Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.1485.526ON77977929970.0
YML006C (GIS4)5.526ON77478223690.0
Smik_13.1455.526ON77477923530.0
Suva_13.1565.526ON77278323420.0
NCAS0H025505.526ON7433355987e-66
NDAI0C010705.526ON7571585652e-61
TDEL0A039005.526ON6711385164e-55
CAGL0K07271g5.526ON7761495161e-54
KNAG0B037105.526ON7111334902e-51
KLTH0G03740g5.526ON6311544599e-48
SAKL0G04906g5.526ON6081334526e-47
Kwal_47.186465.526ON6351324377e-45
ZYRO0D12540g5.526ON5481414259e-44
KAFR0C053905.526ON4551334084e-42
TBLA0D016605.526ON8661403959e-39
KLLA0A01782g5.526ON5281343797e-38
Kpol_1023.995.526ON5512412619e-23
Ecym_40615.526ON663912173e-17
NCAS0F010805.526ON3791212016e-16
TPHA0K005405.526ON675921951e-14
ADR198C5.526ON549931806e-13
NDAI0H015905.526ON371901769e-13
KNAG0C032405.526ON324571010.001
TBLA0G009405.526ON782129990.004
Kpol_1056.112.560ON50047742.6
CAGL0J06842g8.620ON50462743.3
KLTH0F16698g5.405ON67633708.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.148
         (779 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...  1159   0.0  
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   917   0.0  
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   910   0.0  
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   906   0.0  
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   234   7e-66
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   222   2e-61
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   203   4e-55
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   203   1e-54
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   193   2e-51
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   181   9e-48
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   178   6e-47
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   172   7e-45
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   168   9e-44
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   161   4e-42
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   156   9e-39
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   150   7e-38
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   105   9e-23
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    88   3e-17
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    82   6e-16
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    80   1e-14
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    74   6e-13
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               72   9e-13
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      44   0.001
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    43   0.004
Kpol_1056.11 s1056 (27423..28925) [1503 bp, 500 aa] {ON} (27423....    33   2.6  
CAGL0J06842g Chr10 complement(657226..658740) [1515 bp, 504 aa] ...    33   3.3  
KLTH0F16698g Chr6 (1354232..1356262) [2031 bp, 676 aa] {ON} weak...    32   8.8  

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score = 1159 bits (2997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/779 (77%), Positives = 603/779 (77%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHGXXXXXXXXXXGQLKPNTLDDQWSX 180
           LNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHG          GQLKPNTLDDQWS 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHGSTISSSKTSTGQLKPNTLDDQWSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXADLSLTPTNGDNNNNDVLQSXXXXXXXXXXXXXXTSS 240
                                  ADLSLTPTNGDNNNNDVLQS              TSS
Sbjct: 181 INTQTSTATRTNTNTRTLTSPDTADLSLTPTNGDNNNNDVLQSNENENAEEDAGEDATSS 240

Query: 241 IVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLSLT 300
           IVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLSLT
Sbjct: 241 IVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLSLT 300

Query: 301 TARRXXXXXXXXXXXXXXHYNRNSDGFHDEGNEQVSLGIEXXXXXXXXXXXXXXXXXXXX 360
           TARR              HYNRNSDGFHDEGNEQVSLGIE                    
Sbjct: 301 TARREDANDENDENESEDHYNRNSDGFHDEGNEQVSLGIESCVSYSSCSSSSIGSSVRYS 360

Query: 361 XXXNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYIXX 420
              NRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYI  
Sbjct: 361 LSGNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYISG 420

Query: 421 XXXXXXXXXXXXXXXXXXXVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 480
                              VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS
Sbjct: 421 EEDGEGADEDEDISSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 480

Query: 481 NNKPTMASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIE 540
           NNKPTMASVTDDWLLYDSNFSM              KRSFPKILFYTMVIVTDSGHQQIE
Sbjct: 481 NNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTDSGHQQIE 540

Query: 541 EEHKSSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQ 600
           EEHKSSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNI              ASLSEQ
Sbjct: 541 EEHKSSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIDYDEYTDDEDEGDDASLSEQ 600

Query: 601 SGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660
           SGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN
Sbjct: 601 SGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660

Query: 661 SLGEPYPMAQLXXXXXXXXXXXHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAMSAV 720
           SLGEPYPMAQL           HLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAMSAV
Sbjct: 661 SLGEPYPMAQLSNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAMSAV 720

Query: 721 ERXXXXXXXXXXXXXXGIDNHTHGANKDRKRWKFQMXXXXXXXXXXXXXXXXXPRCAIM 779
           ER              GIDNHTHGANKDRKRWKFQM                 PRCAIM
Sbjct: 721 ERSKSLPLPTLLKSLSGIDNHTHGANKDRKRWKFQMNRFRNNKNNNSTNTDKSPRCAIM 779

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/782 (63%), Positives = 532/782 (68%), Gaps = 11/782 (1%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD N SA
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHGXXXXXXXXXXGQLKPNTLDDQWSX 180
           LNNFQDPTFLEFASTSWQVQKNSK LNNNNR  +            G+L+ N  DDQWS 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRNSIPPPTISSSKASNGKLESNVSDDQWSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXADLSLTPTNGDNNNNDVLQSXXXXXXXXXXXXXXTSS 240
                                   D+++T  N  +NNND  Q               TSS
Sbjct: 181 INTQTSTATRTNTNTRTLTSPDTVDINVTSVNSQSNNNDTPQD----NENEVDEEDATSS 236

