-KGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEF 471

Query: 476  RNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEA 535
            R  QG+S+LS CI N KN +L ++L  YED+FP+EDIL+DET+DGSTLLI+++K  N EA
Sbjct: 472  RTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEA 531

Query: 536  AKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQT 595
            A++++ ++  +C+E EL  YVN+ADK  RTVAHYLTHEM+IL+SIG Y++WK ++S+G T
Sbjct: 532  AQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHT 591

Query: 596  PLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSIL 655
            PLF+IFR YDQ NYE M+  AF  A  WYQ +   F + DH D+KGN+LLHI+K++VSIL
Sbjct: 592  PLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSIL 651

Query: 656  LQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDH 715
            L    +DIN  N KGLTPLMIY +Y R  N+  I +D R+IL+K+Q+ +F   FDYA++ 
Sbjct: 652  LDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNP 711

Query: 716  SVLSKIGERGARDSLFGLVYLHSLRYHXXX--XXXXXXXXXXXDKPFLTTVINMKTIQGL 773
             VL ++  +  + + F L ++H L+Y                 D+ + T  +++KT+Q L
Sbjct: 712  LVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNL 771

Query: 774  LRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQ 833
             + +LK +  +FLPL   ++++S+L +S +  I K +     + LT+CF+VLL    + +
Sbjct: 772  FQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK 831

Query: 834  NLFTDEASVLYWMR-----INTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSF 888
             L   E+ ++ W+R      N SK+ QK       K +EPEEI ++ SFLRFN  E+S+ 
Sbjct: 832  -LVLRESRLVSWIRSQDKKCNNSKKLQK------QKNVEPEEIGIMASFLRFNRGELSAV 884

Query: 889  KASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALA 948
            K  L  ++K+LIFL LK+ D   +Y  L   G +    +    F  +  N   F + A  
Sbjct: 885  KLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATM 944

Query: 949  ELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATD 1008
              +  ++FLE CT +L   V+ +L   I +WWK YG+ L + K Y++ FP++ +  S T 
Sbjct: 945  TFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTG 1004

Query: 1009 TPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFR 1066
                  + SF E KRE+ E +L+  +    K ++ +G  I + HE LAEELS YMEF+
Sbjct: 1005 I-----IASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFK 1057

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1097 (35%), Positives = 651/1097 (59%), Gaps = 41/1097 (3%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            YHLP LLNPL+N++FNCP P  SPLKK+FA+L+ +RFIL+ P +  LL+Y D+ T   L 
Sbjct: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123
            +LCY  +F+ +HI++  ++S  +    D  ++TL+GK V+I+ +N I+   +GFP ++R 
Sbjct: 63   DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118

Query: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183
            KI  T++  NFNDY +G+  F ++ ID+PL  +   ND L+ F         + + S+LP
Sbjct: 119  KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGV------RSTNTSSLP 172

Query: 184  VNS--YEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPND----DPSKKMFEDIVQQSF 237
            +++   ++E SSF+ +  +H     +   LF   R+    +    D     F+    ++F
Sbjct: 173  LSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAF 232

Query: 238  DGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEV----DTEKYKYFSVNQ 293
            + ++ +  F+N S L+  +H+Y ELNLYDDIW ++   ++  E+    D    KY +++Q
Sbjct: 233  ELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQ 292

Query: 294  LLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTE 353
            +   F+ +   +F L  +T  E+ +  A+  F++L  + S++EK+KI+++TLQ L+  +E
Sbjct: 293  VPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSE 352

Query: 354  ISSHQQELPNG-LNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGI 412
                    P+  +  +T+DADTL+ L VLVVCRS+ K+LKSHL+YLQNFS + ++ KFG+
Sbjct: 353  -------FPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGV 405

Query: 413  LGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDN 472
            + YA+STLEAV+CYFED + N+  +     + ++ ++  D LS +  +   ++L +Y D 
Sbjct: 406  VAYALSTLEAVLCYFEDAE-NSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKSYRDI 462

Query: 473  LQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGN 532
            L+ R   G+S LS+CI       +  +L  +E   P+EDIL+D+T++GSTLL+++++TGN
Sbjct: 463  LRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGN 522

Query: 533  IEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSS 592
               A +L+ I+  +C+  EL  Y+N+ +++ RT AHYLT ++ +   IG + DW+ K+ S
Sbjct: 523  TRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDIS 582

Query: 593  GQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDV 652
            G TPLF+IFR+YD P+Y +MV  AF  A+ WY+    +F++  H D+KGN+LLH++K+++
Sbjct: 583  GHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNI 642

Query: 653  SILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYA 712
             ILL+   +D+N  N KGLTPLM+YVKY R+ N+  I +D+RLI+EK Q S F  CFDY 
Sbjct: 643  EILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYV 702

Query: 713  KDHSVLSKIGERGARDSLFGLVYLHSLRY-HXXXXXXXXXXXXXXDKPFLTTVINMKTIQ 771
            K+  + +++G   A  + FG V  H+ R+ +              +  F T   N++ IQ
Sbjct: 703  KNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQ 762

Query: 772  GLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKV 831
            GLL+  L+ N  +FLP+++ ++++  + ++ L  +GK +V   L +LT    ++   ++ 
Sbjct: 763  GLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEF 822

Query: 832  PQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKAS 891
             + L+   + ++ W+R +  KR       +  + +EPEEIN IQSFLRFN  E+S  +  
Sbjct: 823  KKALYLPASDLVNWIRESGRKRT------NVSRRIEPEEINSIQSFLRFNLSELSLIRDK 876

Query: 892  LNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELL 951
            ++IL+K+ IF  LK+ D       L     ++ +   + AF     +     DL+   L 
Sbjct: 877  ISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILT 936

Query: 952  EHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPS 1011
             ++ FL++CT +L   +  +L  K+T+WWK Y E L  +  Y K FP+ VKP    +   
Sbjct: 937  SNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKG- 995

Query: 1012 HIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLD 1071
                G+++E KR + E++L+ QIK+  + L+ L  E+   HE LAEELS Y+EF+   L 
Sbjct: 996  --LFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLR 1053

Query: 1072 QRTIVAFATTNIGIFQE 1088
               I  F    I   ++
Sbjct: 1054 TGIIQDFTVGKINTLKD 1070

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1122 (36%), Positives = 652/1122 (58%), Gaps = 74/1122 (6%)

Query: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60
            M  YHLPTLLNPL+N+IFNCP P  SPLKKL+A+LK + FILL PP   LLNY D KTK+
Sbjct: 1    MEQYHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKI 60

Query: 61   PLHELCY-NVDFINSHILLTTENSYLNTTLRD----------SHYETLDGKAVVIQWKNN 109
             L +LCY NVDFI +HILL  ++S  +++               ++TL+G  ++++W+NN
Sbjct: 61   QLEDLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNN 120

Query: 110  IIHALNGFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAP-NDYLKCFDS 168
             +  L+G P RQ++KI   +VLPNFNDY +G+  F ++ ID+PL  +V   ND L+CFD+
Sbjct: 121  FLVLLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDT 180

Query: 169  ---YEEVPKNAQSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPS 225
               ++    ++     L  +  + ERS F+NI++ +     +     + Y+     ++P+
Sbjct: 181  LTLHDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240

Query: 226  KKMFEDIVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFK-GYEVDTE 284
            + +F+ IV  +++ +KS+ +FK F +L  LIH+Y E+NLYD +W ++ T      E    
Sbjct: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGT 300

Query: 285  KYKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVET 344
            + K  S+ ++   F+      F L  IT +E+ +  ++    KL   +S+ EKS+ L+ T
Sbjct: 301  RIKNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIAT 356

Query: 345  LQQLSG-PTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQK--HLKSHLYYLQNF 401
            LQ L+     I    QE   G N+L +DADTL++L +L++CRSE     LK +++YL+ F
Sbjct: 357  LQILTNMDNPIGELNQENEKGANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKF 415

Query: 402  SNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTR---ELLDKLSSEN 458
            + + +   FGIL Y IST E V+  FE+            V Y K +   E+++KL   +
Sbjct: 416  NYDENLINFGILSYTISTFEIVIYSFENI-----------VEYDKLKSYSEIIEKLIKVD 464

Query: 459  PTNEIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETL 518
               ++     +E  L +R++ G+SIL  CITN +    LD+L +YE++F M++IL+D  +
Sbjct: 465  DLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANV 524

Query: 519  DGSTLLIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILK 578
            +G+TLL++++   N + + +LI ++L NCS  +++ Y+NK DK+ R V HYL +E++ILK
Sbjct: 525  EGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILK 584

Query: 579  SIGSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTD 638
             IG YV+WK+++  G+TPLF+IFR YDQPNY+E++   F+I  +WY ++   F   DH D
Sbjct: 585  IIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYD 644