Query: 241 IVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLSLT 300
           IVLNFSHSRT+ SK NRLPKI PSYTNEDYTPSHSEI+SIDSF GED SSTYPGQDLSLT
Sbjct: 237 IVLNFSHSRTVDSKPNRLPKIFPSYTNEDYTPSHSEIMSIDSFAGEDVSSTYPGQDLSLT 296

Query: 301 TARRXXXXXXXXXXXXXXHYNRNSDGFHDEGNEQVSLGIEXXXXXXXXXXXXXXXXXXXX 360
           TARR              HY+R S    DE  +Q S  +E                    
Sbjct: 297 TARR---EDESGQDEVEDHYSRVSHDLGDESIDQASYSMESSVSYTSYSSSSNSSSAHYS 353

Query: 361 XXXNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYIXX 420
              + R + +  N+DHTNATYVSELSSITSSIDNLTTSTTPEEE+NL+ +NYDA+ Y   
Sbjct: 354 LSSSSRGNPKRENIDHTNATYVSELSSITSSIDNLTTSTTPEEEDNLIHHNYDAQGYGSG 413

Query: 421 XXXXXXXXXXXXXXXXXXXVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 480
                              VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS
Sbjct: 414 EDDGEEVYDDEDLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 473

Query: 481 NNKPTMASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIE 540
           NNKPTMASVTDDWLLYDSNFSM              KRSFPKILFYTMVIVT+SG +Q+E
Sbjct: 474 NNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSG-KQVE 532

Query: 541 EEHKSSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIXXX---XXXXXXXXXXXASL 597
           EE K+ ++      SKE+PL+SELSL++DPQQYFPTAYN                  ASL
Sbjct: 533 EEFKNPNYDNREGISKEQPLDSELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASL 592

Query: 598 SEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGV 657
           SEQSGPQMY+PTRM SNVTTAHRSIRTVNSIGEWAFNRHNSVTKI+KS+SNELDNSK G 
Sbjct: 593 SEQSGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGE 652

Query: 658 NRNSLGEPYPMAQLXXXXXXXXXXXHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAM 717
           +     EP+PM QL           H LK KNS+K  S+  N SNSKNELKKIK+SINAM
Sbjct: 653 STVLSSEPHPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAM 712

Query: 718 SAVERXXXXXXXXXXXXXXGIDNHTHGANKDRKRWKFQMXXXXXXXXXXXXXXXXXPRCA 777
           SAVER              GIDN TH  NKDRKRWKFQM                  RCA
Sbjct: 713 SAVERSKSLPLPTLLKSLSGIDNPTHATNKDRKRWKFQMNRFKNHKNSGSAGTDKSQRCA 772

Query: 778 IM 779
           IM
Sbjct: 773 IM 774

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/779 (62%), Positives = 528/779 (67%), Gaps = 5/779 (0%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD + S 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           R NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
Sbjct: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHGXXXXXXXXXXGQLKPNTLDDQWSX 180
           LNNFQDPTFLEFASTSWQVQKNSK LNNNNR L+H           GQLK +T D+QWS 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXADLSLTPTNGDNNNNDVLQSXXXXXXXXXXXXXXTSS 240
                                  AD+ LT  N  +NN  V Q               TSS
Sbjct: 181 INTQTPTGTRTNTNTRTITSPNTADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSS 240

Query: 241 IVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLSLT 300
           IVLNFSHSR L  K +RLPKI P YTNE+YTPSHSEIVSIDSF GED SSTYPGQDLSLT
Sbjct: 241 IVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLT 300

Query: 301 TARRXXXXXXXXXXXXXXHYNRNSDGFHDEGNEQVSLGIEXXXXXXXXXXXXXXXXXXXX 360
           TAR               HYNR S+  +D+   Q+ L +E                    
Sbjct: 301 TAR---CEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNMESSVSCTSCSSSSSSSIRYSL 357

Query: 361 XXXNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYIXX 420
              +R  SL+  + DHTNATYVSELSSITSSIDNLTTSTTPEEE++L+ +NYDA+ Y   
Sbjct: 358 SSTSRA-SLKRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYASR 416

Query: 421 XXXXXXXXXXXXXXXXXXXVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 480
                              VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS
Sbjct: 417 EDEVEEVDDDADLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 476

Query: 481 NNKPTMASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIE 540
           NN+PT+ASVTDDWLLYDSNFSM              KRSFPKILFYTMVIVT+SG QQIE
Sbjct: 477 NNRPTIASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTESG-QQIE 535

Query: 541 EEHKSSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQ 600
           EE K+ ++    D  KE+PLNS+L LSHDP+QYFP AYN               ASLSEQ
Sbjct: 536 EEPKNPNYGTREDMLKEQPLNSDLLLSHDPKQYFPNAYNNDYDEYIDDEDDDDDASLSEQ 595

Query: 601 SGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660
           SGPQMY+PTRM SNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKS+SNE D+S+   +R 
Sbjct: 596 SGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDDRL 655

Query: 661 SLGEPYPMAQLXXXXXXXXXXXHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAMSAV 720
           S  EPYPM Q+           H LKKKN+ K+ S+  N SNSK+ELKKIK SINAMSAV
Sbjct: 656 SSDEPYPMTQISNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAMSAV 715

Query: 721 ERXXXXXXXXXXXXXXGIDNHTHGANKDRKRWKFQMXXXXXXXXXXXXXXXXXPRCAIM 779
           ER               IDN+THG NKDRKRWKFQM                  RC +M
Sbjct: 716 ERSKSLPLPTLLKSLSSIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM 774

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/783 (63%), Positives = 537/783 (68%), Gaps = 15/783 (1%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD NTS 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKTL-NNNNRYLMHGXXXXXXXXXXGQLKPNTLDDQWS 179
           LNNFQDP+FLEFASTSWQVQKN K+L NNNNR+L+H            QLKPNTLDDQ  
Sbjct: 121 LNNFQDPSFLEFASTSWQVQKNPKSLNNNNNRHLIHASTASSSKPSNAQLKPNTLDDQLL 180

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXXADLSLT-PTNGDNNNNDVLQSXXXXXXXXXXXXXXT 238
                                   AD SLT P   +  +ND+ Q+               
Sbjct: 181 DINTQTSMTARTNTNTKTLTYTDTADPSLTQPECNNKGDNDMPQNNENENEEEDAGDDAA 240

Query: 239 SSIVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLS 298
           SSIVLNFSH RTLASKANR PKI PSYTNEDY PSHSEIVSIDSF GED SSTYPGQDLS
Sbjct: 241 SSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDLS 300

Query: 299 LTTARRXXXXXXXXXXXXXXHYNRNSDGFHDEGNEQVSLGIEXXXXXXXXXXXXXXXXXX 358
           LTTARR                +R+S+GF DE  E+ S  IE                  
Sbjct: 301 LTTARREDKDDE----------DRSSNGFDDESFEETSSSIESSVNYTNCSSSSNSSIVR 350

Query: 359 XXXXXNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYI 418
                + R SL  G+VDHTNATYVSELSSITSSI+N+T STTPEEE++LV+NNYD REYI
Sbjct: 351 YHFNSSSRGSLGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTREYI 410

Query: 419 XXXXXXXXXXXXXXXXXXXXXVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIR 478
                                +LSILPSISICDSLGYFRLVLQSILIQ+PDTKEIFTAIR
Sbjct: 411 SGEEDEEEVDDEEDISSSDYSILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIR 470

Query: 479 QSNNKPTMASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQ 538
           QSNN+PT+ASVTDDWLLYDSNFSM              KRSFPKIL YTMVIVT+SG QQ
Sbjct: 471 QSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILLYTMVIVTNSGQQQ 530

Query: 539 IEEEHK--SSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXAS 596
           IEEE+   +  HR  VD ++E+P NSELSLS+DPQ+YFP+ ++               AS
Sbjct: 531 IEEENTNLNQQHR-EVDLTEEKPPNSELSLSNDPQRYFPSTFDDDYDEYIDDDDGGDDAS 589

Query: 597 LSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEG 656
           LSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKS SNE DN KE 
Sbjct: 590 LSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKEC 649

Query: 657 VNRNSLGEPYPMAQLXXXXXXXXXXXHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINA 716
            +R S  EPYPM QL           HLLK KNSYK  S+  N SNSKNELKKIKTSINA
Sbjct: 650 GDRISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINA 709

Query: 717 MSAVERXXXXXXXXXXXXXXGIDNHTHGANKDRKRWKFQMXXXXXXXXXXXXXXXXXPRC 776
           MSAVER              G+DNHT   NKDRKRWKF+M                  RC
Sbjct: 710 MSAVERSKSLPLPTLLKSLSGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRC 769

Query: 777 AIM 779
           AIM
Sbjct: 770 AIM 772

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  234 bits (598), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 182/335 (54%), Gaps = 70/335 (20%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           MQKSVRV DYFDNDDNGLWSWYLTN+RLGDFEE+ GNQLKYTLLKRFLNSHFY + + +A
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 61  ---------------------RPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHI 98
                                +PN +KILLVSIP+ VH D+SILE FL+DYFHLE LE I
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 99  QISKLTHSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHGXX 158
           QI +LT S CYNHENHYLLTD +NNF DP FLEFA ++WQ +   K L+ NN +L H   
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNWQAR---KNLHLNN-HLDH--- 173

Query: 159 XXXXXXXXGQLKPNTLDDQWSXXXXXXXXXXXXXXXXXXXXXXXXADLSLTPTNGDNNNN 218
                    ++ P ++D   +                            +TP   +  N 
Sbjct: 174 -----RDDDRISPQSIDTHSALNKNDDQILVTQPIDSTL----------VTPETREKENL 218

Query: 219 DVLQSXXXXXXXXXXXXXXTSSIVLNFSHSR---------TLASKANRLPKILPSYTNED 269
           D +                 SSIVLNFSH+R          +  +  +  K  P   N  
Sbjct: 219 DDID-------------VGGSSIVLNFSHTREHRKDKDPLNMVKQEEQSNKFSP---NMM 262

Query: 270 YTPSHSEIVSIDSFTGEDASSTYPGQDLSLTTARR 304
           +TP  SE+VSI+SF   D S  Y G  L LT  R+
Sbjct: 263 FTPPQSELVSINSFDDGD-SMNYNGHPLKLTLTRQ 296

 Score =  196 bits (498), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 134/217 (61%), Gaps = 23/217 (10%)

Query: 440 VLSILPSISICDSL-GYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDS 498
           VLSILPSISI D++ G+FRLVLQSILIQ P TKEI+TAIRQSNN+PT+A + DDWLLYDS
Sbjct: 419 VLSILPSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDS 478