Query: 639  SKGNSLLHILKSDVSILLQLSK-----LDINGRNYKGLTPLMIYVKYKRISNIDAITKDS 693
             K NS+LHIL+S++ IL   SK     +DIN RNYKG TPLMIYVKY R+SN+  I  D 
Sbjct: 645  LKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDD 704

Query: 694  RLILEKVQNSTFFTCFDYAKDHSVLSKIGERGAR-DSLFGLVYLHSLRYHXXXXXXXXXX 752
            RL+  + Q   + TCFDYA D ++ +++G+   + +++FG +Y+HSL+            
Sbjct: 705  RLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLT 764

Query: 753  XXXXDKPFLTTVINMKT--IQGLLRSILKDNQFTFLPLNSYIDEISHLN--RSDLTIIGK 808
                DK   T  +N+K   I  LL+ I K +Q + LPL+  I  +  L    ++  I+ K
Sbjct: 765  FPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRK 824

Query: 809  ADV---RSLLHKLTNCFNVLLFLKKVPQ--NLFTDEASVLYWM-RINTSKRNQKPPSKDN 862
             ++   +SLL +LT+C + LLF        +L TDE  +L W+   NT  ++    +   
Sbjct: 825  IEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGE 884

Query: 863  PKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRK 922
             K+++PE+IN+IQSFL+FN  E+ +   ++  L K+L F+ LKS D +++  +   + + 
Sbjct: 885  KKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKS 944

Query: 923  IINGEAADAFAR-------IFTNHNMFSDLALAELLEHVSFLEQCTIQLSTFVQTILFDK 975
            I N + A A  R       + +  N + +  L  + + + FL+ CT+ L+  ++ IL  +
Sbjct: 945  IKNDQIAQATNRSLEPIIEMQSLENQYYNNTL--IRDELDFLKACTLILTGNIEDILRTQ 1002

Query: 976  ITKWWKHYGEFLALQKNYRKAFP-----------SVVKPKSATDTPSHIPLGSFIETKRE 1024
            I  WWK YGE L L K+Y K FP           +    + + D  +    G  IE +R 
Sbjct: 1003 IPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRN 1062

Query: 1025 QSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFR 1066
            ++ ++L   I      L+ LG+EIF  HE LAEEL+ YMEF+
Sbjct: 1063 KAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFK 1104

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1084 (36%), Positives = 615/1084 (56%), Gaps = 44/1084 (4%)

Query: 16   AIFNCPEPEKSPLKKLFANL-KTRRFILLAPPLRFLLNYHDVKTKLPLHELCYNVDFINS 74
            AI NC EP  SPLKKL+  L K  ++++L PP   LL Y D ++   LH+LCY  +F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 75   HILL-----TTENSYLNTTL-------RDSHY-ETLDGKAVVIQWKNNIIHALN--GFPI 119
            HILL     T  N+     L        D H+ + +D     I WKN +I+  N  G  I
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 120  RQRLKILETKVLPNFNDYFEGAAD-FAILFIDQ-----PLNCEVAPNDYLKCFDSYEEVP 173
            + R KIL+ + +P FN+Y +   +   I++ID       L C +  +  L    S   +P
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198

Query: 174  KNAQ-SVSNLPVNSYEQERS--SFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFE 230
               + S+ N     YE  +S  +FD+IL ++    ++  Q F  +R LA  DD    +F 
Sbjct: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258

Query: 231  DIVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFS 290
            +I+++  + M SD+LFKN  +L ++I++Y ELNL+DDIW  ++   K  E+D   +   S
Sbjct: 259  NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNIS 318

Query: 291  VNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSG 350
            + Q+ ++F S ++ +F L ++   ER +  ASK  QK+    +Y  K+ IL+ TL+ L+G
Sbjct: 319  IYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTG 378

Query: 351  PTEISSHQQELPNGLNS---LTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSS 407
              E   +  +  +G  S   L +DAD L++LFVLV CR++ K+LK HL YLQNF NN S 
Sbjct: 379  NKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSD 438

Query: 408  TKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIEN-- 465
            TKFGILGYA+STLEAVVCYFE   K  EN  K  + +  + E L K+ S     E     
Sbjct: 439  TKFGILGYALSTLEAVVCYFEQL-KEKENYRKL-IDFCNSNERLVKVLSSTKKYETNAAL 496

Query: 466  --LATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTL 523
              L  YE +L+YR+  GQS+L++CI + +N  L  +L EYE LFP+ED+L DE++DGSTL
Sbjct: 497  YFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTL 556

Query: 524  LIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSY 583
            LI+++K  N  +A +L+ I+  NC+E EL++Y+N+ D   RT  H+LT+E+++LK +G Y
Sbjct: 557  LIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKY 616

Query: 584  VDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNS 643
            ++W +K+++GQTPLF+IFR+YDQ NY+EMV  +   A +WY  +  +F+YLDH D KGN+
Sbjct: 617  INWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNT 676

Query: 644  LLHILKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNS 703
            LLHILK ++ ILL    +++N  N  G TPLM  ++YKR  NI  +  D RL ++  Q +
Sbjct: 677  LLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKN 736

Query: 704  TFFTCFDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTT 763
               T FD++KD  +   +GE    +S +  VY H+L+Y               D P  TT
Sbjct: 737  NALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKY-TNSRWNLSLTVKLKDAP-KTT 794

Query: 764  VINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFN 823
               +KT++G+LR ++K+N   FLP+   ++++   NR   + + +  V  +L  ++ C +
Sbjct: 795  NFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLS 854

Query: 824  VLLFLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFD 883
             L+ +K +  N+F  E + + W+++N S   +   + D    + PE+I+MIQ+FL+FN  
Sbjct: 855  ALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSD----ITPEDISMIQNFLKFNIT 910

Query: 884  EISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFS 943
            EI   K  L I  K+ +F  LKS D  ++ ++   +  ++ +            +  + S
Sbjct: 911  EIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLS 970

Query: 944  DLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKP 1003
              A   LL  +++L+ C  +L   + +I    I+ WW  YGE L   K+Y +AFP +   
Sbjct: 971  VRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA-- 1028

Query: 1004 KSATDTPSHIPLGSFIET-KREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNY 1062
             + T     + L   I   KR + E+RL+ +IK  ++ L  +G +I   HE  AEE+S +
Sbjct: 1029 -NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRF 1087

Query: 1063 MEFR 1066
            ++ +
Sbjct: 1088 IDLK 1091

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/1082 (33%), Positives = 622/1082 (57%), Gaps = 39/1082 (3%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            YH+P LLNPLINA+FNCP+P  SPL+KLF  +K + F+L+ PP   LL+Y D +  L L 
Sbjct: 6    YHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLK 65

Query: 64   ELCYNVDFINSHILLTTENSYLNTTLR--------DSHYETLDGKAVVIQWKNNIIHALN 115
            ELCY  +F+ SHI+L T+NS  N  ++        D+ Y++L+   ++I+  N I    N
Sbjct: 66   ELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLDFN 125

Query: 116  GFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKN 175
                +++ KI++ K+LPNFN+Y  G+  + I++ D P +    P   ++ F   ++   N
Sbjct: 126  NSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNN 185

Query: 176  AQSV------SNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMF 229
             ++       S L  +  ++ +SSF +I++IH            +++    N       F
Sbjct: 186  IKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLNLTSLPIYF 245

Query: 230  EDIVQQSFDGMKSDSLFKNFSN-LYDLIHDYFELNLYDDIWSRLVTHFKGYE-VDTEKYK 287
             +IV +++  MK + +F +F N LY+LI +Y E + Y+ IW  +  +    + + TE   
Sbjct: 246  REIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEMMD 305

Query: 288  YFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQ 347
            + S++QL  + ++++F++F L ++  +ER V  A+  F+K+  + S++EK +IL++ LQ+
Sbjct: 306  FLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDALQK 365

Query: 348  LSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSS 407
            L+   ++             L +DADTL++LF+LV+CRS+   L++HLYYLQNFS + ++
Sbjct: 366  LTSYDDVHYE---------PLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENN 416

Query: 408  TKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLA 467
             KFG+LGY IST EA +CY +DF +  E   K  ++  + +EL+ K+SSE   +  + + 
Sbjct: 417  VKFGLLGYGISTFEATLCYLKDF-QAGEKFNKQVLNCIRNKELISKISSEADHSTFQ-VK 474

Query: 468  TYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIES 527
             Y+D  ++RNE G+SIL++CI + KN  L ++L  +ED+FP+EDIL+DE ++G+TLL+++
Sbjct: 475  LYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKA 534

Query: 528  IKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWK 587
            +K  N   AK+++ ++  +CSE EL+ Y N+ D   R  AHY+T+++D+LK IG + +WK
Sbjct: 535  LKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWK 594

Query: 588  RKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHI 647
             K+  G TPL +I RTYDQ  YE+M++ AF  A  WY+  N   ++ DH DSK N+LLHI
Sbjct: 595  IKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHI 654

Query: 648  LKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFT 707
            LK D+ +LL+   ++IN  N K +TPLM YVKY R+SNI  I +D RLIL K Q  TF  
Sbjct: 655  LKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLD 714

Query: 708  CFDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINM 767
            C+D+ K+  +   +G R  R+S+F L   +SLR                   ++T  +++
Sbjct: 715  CYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSL 774

Query: 768  KTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDL-TIIGKADVRSLLHKLTNCFNVLL 826
            K +  +++   K     F+P    +  ++ + +++    I K   R+ L+ ++N F  L+
Sbjct: 775  KILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTLI 834

Query: 827  FLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEIS 886
                    LF +  S+  W++    KR  K   ++  K M  ++INMI+SF++FN +E+ 
Sbjct: 835  ETDDFDTELFKNPESLTKWIK--AGKRKHK--KENYYKRMTLDDINMIKSFVQFNINELG 890

Query: 887  SFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARI--FTNHNMFSD 944
                +L IL+K+  FL+LK ND  ++Y   R  G  +   + ++   +I        F  
Sbjct: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQS 950

Query: 945  LALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPK 1004
            + L  LL+ +SFLE CTI +S     ++ + I +W   +     L+K Y++ F       
Sbjct: 951  IFLI-LLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDF---- 1005

Query: 1005 SATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYME 1064
             + +  +   L  + + KRE +E+R++ +I  ++ +  ++ + I+ AHE LAEE + ++ 
Sbjct: 1006 DSRNGLNENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLT 1065

Query: 1065 FR 1066
            F+
Sbjct: 1066 FK 1067

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/1089 (34%), Positives = 596/1089 (54%), Gaps = 44/1089 (4%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            YHLP LLNPL+NA+FNCP P  SPLKKLF N+K +RFILL P    LL Y D+ + LPL 
Sbjct: 3    YHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLS 62

Query: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123
            ELCYN DF+ SHIL+  + S     + +  Y TL+G +V+I+ +  I+ +    P  ++ 
Sbjct: 63   ELCYNYDFVASHILIQLQES----KVTEQEYRTLNGNSVIIRSQAGIVMSK---PELRKC 115

Query: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYE-EVPKNAQSVSNL 182
            ++   +VL NFNDY      F +L ID+PL   +  ND L+ F SYE   P  ++++   
Sbjct: 116  RVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTI--- 172

Query: 183  PVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPND----DPSKKMFEDIVQQSFD 238
              N+  +    F+  + ++    AQL   F   R+   N+    D   K+F+D+V   + 
Sbjct: 173  --NTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYG 230

Query: 239  GMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDT----EKYKYFSVNQL 294
             +K D  F+N+  L ++  +Y ELN+Y+DIW +LV      E D        KY S+N +
Sbjct: 231  VIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNV 290

Query: 295  LADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEI 354
                + +    F L  +T +E+RV  A+  F KL+LT+S+ EK+KI+V T Q L+   E 
Sbjct: 291  ATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEY 350

Query: 355  SSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILG 414
            +S            T+DADTL+ L ++V+CRS+ K+LKSHL YL+ F+  P   KFG+ G
Sbjct: 351  TSIDP---------TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTG 401

Query: 415  YAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQ 474
            Y++ST+EAV+ YFE  D   E L K     +  R   D + S    +    L++Y+++L 
Sbjct: 402  YSLSTIEAVLAYFEAGD-GTEKLKKLISLSEANRVFWDLIRSGVAVS----LSSYKNSLI 456

Query: 475  YRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIE 534
             R+   +S LSICI   +  ++ ++L  Y++   +ED+L D     STLLI++++TG+ E
Sbjct: 457  SRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDE 516

Query: 535  AAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQ 594
             A++LI +M+ NC+  E   YVN+++   RTVAHYL     I++ IG Y+DW++K+ +  
Sbjct: 517  IAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMH 576

Query: 595  TPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSI 654
            TPLF I R YDQ +Y EM+  +F     + ++    F + DH D  GNSLLHI+K  +  
Sbjct: 577  TPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQS 636

Query: 655  LLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKD 714
            +L    +++N  N KG+TPLM+Y KY RI NI  I +D RLI+ K+QN       DY K+
Sbjct: 637  ILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKN 696

Query: 715  HSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTIQGLL 774
              +L+ IG   A++SL+GL+    +++               D  + T   ++K IQGLL
Sbjct: 697  PMILNLIGTHIAKNSLYGLLSADGIKFE-DNCWYLWITVKFSDNSYSTLRQSVKNIQGLL 755

Query: 775  RSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQN 834
            +   K +   FLP++  +  + ++ +  +  +   +    L  LT   +V+    +    
Sbjct: 756  QFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAV 815

Query: 835  LFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNI 894
            L  +E+ +  W+R N  K     P  +  + +EPEE++ IQSFL+FN  E S  K    I
Sbjct: 816  LRYNESDLSTWLRTNNFK-----PRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTI 870

Query: 895  LRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHV 954
            LRK+++F SLK+ D E     + +   +I++     +  + F   N   + +L    + +
Sbjct: 871  LRKLVVFQSLKAQDIECAQRIIYQQ-MEIVSNSVGPSVEKTFIGSN--ENYSLDSFQQAI 927

Query: 955  SFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIP 1014
             F+  C   LS+ +Q +L  K+T WW+ YGE  +L++ Y++ FPS  K    +   S   
Sbjct: 928  EFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGF 987

Query: 1015 LGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRT 1074
              S+IE KR+++E +L  +++     L+ L  E+   HE LAEE+S ++ F+    +   
Sbjct: 988  FESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFV 1047

Query: 1075 IVAFATTNI 1083
            +  +A   I
Sbjct: 1048 MKTYANICI 1056

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/1074 (34%), Positives = 599/1074 (55%), Gaps = 55/1074 (5%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            YHLP LLNPL+NA+FNCP P  SPLKKLF N K ++FIL+ P    LL Y D  T +PL 
Sbjct: 3    YHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62

Query: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123
            ELCYN +F+ SH L+  + + +     +  ++T++GK+VVI+ ++ II A    P  ++ 
Sbjct: 63   ELCYNYEFVASHTLVQLQEARVT----ELEFQTINGKSVVIRPQSGIITAQ---PSAKKC 115

Query: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSN-- 181
            +I   ++L +FNDY  G   FA+L+ID+PL  E+     L+ F   E+ P   Q ++   
Sbjct: 116  RIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQ-PLQYQRITQTA 174

Query: 182  ---LPVNSYEQERSSFDNILHIHSARLAQLGQLFSN----YRRLAPNDDPSKKMFEDIVQ 234
               LP+  +          L +H     QL ++F +     R +A +     ++F ++V+
Sbjct: 175  DAPLPLEQF----------LRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVE 224

Query: 235  QSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYF----S 290
            + +  +K D  F+N+ NL +++  Y ELN+Y+D+W +LV      E D     Y     S
Sbjct: 225  KVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSIS 284

Query: 291  VNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSG 350
            +NQL    + ++  +F LS +T IE+RV  A++ F KLTLT+S+ EK++IL+ T Q+L+ 
Sbjct: 285  LNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTT 344

Query: 351  PTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKF 410
             T  ++        L+ + +DADTLL L V+VVCR++ K+LKSHL YL+ F+ N    KF
Sbjct: 345  KTSQAT--------LDPM-IDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKF 395

Query: 411  GILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYE 470
            G+LGY++STLEAVV YF D   ++  L +     Q+ +   + +    P N    L  +E
Sbjct: 396  GLLGYSLSTLEAVVGYF-DIGGSSIKLERLITQCQRNKIFWNLIEQGIPIN----LKEHE 450

Query: 471  DNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKT 530
            + L  R    +S+LS+CI   +  +  D++  Y+  F +EDIL+D      +LLI++++ 
Sbjct: 451  EVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQA 510

Query: 531  GNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKN 590
            GN +  + +I +++ NC+  E+ +Y+NK D   RTV HYL    +I+  +G +VDWKRK+
Sbjct: 511  GNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKD 570

Query: 591  SSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKS 650
             +  TPLF++ R YD P+Y E++   F     +Y      F + DH D  GN+LLHI+K 
Sbjct: 571  LNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKD 630

Query: 651  DVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFD 710
             + + L     ++N  N +G+TPLM+Y KY RI NI  I  D RLIL K+Q+       D
Sbjct: 631  GIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAID 690

Query: 711  YAKDHSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINMKTI 770
            Y K+  +L+ IG   A++SL+G + +H+++Y               +  + T+   +K I
Sbjct: 691  YVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPES-YKTSSYALKDI 749