Query: 499 NFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGTV------ 552
            FSM               RSFPKILFY+MVIVTD+ HQ I+    ++    T       
Sbjct: 479 QFSMDNLQILTLQDLLDTNRSFPKILFYSMVIVTDAHHQPIQGPTSTAGPDLTTSYLSNK 538

Query: 553 ------DTSKEEPLNSELSLSHD-----PQQYFPTAYNIXXXXXXXXXXXXXXASLSEQS 601
                 D + +   N    ++ D     PQQ+FP                    SL E++
Sbjct: 539 LESIAGDETNQRFENRYYPMADDQVEDQPQQFFP-----QEDDHDDDNMYDTDDSLMEEA 593

Query: 602 GPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNS 638
           GP+MYLPTRM +N TTAHRSIRTVNSIGEWAFNR+N+
Sbjct: 594 GPEMYLPTRMETNNTTAHRSIRTVNSIGEWAFNRNNT 630

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 122/158 (77%), Gaps = 16/158 (10%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTS- 59
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY +  T+ 
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 60  --------------ARPN-KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104
                          +P  KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 105 HSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKN 142
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPN 158

 Score =  184 bits (467), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 135/229 (58%), Gaps = 34/229 (14%)

Query: 440 VLSILPSISICD-SLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDS 498
           VLSILPSISI D + G+FRLVLQS LIQ+P TKEIFTAIRQSNN+PT+A +TDDWLLYDS
Sbjct: 458 VLSILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDS 517

Query: 499 NFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEH--------------- 543
            F+M               R+FPKILFY+MVIV +S     +++H               
Sbjct: 518 KFAMDNLQILTLQDLLDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYLSN 577

Query: 544 ------KSSSHRG-TVDTSKEEPL---------NSELSLSHDPQQYFP-TAYNIXXXXXX 586
                 K+SS  G +++  K  P          N E+ ++  P+Q+FP    +       
Sbjct: 578 KLESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEM-IADVPEQFFPGPPSDDENGKGE 636

Query: 587 XXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNR 635
                    SL EQ GP+MYLPTRM +NVTTAHRSIRT NSIGEWAFNR
Sbjct: 637 DYDDDYDDESLMEQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 41/75 (54%), Gaps = 13/75 (17%)

Query: 239 SSIVLNFSHSRTLASKANRLPK--IL------PSYTNEDYTPSHSEIVSIDSFTGEDASS 290
           SSIVLNF H R    K ++ PK  I+      P   N+ YTP  SE+VSI+SF  +D +S
Sbjct: 251 SSIVLNFPHLR----KHSKDPKQTIINEQQEEPLANNQYYTPPQSELVSINSFGDDDTNS 306

Query: 291 -TYPGQDLSLTTARR 304
             Y G  L L   R+
Sbjct: 307 MAYQGHPLHLVLTRQ 321

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  203 bits (516), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 111/138 (80%), Gaps = 3/138 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTS- 59
           MQKS++V DYFDNDDNGLWSWYL+++R GDFEE   N+LK TLL+RFLNSHF  D N S 
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHF--DSNRSH 58

Query: 60  ARPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119
              N KIL VSIP+ VH D+S+LE FL+DYFHLE LEHI+I+KLT S  YNHENHY+L D
Sbjct: 59  YGQNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILID 118

Query: 120 NLNNFQDPTFLEFASTSW 137
            LNNF DPTFL+FAST W
Sbjct: 119 KLNNFDDPTFLQFASTRW 136

 Score =  193 bits (490), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 99/200 (49%), Positives = 126/200 (63%), Gaps = 14/200 (7%)

Query: 443 ILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSM 502
           ILPSISI D+ G++RLV+QS L+QDP+TKEI+TAIRQSNN+PT+A V DDWLLYDS FSM
Sbjct: 386 ILPSISISDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSM 445

Query: 503 XXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGTVDTSKEEP-LN 561
                          RSFPKI+FY+M++V+D   + ++  +  +    T D S   P  +
Sbjct: 446 NNLQMLTLQELLDMNRSFPKIIFYSMIVVSDEQQELLQWSNGMTQKEDTADASSSIPRAD 505

Query: 562 SELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRS 621
           S  S+S DPQQ++                     SLSEQSGP MY PTR+ SN +TAHRS
Sbjct: 506 SYASMSRDPQQFYANM-------------DDDDTSLSEQSGPMMYAPTRLQSNTSTAHRS 552

Query: 622 IRTVNSIGEWAFNRHNSVTK 641
           IRTVNSIG+WAF   N   +
Sbjct: 553 IRTVNSIGDWAFVHKNETKR 572

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  203 bits (516), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 120/149 (80%), Gaps = 3/149 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           M KSVRVGDY+ ND+NG+WSWYL+NLR GDFEE+I N+LKYTLLKRFLNS+  G+++  +
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPES 60

Query: 61  RP---NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLL 117
                NKK++ VSIPE+VH+DISILE+FL+DYFHL+ L++ QI KLT    Y+HENHY L
Sbjct: 61  PTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFL 120

Query: 118 TDNLNNFQDPTFLEFASTSWQVQKNSKTL 146
            D LNNF+DPTFLEF  ++W+++  + T+
Sbjct: 121 MDELNNFEDPTFLEFGKSNWKMEGTAGTV 149

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 110/199 (55%), Gaps = 11/199 (5%)

Query: 440 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 499
           +LSILPSISI D+LGYFRLVLQSILIQDP TKE+FTA+RQSNNKPT+A +TDDWLLYD+ 
Sbjct: 451 LLSILPSISIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAE 510

Query: 500 FSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGT---VDTSK 556
           FSM              K+ +PKILFYTMV++ D      E  +  +        +    
Sbjct: 511 FSMHNLQILTLQDIMTIKKDYPKILFYTMVVINDRSEIACEFPYNGAQFTKAPSPITNKS 570

Query: 557 EEPLNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVT 616
            E    EL    + Q YFP                     L +          R  SN+T
Sbjct: 571 HEVEKEELDQPTEVQAYFPGNGQAIKDSIKPNNRDSLTFDLCQAE--------RTKSNMT 622

Query: 617 TAHRSIRTVNSIGEWAFNR 635
           T HRSIRTVNSIG+W+ +R
Sbjct: 623 TTHRSIRTVNSIGDWSISR 641

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 239 SSIVLNFSHSRTLASKANRLPKILPS-YTNEDYTPSHSEIVSIDSF-TGEDASSTYPGQD 296
           SSIVLNFSH+R    +  ++  +L   Y ++ YTP  SE+VSI+S  + ED    Y GQ 
Sbjct: 306 SSIVLNFSHNRNAHKRKTKIDSLLGERYPSDFYTPPQSELVSINSCGSAED----YTGQS 361

Query: 297 LSLTTAR 303
           L L   +
Sbjct: 362 LRLMVTK 368

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  193 bits (490), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (78%), Gaps = 6/133 (4%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           MQKS+RV DY+DNDDNGLWSWYL N+R GDFEEL  N+LKYTLLKRFL +HF     TS 
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHF-----TSL 55

Query: 61  RP-NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119
              N KIL +SIP+ VH DIS+LE FLKDYFHLE L++I+I KLT S+CYNHENHYLLTD
Sbjct: 56  EGINSKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTD 115

Query: 120 NLNNFQDPTFLEF 132
            LNNF D  FL +
Sbjct: 116 TLNNFNDRKFLRY 128

 Score =  142 bits (359), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/201 (43%), Positives = 112/201 (55%), Gaps = 36/201 (17%)

Query: 442 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 501
           SILPSI+I D+ G+FRLVLQS+L+Q  D K IFTAIRQSNNK   A+V DDW+LYDS+FS
Sbjct: 460 SILPSITIKDTEGHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFS 518

Query: 502 MXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDS--GHQQIEEEHKSSSHRGTVDTSKEEP 559
           M                +  KILFY+M+IV D+      ++EE   ++H G V  ++   
Sbjct: 519 MNNLMMMTLRGLFNFSENMSKILFYSMIIVDDAETADDMLDEE---ATHSGDVSDTQ--- 572

Query: 560 LNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAH 619
                     PQ  F                     S S    PQMYLP + AS+ TTAH
Sbjct: 573 ----------PQLMF-----------------DEEDSDSGVQEPQMYLPQKTASHATTAH 605

Query: 620 RSIRTVNSIGEWAFNRHNSVT 640
           RSIRTVNSIGEWA+ + ++ T
Sbjct: 606 RSIRTVNSIGEWAYKKKSNAT 626

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  181 bits (459), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/154 (55%), Positives = 117/154 (75%), Gaps = 5/154 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   S 
Sbjct: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D+
Sbjct: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKTL--NNNNRY 152
           L+NF D +FLEF + S + + +++ L  ++NN+Y
Sbjct: 119 LSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQY 152

 Score =  139 bits (351), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 125/238 (52%), Gaps = 20/238 (8%)

Query: 442 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 501
           SI PSISI +  G FRLVLQSIL+  PDT+++FTA+RQSNN PT+A V DDWLLYD  FS
Sbjct: 319 SIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFS 378

Query: 502 MXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEH-----KSSSHRGTVDTSK 556
           M               + FPKILFY++V++++      ++ +     KS     +  T  
Sbjct: 379 MNNLQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDYYPSKPSKSPQPTASNSTIS 438

Query: 557 EEPLNSELSLSH---DPQQYFPT-AYNIXXXXXXXXXXXXXXASL----------SEQSG 602
           E  L  + +L+H   +   Y  T AYN                            SE   
Sbjct: 439 ENTLKVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEGVV 498

Query: 603 PQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660
             +Y  TR  SN +TAHRSIRT+ SIG+WAF+  +S  K++ +DS  L++S + V  N
Sbjct: 499 VPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDST-LEDSYQSVEGN 555

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  178 bits (452), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 102/133 (76%), Gaps = 3/133 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D     
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDI---V 57

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++DN
Sbjct: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117

Query: 121 LNNFQDPTFLEFA 133
           LNNF D +FL F 
Sbjct: 118 LNNFHDRSFLGFG 130

 Score =  156 bits (394), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 118/331 (35%), Positives = 144/331 (43%), Gaps = 76/331 (22%)

Query: 440 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 499
           + SI P+ISI D+ G FRLVLQSILIQ+PDT+EIFTA+RQSNN P +A + DDWLLYD  
Sbjct: 296 MASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEK 355

Query: 500 FSMXXXXXXXXXXXXXXKRSFPKILFYTMVI-----VTDSGHQQIE-EEHKSSSHRGTVD 553
           FSM               R FPKILFYTMV+     + D  H  I  + H     +G   
Sbjct: 356 FSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIAS 415

Query: 554 TSK---------------------EEPLNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXX 592
           TS                       E LN+  + + D + YFP                 
Sbjct: 416 TSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFP-------------EDNH 462