Query: 771  QGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKK 830
            Q LL+   K +  +FLP++ +++ +  L +S +  +   +   LL  LT   +++   ++
Sbjct: 750  QSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQ-QRE 808

Query: 831  VPQNLFT-DEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFK 889
              +N+F+  E+ +  W+R +  K  QKP  +D    +EPEEI+ IQ+FL+F+  E +  +
Sbjct: 809  DYKNVFSYTESELSTWLRASMVK--QKPNKRDK---IEPEEIHSIQNFLKFSLTEFNYLR 863

Query: 890  ASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAE 949
                +L+K++IF   KS+D E +   L   G +II         R     N F+D  +  
Sbjct: 864  EKFTVLKKLIIFEHYKSHDIECSQRILYSQG-EIIASVVPSKRLRTSPFDNEFND-GIDP 921

Query: 950  LLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDT 1009
              + V F+  C   L++ +  +L  K++ WW  YGE   LQK Y++ FP   KP SA+  
Sbjct: 922  FEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSE 981

Query: 1010 PSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYM 1063
             S     S++E KR++ E +L  ++   S+ L+ L +E+   HE LAEE+S ++
Sbjct: 982  DSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFI 1035

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/862 (36%), Positives = 530/862 (61%), Gaps = 32/862 (3%)

Query: 4   YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
           YHLP LLNPL+N++FNCP P  SPLKK+FA+L+ +RFIL+ P +  LL+Y D+ T   L 
Sbjct: 3   YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62

Query: 64  ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123
           +LCY  +F+ +HI++  ++S  +    D  ++TL+GK V+I+ +N I+   +GFP ++R 
Sbjct: 63  DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118

Query: 124 KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183
           KI  T++  NFNDY +G+  F ++ ID+PL  +   ND L+ F         + + S+LP
Sbjct: 119 KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGV------RSTNTSSLP 172

Query: 184 VNS--YEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPND----DPSKKMFEDIVQQSF 237
           +++   ++E SSF+ +  +H     +   LF   R+    +    D     F+    ++F
Sbjct: 173 LSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAF 232

Query: 238 DGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEV----DTEKYKYFSVNQ 293
           + ++ +  F+N S L+  +H+Y ELNLYDDIW ++   ++  E+    D    KY +++Q
Sbjct: 233 ELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQ 292

Query: 294 LLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTE 353
           +   F+ +   +F L  +T  E+ +  A+  F++L  + S++EK+KI+++TLQ L+  +E
Sbjct: 293 VPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSE 352

Query: 354 ISSHQQELPNG-LNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGI 412
                   P+  +  +T+DADTL+ L VLVVCRS+ K+LKSHL+YLQNFS + ++ KFG+
Sbjct: 353 -------FPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGV 405

Query: 413 LGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDN 472
           + YA+STLEAV+CYFED + N+  +     + ++ ++  D LS +  +   ++L +Y D 
Sbjct: 406 VAYALSTLEAVLCYFEDAE-NSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKSYRDI 462

Query: 473 LQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGN 532
           L+ R   G+S LS+CI       +  +L  +E   P+EDIL+D+T++GSTLL+++++TGN
Sbjct: 463 LRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGN 522

Query: 533 IEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSS 592
              A +L+ I+  +C+  EL  Y+N+ +++ RT AHYLT ++ +   IG + DW+ K+ S
Sbjct: 523 TRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDIS 582

Query: 593 GQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDV 652
           G TPLF+IFR+YD P+Y +MV  AF  A+ WY+    +F++  H D+KGN+LLH++K+++
Sbjct: 583 GHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNI 642

Query: 653 SILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYA 712
            ILL+   +D+N  N KGLTPLM+YVKY R+ N+  I +D+RLI+EK Q S F  CFDY 
Sbjct: 643 EILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYV 702

Query: 713 KDHSVLSKIGERGARDSLFGLVYLHSLRY-HXXXXXXXXXXXXXXDKPFLTTVINMKTIQ 771
           K+  + +++G   A  + FG V  H+ R+ +              +  F T   N++ IQ
Sbjct: 703 KNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQ 762

Query: 772 GLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKV 831
           GLL+  L+ N  +FLP+++ ++++  + ++ L  +GK +V   L +LT    ++   ++ 
Sbjct: 763 GLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEF 822

Query: 832 PQNLFTDEASVLYWMRINTSKR 853
            + L+   + ++ W+R +  KR
Sbjct: 823 KKALYLPASDLVNWIRESGRKR 844

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/1105 (33%), Positives = 607/1105 (54%), Gaps = 56/1105 (5%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            Y+LP LLNPLINA+FNCP P  S LKK+F+ ++  RF+L+APP   LL Y D+++ LPL 
Sbjct: 3    YYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQ 62

Query: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123
            +LCY   F++ HI+L          L++  Y+TL GK ++++ +  II     F  R+R 
Sbjct: 63   DLCYATGFVSDHIVLLDGRE----GLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRC 118

Query: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183
            +I   ++L NFN+Y +G   F I+ +D PL   +A  D  +CF     V KN Q  +N P
Sbjct: 119  RIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCF----RVTKN-QEHTNGP 173

Query: 184  VNSYEQERS----SFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKM-----FEDIVQ 234
             NS +        S + +L I+      L  +    +R++ N   +        F    +
Sbjct: 174  KNSGKLSHGDNNISLEQLLRINPEYGESLNDIV-KAQRISLNSSVTGTTHLASHFVQTCK 232

Query: 235  QSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEK----YKYFS 290
            ++ D +++   F+   NL   +H+Y ELNLYDD W++L    +  E+++       K+ S
Sbjct: 233  KALDVVRAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHIS 292

Query: 291  VNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSG 350
            V+Q+ +  +  + ++F L  IT  E+ V  A + F+K+ +T+ ++ K+K+++ETLQ LS 
Sbjct: 293  VSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSR 352

Query: 351  PTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKF 410
               +            ++T+DADTL+SLFV+VVC ++ K L+SHL+YLQ F+ + +   F
Sbjct: 353  SLLVDDR---------AVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTF 403

Query: 411  GILGYAISTLEAVVCYFEDFDK--NNENLAKANVSYQKTRELLDKLSSENPTNEIENLAT 468
            GIL Y +STLEAV+CYFE  +K  + E   +AN+S+ K+      +S  +     +    
Sbjct: 404  GILAYGMSTLEAVLCYFESPEKVASLEKYCRANLSHWKS------ISEGSIDLNADTTVP 457

Query: 469  YEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESI 528
             +D L+ R   GQS L++C+ + +      +    E  FP+ED+L DET DGS LLI  +
Sbjct: 458  LDDLLKIRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHML 517

Query: 529  KTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKR 588
            ++G    A +LI  ++ NC++ EL++++N  +KY R+  HYL H   ++  +G  ++W++
Sbjct: 518  ESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQ 577

Query: 589  KNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHIL 648
            ++ +G TPLF+I R YD+P+Y +MV  A+  A    +  NS F   +HTD KGN+LLH++
Sbjct: 578  RDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVI 637

Query: 649  KSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTC 708
            KSDVSILL    +D+N  N KGLTPLM+YV+Y RI N+  I +D RLI+ K Q+  + +C
Sbjct: 638  KSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSC 697

Query: 709  FDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDK-PFLTTVINM 767
            FDY K+ +VL ++G+  +       + +HS++                 + P      ++
Sbjct: 698  FDYVKNPAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSL 757

Query: 768  KTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLF 827
            + IQ  L      +  TF+P++  + E+  L++S + I+ K D +  L +   C   L  
Sbjct: 758  RFIQAFLTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKR---CSVTLSM 814

Query: 828  LKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISS 887
            + +  + LF D  +       ++           N K MEPEE+  IQS L+FN  EIS+
Sbjct: 815  VSQ--ERLFADAFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISA 872

Query: 888  FKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIING--EAADAFARIFTNHNMFSDL 945
             K ++ +++K+ +F  LK  D  +   +     + +  G  ++ D F  +    N+F   
Sbjct: 873  LKTAMLLMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFLNV-QAPNLFDFE 931

Query: 946  ALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKS 1005
             +A    +++  E C+  L   +  +L D I KWW  YGE L+L++ Y+K+FP   +P  
Sbjct: 932  GIA---NNIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHV 988

Query: 1006 ATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEF 1065
            + ++      GS+IETKR + EQ  A +I  +S  L E+ ++I   +E+LA EL+N++ F
Sbjct: 989  SENSGL---FGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINF 1045

Query: 1066 RKACLDQRTIVAFATTNIGIFQEYI 1090
            +   L +  I   A TNI   +E +
Sbjct: 1046 KNEFL-KSAIKEHADTNIKRLREQL 1069