Query: 593 XXASLSEQSGPQ-MYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELD 651
                 E +G   +Y PTR  SN TTAHRSI TVNSIGEWAF+ HN              
Sbjct: 463 DDEDDQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFH-HN-------------- 507

Query: 652 NSKEGVNRNSLGEPYPMAQLXXXXXXXXXXXHLLKKKNSYKLGSRDKNGSNSKNELKKIK 711
                       EPYP                  K K     GS       SKN L+K  
Sbjct: 508 ------------EPYPQNNHSNISFADQNTSTAGKMKRVSSKGS-------SKNTLQK-T 547

Query: 712 TSINAMSAVERXXXXXXXXXXXXXXGIDNHT 742
           T++ ++SAVER              G+D+ T
Sbjct: 548 TTVGSLSAVERSKSTPLPTLLRTLSGLDDET 578

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  172 bits (437), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 100/132 (75%), Gaps = 3/132 (2%)

Query: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSAR 61
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   +  
Sbjct: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59

Query: 62  PNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNL 121
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ DNL
Sbjct: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119

Query: 122 NNFQDPTFLEFA 133
           +NF D +FLEF 
Sbjct: 120 SNFNDKSFLEFG 131

 Score =  140 bits (352), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 126/236 (53%), Gaps = 24/236 (10%)

Query: 442 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 501
           SI PSISI +  G FRLVLQSILIQ  DT++++TA+RQSNN PT+A V DDWLLYD  FS
Sbjct: 319 SIFPSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFS 378

Query: 502 MXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRG---TVDTS--K 556
           M               + FPK+LFY++++VTD      +E + S+SH+    TV TS   
Sbjct: 379 MNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLS 438

Query: 557 EEPL-------------NSELSL---SHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQ 600
           E  L             NS LS+   S     ++ TA                       
Sbjct: 439 ENTLKLQTTLTPSLTNTNSFLSMGVNSSSLTPFYATAQGSPDRANDEDDYFDDERDGKTD 498

Query: 601 SGP--QMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSK 654
            G   Q+Y  TR  SN +TAHRSIRT+ SIG+WAF+ H+S ++   S ++ L++ +
Sbjct: 499 DGEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFH-HDSTSRRTSSAASFLEDPR 553

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  168 bits (425), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 103/141 (73%), Gaps = 5/141 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL ++     N   
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLN--E 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115

Query: 121 LNNFQDPTFLEFASTSWQVQK 141
            NNF++  FL FAST+ Q  K
Sbjct: 116 ENNFKNSNFLHFASTNIQTGK 136

 Score =  127 bits (318), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 109/208 (52%), Gaps = 22/208 (10%)

Query: 440 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 499
           ++SILPSISI DS G+FRLVLQS+L  +P + EIFTAIRQSNNKPT A V DDWLLYDS 
Sbjct: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354

Query: 500 FSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGTVDTSKEEP 559
           FSM               +  PK+LFY++V V D+   + + + + ++   T  TS    
Sbjct: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLE-DADTECATISNTASTSLSSA 413

Query: 560 LNSELSLSHDPQQYFPTAYNIXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAH 619
             S  S+S +P+ +FP+  N                   + SG ++      +S  T  H
Sbjct: 414 PTS-TSVSCEPRVFFPSNVN------------------GDNSGCRLAKGNTNSS--TLGH 452

Query: 620 RSIRTVNSIGEWAFNRHNSVTKINKSDS 647
           RSI T NS  +W      S   I K DS
Sbjct: 453 RSIVTTNSAADWRRQSVESNASIRKYDS 480

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  161 bits (408), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/133 (60%), Positives = 101/133 (75%), Gaps = 5/133 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           M  SV++ DYFDND+NGLWSWYLTNLR G+FEELI N+LK +LLKRFL +    D N   
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQV--DINDQI 58

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
              KKILL+SIP+++  DI++LEIFL DYFHL  L +I+I KLT  + YNHENHYLL D+
Sbjct: 59  ---KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDS 115

Query: 121 LNNFQDPTFLEFA 133
           +NNF+D TFL + 
Sbjct: 116 VNNFKDETFLNYV 128

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (59%), Gaps = 2/92 (2%)

Query: 442 SILPSISIC-DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNF 500
           SILP +SI  +++G++RLVLQS+LI + +  ++ T +RQSNN    A++ DDW+LYD  F
Sbjct: 251 SILPCVSINNEAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKF 310

Query: 501 SMXXXXXXXXXXXXXXKR-SFPKILFYTMVIV 531
           SM                    KILFY+M+ V
Sbjct: 311 SMRNLNILSLKDLSIIGNVDSIKILFYSMIDV 342

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  156 bits (395), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 3/140 (2%)

Query: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARP 62
           K V+V DY+DND+NGLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D N++++ 
Sbjct: 7   KPVQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66

Query: 63  NK---KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119
           +    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126

Query: 120 NLNNFQDPTFLEFASTSWQV 139
            L+NF + +F     T  ++
Sbjct: 127 ILDNFGNTSFFIHDGTKQKI 146

 Score =  128 bits (322), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 112/214 (52%), Gaps = 24/214 (11%)

Query: 443 ILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSM 502
           ILPSISI DSLG+FRLVLQ ILI  P  ++ +TAIRQS++   +A + DDWLLYD  FSM
Sbjct: 499 ILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSM 558

Query: 503 XXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSG-----HQQIEEEHK------------S 545
                          R +PKILFYT+V + D+      ++ I E ++            S
Sbjct: 559 DNLEILTLQELLDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPS 618

Query: 546 SSHRGTVDTSKEEPLNSELSLSHDPQQYF---PTAYNIXXXXXXXXXXXXXXASLSEQSG 602
              R   D  K   +N+E + +     +     ++ +I                +    G
Sbjct: 619 GDDRNKKDNQK---INTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEG 675

Query: 603 PQMYLPTRMASNVTT-AHRSIRTVNSIGEWAFNR 635
            +MY P+++ SN TT AHRSIRTVNSIGEWAF+R
Sbjct: 676 LEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHR 709

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  150 bits (379), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 93/134 (69%), Gaps = 7/134 (5%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60
           M  SV+V DY++ND NGLWSWYL+NLR G+FEEL GN+LK+ LLKRFL   F      + 
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQF----QATG 56

Query: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEH--IQISKLTHSHCYNHENHYLLT 118
             NKK+LLVSIP+ +H+DI +LE FL +YFHL K +H  I I KLT    Y HENHYL+ 
Sbjct: 57  PLNKKLLLVSIPDEIHQDIKVLEEFLSEYFHL-KDDHTNIVIDKLTRGTVYKHENHYLIQ 115

Query: 119 DNLNNFQDPTFLEF 132
           D L NF D  FLE 
Sbjct: 116 DKLTNFNDEWFLEM 129

 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 120/261 (45%), Gaps = 26/261 (9%)

Query: 451 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMXXXXXXXX 510
           D+ G FRLVLQSILI + +T++IFT IRQS N  + A + DDWLLYD++F++        
Sbjct: 284 DNFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSL 343

Query: 511 XXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGTVDTSKEEPLNSELSLSHDP 570
                  +  PKILFY+M+ V DS     E    S  H  TV+ +     N  +   + P
Sbjct: 344 YDILDFSKFLPKILFYSMIHVKDSVDDNTE---LSLQHLITVNNTLT---NGNM---YSP 394

Query: 571 QQYFPTAYNIXXXXXXXXXXXXXXASLSEQSGPQMYLPTRMASNVTTAHRSIRTVNSIGE 630
            +   +   +               S++++    +Y P   A+  T  HRSIRTV SIG 
Sbjct: 395 HEVDDSMSELSSDNSIECYTGNSNDSIADEPVIGLYSP---ATAATAGHRSIRTVESIGA 451

Query: 631 WAFNRHNSVTKINKSDSNELDNSKEGVNRNSLG------EPYPMAQLXXXXXXXXXXXHL 684
           WA NR N+           ++  +  V+R+S G      +  PM  L            +
Sbjct: 452 WALNRSNT--------KKSMETVQNTVSRDSRGNFMNRIKSQPMPVLLQTLNSNIDEEAI 503

Query: 685 LKKKNSYKLGSRDKNGSNSKN 705
             KKN  K+ +R +  S S N
Sbjct: 504 KIKKNLAKVRARQRKKSTSHN 524

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  105 bits (261), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 121/241 (50%), Gaps = 32/241 (13%)

Query: 442 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 501
           ++LP++++ D    F+LVLQSILI + D+ E+ TAIRQSNN+   A + DDWLLYDS FS
Sbjct: 246 TVLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFS 305

Query: 502 MXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGTVDTSKEEPLN 561
           M               + +PKILFY++V + +        E+ S+ H        E+ +N
Sbjct: 306 MTNLQILSLNELLHINKDYPKILFYSLVSIPNVTVNISNYENSSNPHL-------EDYIN 358

Query: 562 -SELSLS-HD-PQQYFPTAYNIXXXXXXXXXXXXXXAS---LSEQSGPQ------MYLPT 609
            S+ SLS HD PQQ++P   N                S     + S PQ      M +PT
Sbjct: 359 HSDDSLSIHDTPQQFYPMIVNDNNNNININNHNNTRRSSVDYYDDSIPQQFYPDDMNIPT 418

Query: 610 RMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRNSLGEPYPMA 669
           ++ +N T AHRS RT+          + S + IN  D  EL N       N++G  YP+A
Sbjct: 419 KVNTNTTIAHRSYRTI---------TNGSSSYIN--DGQELQNIITLT--NTVGTEYPLA 465

Query: 670 Q 670
           +
Sbjct: 466 K 466

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 18 LWSWYLTNLRLGDFEELIGNQLKYTLLKRFL 48
          +W+WYL ++R G FEE++GN+  Y LLK  L
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNL 45

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 54/91 (59%)

Query: 441 LSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNF 500
            SI PSISI    G FR+VLQSILI +    ++ TA+RQSNN  T+A + DDWLLYD  F
Sbjct: 326 CSIFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERF 385

Query: 501 SMXXXXXXXXXXXXXXKRSFPKILFYTMVIV 531
           SM                 FPKILFY++V +
Sbjct: 386 SMNNIQMVSLIDIFEMNGVFPKILFYSVVAI 416

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVSIP 72
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +  +  G  + S R    +LLVS+P
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNR----VLLVSVP 65

Query: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 71/121 (58%), Gaps = 5/121 (4%)

Query: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVS 70
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F     TS     K +L+S
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQF-----TSGNEGSKKILLS 63

Query: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPTFL 130
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F +  F+
Sbjct: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123

Query: 131 E 131
           E
Sbjct: 124 E 124

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%)

Query: 454 GYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMXXXXXXXXXXX 513
           G  R VL S+LIQ+  +KE FTAIRQ ++ P  A++ D+WLLYDS FS+           
Sbjct: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359