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/1109 (32%), Positives = 602/1109 (54%), Gaps = 62/1109 (5%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            Y+LP LLNPLINA+FNCP P+ SPL+K+F  ++ +RF L+ P    LL Y D+++   L 
Sbjct: 3    YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62

Query: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123
            +LCY+  F++ HILL            +  Y+TL GK + ++ +   +    GF  R+R 
Sbjct: 63   DLCYSASFVSDHILLLGGGG----CSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRC 118

Query: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183
            ++LET++L NFN+YF+G++ + I+ +D PL   +A  D    F +Y     +  S +N  
Sbjct: 119  QVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTS-ANSS 177

Query: 184  VNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAP----NDDPSKKMFEDIVQQSFDG 239
            + +  + ++S + +L  H +   +L  +    R        N D     F    +++   
Sbjct: 178  LAASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAA 237

Query: 240  MKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEK----YKYFSVNQLL 295
            ++ D  F+ F NL   IH+Y E+NLYDD W++L    K  E++ +      +  S++Q+ 
Sbjct: 238  IQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVP 297

Query: 296  ADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEIS 355
            +  +  D ++F +  +T +E+ +  A +  ++L +T+S++ K+K++VETLQ +S   EI+
Sbjct: 298  SFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEIN 357

Query: 356  SHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGY 415
                        +++DADTL+SL V+VVC++E K LKSHL+YLQ F+ + +S  FGIL Y
Sbjct: 358  D---------KVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAY 408

Query: 416  AISTLEAVVCYFEDFDKNN--ENLAKANVSYQKTRELLDK---LSSENPTNEIENLATYE 470
             +STLEAV+ YFE  +K    E    +N SY +   L D    L S NP+         +
Sbjct: 409  GMSTLEAVLSYFESREKLKLLEKHCSSNASYWEA--LADGKLPLGSLNPSE-------VK 459

Query: 471  DNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKT 530
            D L+ R   G S LSIC+ N +  + L + T++E  FP+ED+L DET++GS LLI+ +  
Sbjct: 460  DILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDN 519

Query: 531  GNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKN 590
            G    +   I ++  +C++ EL S++N  ++Y R+  HYL H +D++  +G +++W++++
Sbjct: 520  GCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRD 579

Query: 591  SSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKS 650
             +G TPLF+I RTYD  +Y+ MV  A+  A  W       F    H D+KGN+LLH++KS
Sbjct: 580  CNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKS 639

Query: 651  DVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFD 710
            +VS++L    +++N  N KGLTP+M+Y +Y R+ NI +I +D RLI++K QN ++ TCFD
Sbjct: 640  NVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFD 699

Query: 711  YAKDHSVLSKIGERGARDSLFGLVYLHSLRYHXXX------XXXXXXXXXXXDKPFLTTV 764
            Y K+  VL ++G+       F L   + +R H                    + P     
Sbjct: 700  YIKNPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQ 754

Query: 765  INMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNV 824
             ++K IQ  L S  K N  TF+P  S  +E+S L +  +  I + + +  L + +   ++
Sbjct: 755  RSLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSL 814

Query: 825  LLFLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDE 884
            +   ++  +++F + +  L    +N ++  Q+  +      +EPEE+  IQ  ++FN  E
Sbjct: 815  ICRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTE 869

Query: 885  ISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGR---KIINGEAADAFARIFTNHNM 941
            I + K+   +L+K+ IF  LK  D E ++   +  G    KII G + + F  +   H++
Sbjct: 870  ILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKII-GRSTNVFGSL--KHSL 926

Query: 942  FSDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVV 1001
                    L  + + LE  +  L   +  IL   I  WWK YGE ++L+  Y K FP  V
Sbjct: 927  -PQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDV 985

Query: 1002 KPKSATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSN 1061
            +P+ A +T     + S+IETKR + EQ L  +I  SSK L      +  ++E LA EL+N
Sbjct: 986  RPRVAENTGF---ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNN 1042

Query: 1062 YMEFRKACLDQRTIVAFATTNIGIFQEYI 1090
            ++ F+       TI   A  NI   QE +
Sbjct: 1043 FINFKAEFWVSATIKEHAAMNIKWLQEQL 1071

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/1106 (32%), Positives = 608/1106 (54%), Gaps = 35/1106 (3%)

Query: 3    VYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPL 62
             Y +P L NPLINA+FNCP+P  SP KKL+  L+ + F+LL P    LL Y D  + +  
Sbjct: 2    AYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISF 61

Query: 63   HELCYNVDFINSHILLTTENSYL------NTTLRDSHYETLDGKAVVIQWKNNIIHALNG 116
             ELCY  DF+ +HIL+  +NS        N    D + ++L+GK V++  + ++   + G
Sbjct: 62   RELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKG 119

Query: 117  FPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNC-EVAPNDYLKCFDSYEEVPKN 175
            +  +++ ++ +  +L NFNDY  G+  F I+ ID PL   +    D LK F+   E+P +
Sbjct: 120  YFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFH 179

Query: 176  AQSVSNLPVNSYEQE----RSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFED 231
            +Q      +    +E    R  F  +         +L +    Y+ + P  +   ++F D
Sbjct: 180  SQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHD 239

Query: 232  IVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSV 291
            IV   ++ +K +  F+ F+NLYD+ ++Y E  LY DIW++L  H++   +D       S+
Sbjct: 240  IVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSL 299

Query: 292  NQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGP 351
            + L   F+++ FK F+L DI  +E  +  A   F+ +   +SY++K  ++ +TL  ++G 
Sbjct: 300  DMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGK 359

Query: 352  TEISSHQQELPNGLNSLTM-DADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKF 410
               +S      N L  L + DADTL+SLF L++CR+  + +  H+ YLQ+F  + ++ KF
Sbjct: 360  ---NSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKF 416

Query: 411  GILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLD---KLSSENPTNEIENLA 467
            G LGY +ST+EA + YF +   ++E    + +  QK   L D   K+ S++  +++  + 
Sbjct: 417  GALGYTLSTIEATLSYFYELSNSDE----SRIQLQKLSLLEDFLIKIRSQH--DDLIPIN 470

Query: 468  TYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIES 527
             ++D  +YR + G+SILS+ I N KN  L + L  +ED+FP++D+L D  + GSTLLI+ 
Sbjct: 471  QFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKC 530

Query: 528  IKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWK 587
            +K  N+EAA+ILI I   +C+  EL++Y NK DK  RT+AHY+T E++IL+ IG Y++W 
Sbjct: 531  LKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWT 590

Query: 588  RKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHI 647
             K+  G+T LF+IFR+YDQ  Y   +KIA + A  WY+ ++  F   DHTD  G+SLLHI
Sbjct: 591  LKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHI 650

Query: 648  LKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFT 707
            LKS VS+LL+   LDIN  N KG+TPLM YVKY RI NI  I +D RLI++K+Q   +  
Sbjct: 651  LKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLN 710

Query: 708  CFDYAKDHSVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXDKPFLTTVINM 767
            C DY K+ +V + +  + ++D +F   Y+   RY               D  + T +I +
Sbjct: 711  CLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYE-KSHWYLCISVQKDDLEYTTNIIKL 769

Query: 768  KTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRS-DLTIIGKADVRSLLHKLTNCFNVLL 826
            K    L+ ++ K  +  F+P +  +D +  +    ++  I +  +++ L+ L++  + LL
Sbjct: 770  KKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALL 829

Query: 827  FLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEP---EEINMIQSFLRFNFD 883
            + +K+      DE  ++ W+   +SK  Q+  S D+  + +P   E+IN I++F  F+F 
Sbjct: 830  YFEKIDPLTLLDENLIIKWI---SSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQ 886

Query: 884  EISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFT-NHNMF 942
            EI      +    K+ IF  +K+ D   +YD L  +G    N E +     + + + ++ 
Sbjct: 887  EIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISPHVH 946

Query: 943  SDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVK 1002
            S +   EL + + F+++CT+ L++ + + + DK++ W K   + L  +K Y   F    +
Sbjct: 947  SSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNE 1006

Query: 1003 PKSATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNY 1062
                    + +   ++  T R++ E+RL   +    + LK+LG+EI   HE+LAEE S+Y
Sbjct: 1007 ETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDY 1066

Query: 1063 MEFRKACLDQRTIVAFATTNIGIFQE 1088
            +  +        +  F + N+   +E
Sbjct: 1067 VRMKSKFNSNLLVRKFVSLNLAHLKE 1092

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1138 (33%), Positives = 604/1138 (53%), Gaps = 85/1138 (7%)

Query: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLHEL 65
            +P LLNPL++A+FNC + E SPL+K++++L    FILL PP   L  Y D  TK PLHEL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 66   CYNVDFINSHILL---TTENSYLNTTL------RDSHYETLDGKAVVIQWKNNIIHALNG 116
            C++ +F++SHIL      +N  ++T L      R++ + T +GK +   +    ++  +G
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 117  FPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKC--FDSYEEVPK 174
            F  R   +IL+ + L +F +Y +G++ F +++IDQPL   +  N  LKC   D +  +  
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPL---IDTNRLLKCEDLDCFPNLTI 177

Query: 175  NA----QSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRR-LAPNDDPSKKMF 229
            N     +S++NL       +R+   N + IH+    +   +F NYR+ +  ++      F
Sbjct: 178  NTTPSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQSESMLIPGF 236

Query: 230  EDIVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEK---- 285
               + + +DG+  D+ F     +  LI +Y E N+YDD+W  L+      E + EK    
Sbjct: 237  RKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINR-NNAEGEKEKQSES 293

Query: 286  ---YKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILV 342
               +++ S++QL  DF+   F +F L DI  +E+ ++ A+K F+ L++TH+Y EK ++LV
Sbjct: 294  SDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353

Query: 343  ETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFS 402
            ETLQ LS P +     Q        + + ADTL+SLF+L++ R++ K+++ HLYYLQNF 
Sbjct: 354  ETLQILSKPVKRVGGYQ--------VPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFH 405

Query: 403  NNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLS-SENPTN 461
             + +S KFG+LGYAISTLEAV+CY E  + + E L     +     E L  L+ S+  +N
Sbjct: 406  QDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSN 465

Query: 462  EIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTE-YEDLFPMEDILEDETLDG 520
            E  +L+ Y  N +YRN  G S LS+CI N KN I  ++L+E YE  F  ED+LED+T +G
Sbjct: 466  EGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEG 525

Query: 521  STLLIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSI 580
            +TLL++S++  N E  + L  IML N +E EL  Y  K DKY R + HY+  +  +L+ I
Sbjct: 526  TTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKI 585

Query: 581  GSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQK-HNSSFDYLDHTDS 639
            G Y+ W  K+ +GQTPL  IFR+YDQ  Y+ MV+ +F IA  WY    NS F + DHTDS
Sbjct: 586  GKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDS 645

Query: 640  KGNSLLHILKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEK 699
            KGN+LLHI+K ++S LLQ   +DIN  N +GL+PL     Y R  N++A+ KD RLI   
Sbjct: 646  KGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI--- 702

Query: 700  VQNSTFFTCFDYAKDH--SVLSKIGERGARDSLFGLVYLHSLRYHXXXXXXXXXXXXXXD 757
                  F+ FD+ K +  +  + I      D+      + +  +                
Sbjct: 703  ------FSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRS 756

Query: 758  KPFLTTVIN-----MKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNR--SDLTIIGKAD 810
            K     +I      +K ++ L R +LK + FTF PL   +DE+S + +  S  +++  + 
Sbjct: 757  KEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSSF 816

Query: 811  VRSLLHKLTNCFNVLLFLKKVPQNLFTDEASV---LYWMRINTSKRNQKPPSKDNPKTME 867
               +L KLT C + ++ ++ +P       A +   +   ++   +   K  SKD  K M+
Sbjct: 817  CSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKD--KKMQ 874

Query: 868  PEEINMIQSFLRFNFDEISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGE 927
            PE I  I +FL++  + +   K ++  LRK  I   LKS D  ++ + +  +G ++ + +
Sbjct: 875  PESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKK 934

Query: 928  AADAFARIFTNHNMF-SDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEF 986
               A  R  T  N F  + +   L+  + F E C   +   +  +L  KI +WWK YG+ 
Sbjct: 935  IGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQL 994

Query: 987  LALQKNYRKAFPSVVKPKS------------ATDTPSHIP----LGSFIETKREQSEQRL 1030
            L L K      PSV+  +S             T T  H      LG+FIE KR ++++R 
Sbjct: 995  LELSKED----PSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERT 1050

Query: 1031 AVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFATTNIGIFQE 1088
               I    + LK L +EI T +  +  E   ++ F+   +    +  +   NI + ++
Sbjct: 1051 RAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKK 1108

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1193 (34%), Positives = 636/1193 (53%), Gaps = 120/1193 (10%)

Query: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60
            MS YHLPTLLNPL+NA+FNCP+P  SP KKLF  LK ++FILL PP   LLNY D   KL
Sbjct: 1    MSQYHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKL 60

Query: 61   PLHELCY-NVDFINSHILLTT----ENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALN 115
             L+ELCY N DF+ SHIL  +     N    TT  D  ++ L+G   +I+WK+NII    
Sbjct: 61   SLNELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRG 120

Query: 116  GFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCE-VAPNDYLKCFDSYEEVPK 174
             F   QR KIL+   L NFNDYF G+ +F ++FID+P+    +  ND LKC        K
Sbjct: 121  NFSNDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK 180

Query: 175  NAQSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQ 234
            + +  + L  +  +Q +SSF+N L+ + A   + G L +NY+  +   +P+ K+F ++V 
Sbjct: 181  SQEKETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN 240

Query: 235  QSFDGMKSDSLFKNF-----SNLYDLIHDYFELNLYDDIWSR----LVTHFKGYEVDTEK 285
            ++F  + S   F+         L+ L HDY E +LYD+IWSR    ++   K Y  D + 
Sbjct: 241  EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKA 300

Query: 286  ---YKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILV 342
                K+FS+ ++  +F+      F L  +  +E+ +  +     KL  T SY EKS IL+
Sbjct: 301  QHLIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILI 356

Query: 343  ETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSE--QKHLKSHLYYLQN 400
            E+LQ ++     +  ++      +   +DAD LL+L  LV+ +S      LK++LYYL+ 
Sbjct: 357  ESLQIITDSN--TGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKY 414

Query: 401  FSNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPT 460
            FS + SS+ FGIL Y I+T   V    E+            + + + +E  D +     T
Sbjct: 415  FSTDESSSSFGILNYTIATFHMVSHVLENV-----------IDWDRLKEKSDLIEELIMT 463

Query: 461  NEIENLA-TYEDN----LQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILED 515
            +++  L+ T+E++    L YRN  G+S+L++ I N +N      L EYED+  M+ I  D
Sbjct: 464  DDLSTLSSTFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISND 523

Query: 516  ETLDGSTLLIESIKTGNIEAAKILIGIMLLNC-SEGELVSYVNKADKYARTVAHYLTHEM 574
            +++D STLL+++I++ N EAA IL+ ++  NC ++ EL+SY+N+ D + R + HYL   +
Sbjct: 524  QSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINL 583

Query: 575  DILKSIGSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYL 634
             ILK IG +++WK+K+ +G+TPLF+IFR+YDQ NY+E+V   F IA  WY  +N  F   
Sbjct: 584  TILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMN 643

Query: 635  DHTDSKGNSLLHILKSDVSILLQLSK-----LDINGRNYKGLTPLMIYVKYKRISNIDAI 689
            DH DS GNSLLHIL++++SILL  +K     +++N  N KG TPLM+Y KYKR  NI  I
Sbjct: 644  DHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMI 703

Query: 690  TKDSRLILEKVQNSTFFTCFDYAKDHSVLSKIGE-RGARDSLFGLVYLHSLRYHXXXX-- 746
             K+ +LI  K Q+  F  CFDY+ D S+++ IGE   +   LFG + + SL+        
Sbjct: 704  IKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPS 763

Query: 747  ------XXXXXXXXXXDKPFLTTVINMKTIQGLLRSILKDNQFTFLPLN-------SYID 793
                            DK  LT  +   ++   L+ + +    +FLPL+       S++D
Sbjct: 764  LPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLD 823

Query: 794  EISHLNRSDLTI----IGKADVRSLLHKLTNCFNVLLFL--KKVPQNLFTDEASVLYWMR 847
            + S  N +  TI    I K  +R  L +L  C +VLL      +   L   E  +L W+ 
Sbjct: 824  KKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWIS 883

Query: 848  INTSK--RNQKPPSKDNP----------KTMEPEEINMIQSFLRFNFDEISSFKASLNIL 895
            I  SK  R+   PS  +           K ++PE IN+IQ+FL+FN +E+++   +L +L
Sbjct: 884  IEESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVL 943

Query: 896  RKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFT--NHNMFSD---LALAEL 950
             K++IF++LK+ D  D       + + + N E      + F   + + + D   + L  L
Sbjct: 944  SKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESL 1003

Query: 951  LEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATD-- 1008
             E +SF  +CT++L   V+ I+  KI  WWK YGE L L K Y K FP+ V     TD  
Sbjct: 1004 HEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLL 1063

Query: 1009 ------------------TPSHI-------------PLGSFIETKREQSEQRLAVQIKAS 1037
                              +P  +                + IE ++ + E++ +  I  +
Sbjct: 1064 SGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDET 1123