Query: 514 XXXKRSFPKILFYTMVIVT 532
               +    +L Y  ++++
Sbjct: 360 LLSNKGNSMLLLYKTILIS 378

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 58/92 (63%)

Query: 440 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 499
           +LS+LPSI + +S G F+LVLQS+++ + ++ E FTA+RQSN+    A+  D+WLLYDS 
Sbjct: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382

Query: 500 FSMXXXXXXXXXXXXXXKRSFPKILFYTMVIV 531
           FSM                 F KI FY+MVI+
Sbjct: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMVII 414

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 19/122 (15%)

Query: 17  GLWSWYLTNLRLGDFEELIGNQLKY-TLLKRF---LNSHFYG------DYNTSARPNKKI 66
            LW+WYL  +R G+FEEL+  + KY ++L +    L +H         D N S   +  I
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANIS---DGNI 70

Query: 67  LLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHYLLTDN 120
           L +S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y++ D+
Sbjct: 71  LFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDS 130

Query: 121 LN 122
           LN
Sbjct: 131 LN 132

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 55/93 (59%)

Query: 442 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFS 501
           S+ PS+SI +    FR+VLQSIL+ D +   I TA+RQ NN P +A+ +DD LLYD+  S
Sbjct: 235 SVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKIS 294

Query: 502 MXXXXXXXXXXXXXXKRSFPKILFYTMVIVTDS 534
           +               R+ PK+LFY++  + +S
Sbjct: 295 LITFRILSLVDLMELNRAHPKMLFYSVAEIFNS 327

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 59/107 (55%), Gaps = 11/107 (10%)

Query: 14  DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVSIPE 73
           D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F      S    +++ L+S P 
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF----AHSTGQERRLQLLSFPA 59

Query: 74  NVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           +V  D  ILE F++   ++     + I ++   H    E HYL+  N
Sbjct: 60  SVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLVDGN 99

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (57%)

Query: 443 ILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSM 502
           ++PSIS     G  R VLQSI+ +   T E+ TAIRQS+    +A+ +D+WLLYDS+FS+
Sbjct: 282 VVPSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSL 341

Query: 503 XXXXXXXXXXXXXXKRSFPKILFYTMVIVT 532
                             P+ILFYTM +V+
Sbjct: 342 NNLEISTLQDILYPNYENPRILFYTMSVVS 371

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 66/118 (55%), Gaps = 3/118 (2%)

Query: 9   DYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILL 68
           D    DDN + SWYL NLR G FE +I ++ K   L   L+   + +    A  NK  +L
Sbjct: 4   DNIKKDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYGA-TNK--IL 60

Query: 69  VSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQD 126
           VS   ++ E +SI +IFL   F  E+L++I++ +L      N E HY LTD+LN+F D
Sbjct: 61  VSTLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSFND 118

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 16 NGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVSIP 72
          N  W WY+ NL  G+FEEL  N +K   L  FL +H++G   T+ +  +++LLV+ P
Sbjct: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQTT-KLQRRLLLVTSP 72

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 13/129 (10%)

Query: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILL 68
           DND +  LW+WYL N+    F E   I N+ KY+ LK+ ++   +   N + +  K I+ 
Sbjct: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFTVTNINTKKVKNIIF 73

Query: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDNLN 122
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129

Query: 123 NFQDPTFLE 131
           NFQ+ TF E
Sbjct: 130 NFQNTTFKE 138

>Kpol_1056.11 s1056 (27423..28925) [1503 bp, 500 aa] {ON}
           (27423..28925) [1503 nt, 501 aa]
          Length = 500

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 6   RVGDY--FDNDDNGLWSWYLTNLR-LGDFEELIGNQLKYTLLKRFLN 49
           ++GDY  FDN D  L+S +LTNL  L D +ELI N L   L+   +N
Sbjct: 169 KIGDYKSFDNIDCNLFSIFLTNLLFLNDSKELIYNNLFKALMFSLIN 215

>CAGL0J06842g Chr10 complement(657226..658740) [1515 bp, 504 aa]
           {ON} highly similar to uniprot|Q02939 Saccharomyces
           cerevisiae YPL122c TFB2
          Length = 504

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%)

Query: 601 SGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660
           S P ++ PTR+A  +T+  +S+RT +   E   N+ +   K      + L+   E +   
Sbjct: 268 SNPNIFYPTRLAQMLTSDTKSMRTASGAMESVLNKPDDAAKSTDDKYDSLEGKAEDIQDG 327

Query: 661 SL 662
           +L
Sbjct: 328 AL 329

>KLTH0F16698g Chr6 (1354232..1356262) [2031 bp, 676 aa] {ON} weakly
           similar to uniprot|P50273 YDR350C Saccharomyces
           cerevisiae CM10 Mitochondrial inner membrane protein
           required for assembly of the F0 sector of mitochondrial
           F1F0 ATP synthase
          Length = 676

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 613 SNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKS 645
           + V T+ +++R +N +G W+  RHNSV  +N +
Sbjct: 379 TTVYTSPKTLRLLNELGIWSLLRHNSVNVLNAT 411

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,424,258
Number of extensions: 2771778
Number of successful extensions: 8812
Number of sequences better than 10.0: 36
Number of HSP's gapped: 8977
Number of HSP's successfully gapped: 64
Length of query: 779
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 661
Effective length of database: 39,950,811
Effective search space: 26407486071
Effective search space used: 26407486071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)