Query: 1038 SKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFATTNIGIFQEYI 1090
              +L+ LGS +   HE LAEEL+ YMEF+     +  +  F   +I + +E++
Sbjct: 1124 ISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHV 1176

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  511 bits (1317), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/289 (82%), Positives = 264/289 (91%)

Query: 1   MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60
           MSVYHLPTLLNPL+NAIFNCPEPE+SPLKKLFANLKTRRFILLAPP  +LLNYHDVK+KL
Sbjct: 1   MSVYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKL 60

Query: 61  PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120
           PLH+LCYN +FINS+ILL TENSY+NT  RDSHYETLDGK VVIQWKNN+IHALNGF IR
Sbjct: 61  PLHDLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIR 120

Query: 121 QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180
           +RLKILETK+LPNFNDYFEGAADF ILFIDQPLNCE  PNDYL+CF +YE++PKNA ++ 
Sbjct: 121 RRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMP 180

Query: 181 NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240
           NL ++S++QERSSF+NILHIH ARL QLGQLFS+YR LAP DDPS+ +FE IVQQ+FDGM
Sbjct: 181 NLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFESIVQQAFDGM 240

Query: 241 KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYF 289
           KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRL THFKG+EVDTEK   F
Sbjct: 241 KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDTEKINIF 289

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  503 bits (1295), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 356/1105 (32%), Positives = 578/1105 (52%), Gaps = 94/1105 (8%)

Query: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63
            YHLP LLNPL+NAIFNCP P+ S LK++F+ L   RF +L P    LL + D+++ L L 
Sbjct: 3    YHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELA 62

Query: 64   ELCYNVDFINSHILLT---TENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120
            ELCY+ DF+ SHI++    T++     ++ ++ + TL+G+ + I+++N+ I   +GF  R
Sbjct: 63   ELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTER 122

Query: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180
            +++ I E  +LP FNDY +G+    IL I  PL  ++ P D L+ F        + Q  +
Sbjct: 123  RKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQEQA 182

Query: 181  NLPVNS-------YEQERSSFDNI-------LHIHSARLAQLGQLFSNYRRLAPNDDPSK 226
             LP +        +EQ   S  ++        H+  AR+ +   +           D  +
Sbjct: 183  PLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDSIR 242

Query: 227  KMFEDIVQQSFDGMKSDSLFKNFSNLYDL---IHDYFELNLYDDIWSRLVTHFKGYEV-- 281
            ++               SL K  ++L DL   I+DY EL L+ DI  +L    +  E+  
Sbjct: 243  QII--------------SLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEH 288

Query: 282  --DTEKYKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSK 339
              D +  +  S+NQ+  +F+ KD K F L+ +  +E+ VN A ++ + + L  +++ K +
Sbjct: 289  RFDFKALRSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLE 348

Query: 340  ILVETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQ 399
            +L  T++ LS               +N ++ DADTLLSLFVL++CRS+   L   L YL 
Sbjct: 349  VLSTTMRLLS-------------REINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLT 395

Query: 400  NFSNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENP 459
            NF  + +S KFG+ GY +ST EA + +F       ++L K   S +K    + K S    
Sbjct: 396  NFEISETSIKFGLQGYVLSTFEAALSFFHQ--DTVDSLTKKCASNKKIWASIQKHSKV-- 451

Query: 460  TNEIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLD 519
              E E L++   NL+ R + G+S+LSICI +  N +L  +L  +E  FP+EDIL+D    
Sbjct: 452  --EAELLSS---NLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFA 506

Query: 520  GSTLLIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKS 579
             STLLI++++  N +AA IL  I+L +C+E E+ SY+N  + + R  AHY+  ++ +L+S
Sbjct: 507  LSTLLIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLES 566

Query: 580  IGSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDS 639
            +G Y +W+ K+ +G TPLF++FR+YD  NY+E+V    +    WY  +N  F++  H D 
Sbjct: 567  VGRYFNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDP 626

Query: 640  KGNSLLHILKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEK 699
            KGN+LLH++KS +  LL+L  +++N  + KGLTPLMIY +Y RI+NI+ I KD RL+ + 
Sbjct: 627  KGNTLLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDL 686

Query: 700  VQNSTFFTCFDYAKDHSVLSKIGERGARDSLFGL--VYLHSLRYHXXXXXXXXXXXXXXD 757
            VQ     T  D+ K+  V   I      D+ F    V +HSLR+                
Sbjct: 687  VQQPLVMTSLDFTKNPKVTKTI-----LDATFNREPVVIHSLRFEERKWKIGIFSEGIFK 741

Query: 758  KPFLTTVINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHK 817
            K       ++  IQ  LR +      +F P+    +E+  L    +  + +        K
Sbjct: 742  K------YSLDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKK 795

Query: 818  LTNCFNVLLFLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSF 877
            L   F+ +    K+   L  DE  +   + + T   ++     +    +EPEEIN IQ+F
Sbjct: 796  LDMLFSYVNTRGKLW--LGKDEEELKVLLDVPTPYLSE----SERFIKLEPEEINGIQTF 849

Query: 878  LRFNFDEISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFT 937
            L++N  E    +  L IL+K+ I   +K  D     +S   +G ++     A +F    T
Sbjct: 850  LKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFEN--T 907

Query: 938  NHNMFSDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAF 997
            N     DL+  E   ++ +LE   + L    +++L  K T WWKH+GE + L+K ++K F
Sbjct: 908  NCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNF 966

Query: 998  PSVVKPKSATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAE 1057
            P+   P S+ +      + ++IE KR +   +L+ Q+K SS  LK++G EI T HE +A 
Sbjct: 967  PNDKAPPSSANRNF---IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAV 1023

Query: 1058 ELSNYMEFR---------KACLDQR 1073
             ++ ++EF+         K+ +DQR
Sbjct: 1024 GINLFIEFKEQFYHDHIVKSIVDQR 1048

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  432 bits (1112), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 365/1214 (30%), Positives = 597/1214 (49%), Gaps = 181/1214 (14%)

Query: 9    LLNPLINAIFNCPEPE--KSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKT-------- 58
            +LNPLI  +F+    +    PLKKLF  LK  +F+LLAPP   LLNY D           
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 59   ---KLPLHELCYN-VDFINSHILLTTENSYLNTTLRDSH--YETLDGKAVVIQWK----- 107
                 PL +LC N  DFI SHILL     Y +  +++     E+++GK + I+       
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILL-----YDSKVIKNDQCVMESINGKTITIKRVTGNGA 119

Query: 108  -NN-----IIHALNGFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPND 161
             NN     I  + N    ++ LKI++  +  NFN Y +G  ++ I +ID PL   +  N+
Sbjct: 120  LNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNE 179

Query: 162  YLKCFD----SYEEVPKNAQSVSNLPVNSYEQ---------------------------- 189
            +L  FD      E+    AQ V++L   + +Q                            
Sbjct: 180  FLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKD 239

Query: 190  ERSSFDNILHIHSARLAQLGQLFSNYRRLAPND-DPSKKMFEDIVQQSFDGMKSDSLFKN 248
            +R  +  +++ + A    + Q     + +  N  D + +M  DI    F+ +K +  +  
Sbjct: 240  DRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNF 299

Query: 249  FS--NLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS-KDFKE 305
             S  NL +LI+++ E+ L+DDIW R+   F   + D  K    SVN+LL +F+S  +FK 
Sbjct: 300  LSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKN 359

Query: 306  FKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNGL 365
            FKL DI  +E++++ A  +FQK     ++ EKS  L++TLQ L+               +
Sbjct: 360  FKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT---------------I 404

Query: 366  NSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVC 425
            N LT DADTL+ L  +V+CR + ++LKSHL+YLQNF+ +P++ KFGILGY+ISTLEA+  
Sbjct: 405  NKLT-DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITY 463

Query: 426  YFEDFDKNNENLAKANVSYQKTRELL---DKLSSENPT--NEIENLATYEDNLQYRNEQG 480
            YF+            ++S+    +L+   DKL +   T  N I++L    D L YR++ G
Sbjct: 464  YFD------------HISHSHKADLIAFCDKLHNLYDTILNNIKSLDN--DILSYRSQNG 509

Query: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540
            +S+LS+CI N K  I L++LT YE  FP+EDIL+D  L+GS+LL+++ K  N  A++IL+
Sbjct: 510  ESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILV 569

Query: 541  GIMLLNCSEGELVSYVNKADKYARTVAHY--LTHEMDILKSIGSYVDWKRKNSSGQTPLF 598
             I+  +C+E EL  ++NK DK+ R+VAHY  + + + IL   G+ +DW+ K+    TPL 
Sbjct: 570  TILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLL 629

Query: 599  SIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQ- 657
            +IF+ +     E  +KI F +  +WY+ HN  F+   H D  GN+LLH++K  ++ L++ 
Sbjct: 630  TIFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIEN 689

Query: 658  ---LSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKD 714
                  ++IN  N KGL+P M+Y K  R  NI  I K+  LI  + Q     T  +   +
Sbjct: 690  PELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-N 748

Query: 715  HSVLSKIGERGARDSLFGLVYLHSLRYHX-XXXXXXXXXXXXXDKPFL------------ 761
              V   +     R   F  + LHSLR++               D   L            
Sbjct: 749  SKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPS 808

Query: 762  ---TTVINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTI------------- 805
               T  + +KTI+ LL   ++  +++ LPL S ++  + L +S+ +I             
Sbjct: 809  ICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSL 868

Query: 806  -IGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASVLYWMRINTSK------------ 852
             I K +++  L  ++NC N L         L  DE  +  +++IN  K            
Sbjct: 869  LIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSH 928

Query: 853  RNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILIFLSLKSNDFEDT 912
            +N    + +  K  +PE+IN IQ+F++FN  E+ +FK ++  ++ + I +  K  D   +
Sbjct: 929  KNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSS 988

Query: 913  YDSLREMGRKI-INGEA-------------ADAF-ARIFTNHNMFSDLA--LAELLEHVS 955
                ++   KI IN  +              +A+ +R F ++N +      L +LLE++ 
Sbjct: 989  QFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLI 1048

Query: 956  FLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPL 1015
            F E+   +L    + +    I  WW HYG  L  +  Y K +P+        D  ++   
Sbjct: 1049 FFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDINNNFES 1103

Query: 1016 GSFIETKR------EQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKAC 1069
             + +  KR         E+ + + IK +S +L+   ++I   HE LA EL+N+M F+   
Sbjct: 1104 FNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKF 1163

Query: 1070 LDQRTIVAFATTNI 1083
            + +  I+ F+T  +
Sbjct: 1164 I-REYIIKFSTIEV 1176

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  330 bits (845), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 271/845 (32%), Positives = 437/845 (51%), Gaps = 104/845 (12%)

Query: 260  FELNLYDDIWSRLVTHFKGYEVDTEKYK--YFSVNQL-LADFFSKDFKEFKLSDITFIER 316
            FE  LY  IW++LV H      + +K+   Y S ++L + D++S  F +F L D+ FIE 
Sbjct: 178  FEARLYSSIWNKLV-HQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIEN 236

Query: 317  RVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNGLNSLTMDADTLL 376
             V++A K F KL  + S+ EK  IL+ T   L+          +LP     L +DAD LL
Sbjct: 237  VVDLACKEFVKLRESLSFDEKIDILLSTFNILTS---------KLP----QLEIDADNLL 283

Query: 377  SLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNEN 436
            +  ++++ R +  +L  H +YLQNF N   +  FGIL YAISTL AV+ Y +    NN  
Sbjct: 284  NFMLIIINRVKLNNLNEHFHYLQNF-NFKQNKDFGILNYAISTLGAVLYYID----NN-- 336

Query: 437  LAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQGQSILSICITNTKNCIL 496
                          LDK   +  T+ I++    E+ L+YRNE G+S L  CI    N  L
Sbjct: 337  --------------LDKF--KRYTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTL 380

Query: 497  LDVL--TEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILIGIMLLNCSEGELVS 554
             ++L  +EY   FPMEDIL+D+T+DGSTLL+ ++K  N  AA ILI I++ N +  E+ +
Sbjct: 381  RELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRT 440

Query: 555  YVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNS-SGQTPLFSIFRTYDQP--NYEE 611
            YVN  D+  R V H++T++  +L  IG Y++W  K+  +GQTPLF+IFR+YDQ   +Y++
Sbjct: 441  YVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKK 500

Query: 612  MVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSKLDINGRNYKGL 671
            M + +F  A       +  F    H D+  N+LLHILK+++ ++L  + L IN  N  G+
Sbjct: 501  MSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGM 555

Query: 672  TPLMIYVKYKRISNIDAIT----KDSRLILEKVQ-NSTFFTCFDYAKDHSVLSKIGERGA 726
            TPLM++ KY+R+ NI  +     KD   I E  Q ++ +  CF    D  +L+ +G+   
Sbjct: 556  TPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAI 615

Query: 727  RD-SLFGLVYLHSLRY------HXXXXXXXXXXXXXXDKPFLTTVINMKTIQGLLRSILK 779
            ++ S+FG  + HSL+       H              +K + T   N+KTI+ L+  +L 
Sbjct: 616  KNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLT 675

Query: 780  DNQF--TFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFT 837
             N    +FLPL    +E++ +     ++I        ++ L    + +LFL+ VP+  F 
Sbjct: 676  SNSHVSSFLPLYKVFNELNGI----ASMISTKSKILFINNLNVILDTILFLELVPREGFI 731

Query: 838  DEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK 897
             EA +  ++R   ++R  K  +  + K ++ E+INMI +FL+FN +E+++FK  +  + +
Sbjct: 732  LEARLKDYLR---NQRKIKTVATKSKK-LQIEDINMISNFLKFNLNELNAFKNGVKKILR 787

Query: 898  ILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFL 957
             +  ++LK  D   +Y  L             D    +   +N   +L    L+ +   L
Sbjct: 788  QMNSINLKLFDQRISYMDLL---------HCPDVVVHL---NNPLWNLNYNILISNFQIL 835

Query: 958  EQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGS 1017
            E        F++    +KI KWWK   E + L              K A+++   + L S
Sbjct: 836  ENSIDNTLHFLKVFQNEKIRKWWKLNNELINL-------------TKLASNSDDDL-LRS 881

Query: 1018 FIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVA 1077
            F   K     ++L+++I    + + EL  +IF +HE LA E++N+M+F K     RT+V 
Sbjct: 882  FFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKF-KPLFITRTLVV 935

Query: 1078 FATTN 1082
            +A  N
Sbjct: 936  WAHRN 940

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 93/236 (39%), Gaps = 24/236 (10%)

Query: 266 DDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHF 325
           DDI+  L    KG             N ++AD+ S+DF+    + +  I   +N  S  F
Sbjct: 101 DDIYDSLWWLMKG-------------NDIIADYKSQDFEADVQNKVAQI---LNARSNTF 144

Query: 326 QKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVL-VVC 384
           Q+ T +     K    V + +     +E       L +      + ++  L L    V C
Sbjct: 145 QRATESWQLEIKPCSHVTSFETPVNKSEC------LSDVCVECKLGSNLWLCLHCGNVGC 198

Query: 385 RSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAK-ANVS 443
             +Q  ++ H + L +F  NP       LG   +T   + CYF D +   ++L K  NV 
Sbjct: 199 GRQQVGIEGHSHALTHFEENPEHPLAVKLGSLSNTSADIYCYFCDDEVQFQDLDKWHNVL 258

Query: 444 YQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDV 499
                 + DK++ E    E++       + Q  + QG  +  +  +    C LL++
Sbjct: 259 EHWGINIRDKVAQEKSLVELQVEQNASWDFQMVDSQGHELHHLRSSKRYGCGLLNL 314

>TBLA0D04330 Chr4 complement(1072027..1072827) [801 bp, 266 aa] {ON}
           Anc_1.424 YCR009C
          Length = 266

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 33/75 (44%), Gaps = 4/75 (5%)

Query: 597 LFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHT--DSKGNSLLHILKSDVSI 654
           L S+   Y  P++E +VKI        Y +      YLD    D   N LL    SD  +
Sbjct: 194 LISLRVPYYDPSFEALVKIQMRFCTDGYTRLAQIQQYLDQQSRDDYANGLLDDRISD--L 251

Query: 655 LLQLSKLDINGRNYK 669
           L Q+S LDI    YK
Sbjct: 252 LQQMSSLDICALGYK 266

>KLLA0D10263g Chr4 complement(868131..869444) [1314 bp, 437 aa] {ON}
           similar to uniprot|P54787 Saccharomyces cerevisiae
           YML097C
          Length = 437

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 366 NSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVC 425
           N L   AD  + L +  + +S+  HL S++ Y++ F     S   G   Y +STL+  V 
Sbjct: 217 NKLNGGADHFVPLLIFTLLKSDVPHLISNVRYIERFRF--PSFLMGENAYYLSTLQGAVN 274

Query: 426 YFEDFDKNNENLAKANVSYQK 446
           +  D D ++ ++ + +  + K
Sbjct: 275 FILDMDIDSISILETDKDFNK 295

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 120,200,226
Number of extensions: 5660120
Number of successful extensions: 20644
Number of sequences better than 10.0: 87
Number of HSP's gapped: 21175
Number of HSP's successfully gapped: 91
Length of query: 1090
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 970
Effective length of database: 39,721,479
Effective search space: 38529834630
Effective search space used: 38529834630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)