Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.1475.528ON66566523840.0
Smik_13.1445.528ON63967219680.0
YML007W (YAP1)5.528ON65067718230.0
Suva_13.1555.528ON64568016920.0
KAFR0C054005.528ON4813293482e-34
CAGL0H04631g5.528ON588633241e-30
NDAI0C010605.528ON6371173232e-30
NCAS0H025605.528ON587633212e-30
TDEL0A039205.528ON4663023083e-29
KNAG0B036805.528ON482632988e-28
SAKL0G04950g5.528ON5673002963e-27
ZYRO0D12584g5.528ON579632937e-27
Kwal_47.186315.528ON584642883e-26
KLTH0G03784g5.528ON569642856e-26
KLLA0A01760g5.528ON583632778e-25
Kpol_1023.975.528ON591632689e-24
TBLA0G009305.528ON608592554e-22
Kpol_1004.225.528ON475632516e-22
TPHA0D023405.528ON506632501e-21
TPHA0K005205.528ON560632421e-20
NCAS0F011005.528ON475912072e-16
TBLA0D016405.528ON599591798e-13
Ecym_40645.528ON426801652e-11
CAGL0F03069g5.528ON486911474e-09
KNAG0C032105.528ON3841001384e-08
NDAI0H016105.528ON519621394e-08
ADR195C5.528ON288791347e-08
YDR423C (CAD1)5.528ON409931304e-07
Smik_4.6985.528ON393931295e-07
KAFR0E032905.528ON265861241e-06
Suva_2.600singletonOFF382531143e-05
Smik_8.332.493ON331116800.39
YPR199C (ARR1)na 1ON29442770.83
Skud_16.2948.113ON120339771.2
Smik_16.2498.113ON120339771.2
Suva_9.2317.115ON24587751.2
YPR010C (RPA135)8.113ON120339761.7
ZYRO0E02838g8.113ON119634743.0
Suva_16.3318.113ON120339734.1
NOTE: 1 genes in the same pillar as Skud_13.147 were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.147
         (665 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   922   0.0  
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   762   0.0  
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   706   0.0  
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   656   0.0  
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   138   2e-34
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   129   1e-30
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   129   2e-30
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   128   2e-30
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   123   3e-29
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   119   8e-28
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   118   3e-27
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...   117   7e-27
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   115   3e-26
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   114   6e-26
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   111   8e-25
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   107   9e-24
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   102   4e-22
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   101   6e-22
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   100   1e-21
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    98   1e-20
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    84   2e-16
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    74   8e-13
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    68   2e-11
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    61   4e-09
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    58   4e-08
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    58   4e-08
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    56   7e-08
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    55   4e-07
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    54   5e-07
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    52   1e-06
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    49   3e-05
Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON} YH...    35   0.39 
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    34   0.83 
Skud_16.294 Chr16 complement(541842..545453) [3612 bp, 1203 aa] ...    34   1.2  
Smik_16.249 Chr16 complement(453693..457304) [3612 bp, 1203 aa] ...    34   1.2  
Suva_9.231 Chr9 (372034..372771) [738 bp, 245 aa] {ON} YIR018W (...    33   1.2  
YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}...    34   1.7  
ZYRO0E02838g Chr5 (215374..218964) [3591 bp, 1196 aa] {ON} highl...    33   3.0  
Suva_16.331 Chr16 complement(581588..585199) [3612 bp, 1203 aa] ...    33   4.1  

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/665 (73%), Positives = 487/665 (73%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60
           MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ
Sbjct: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTL 120
           DLDPETKQKRTAQNRAAQRAF              VQGLENIQQQNEVEATFLRDQLVTL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTL 120

Query: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSEEIQENVRQKMNF 180
           VNELKKYRPETRNDSKVLEYLASRDPNLP           RPIITPSEEIQENVRQKMNF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPTSNNSTNSSSNRPIITPSEEIQENVRQKMNF 180

Query: 181 TFQYALDNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKXXXXXXXXXXXXXXXXNSHDVLN 240
           TFQYALDNDSKNLEKQLPSPNDPSHSAPIPTTQAQKK                NSHDVLN
Sbjct: 181 TFQYALDNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKSSDATDSSTATLDSLSNSHDVLN 240

Query: 241 NTPNSSSSMDWLDNVIYTNRFVAGGDGSKLEVKXXXXXXXXXXXXXXXXXXXXXSEFCSK 300
           NTPNSSSSMDWLDNVIYTNRFVAGGDGSKLEVK                     SEFCSK
Sbjct: 241 NTPNSSSSMDWLDNVIYTNRFVAGGDGSKLEVKNVDSNMFSNNFNFENQFDEQVSEFCSK 300

Query: 301 MNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHSXXXXXXXXXXXXXD 360
           MNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHS             D
Sbjct: 301 MNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHSNITANTPANITTND 360

Query: 361 TSLSGFGQLGFELTTSRHAAEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           TSLSGFGQLGFELTTSRHAAEE                                      
Sbjct: 361 TSLSGFGQLGFELTTSRHAAEENSTGNTDNDNNSGDSSNNKNNNNNNNNNNNSNNNKNNN 420

Query: 421 XXXXXXXVIPFISDSPFDMNQVTNFFSPGSTXXXXXXXXXXXPSLSQNTKDDVPFINAGL 480
                  VIPFISDSPFDMNQVTNFFSPGST           PSLSQNTKDDVPFINAGL
Sbjct: 421 NNGDDGGVIPFISDSPFDMNQVTNFFSPGSTNNINIAASSANPSLSQNTKDDVPFINAGL 480

Query: 481 AFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNSXXXXXXXXXXXXXXXXXXXXK 540
           AFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNS                    K
Sbjct: 481 AFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNSLFEEFLEEEEDDDDDDNNNEK 540

Query: 541 ATNASDDESSLIRNQLINEEXXXXXXXXXXXXXXEKETSPKTNSGGTQXXXXXXXXXXXX 600
           ATNASDDESSLIRNQLINEE              EKETSPKTNSGGTQ            
Sbjct: 541 ATNASDDESSLIRNQLINEEPQPLNQNSLSSLNNEKETSPKTNSGGTQNANDSDGNDNDN 600

Query: 601 XVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLAL 660
            VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLAL
Sbjct: 601 DVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLAL 660

Query: 661 NKHMN 665
           NKHMN
Sbjct: 661 NKHMN 665

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/672 (60%), Positives = 439/672 (65%), Gaps = 40/672 (5%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60
           MSVSTAKRSLDL S GSLAEFDDS  HH+EIENEH  + TRD+DDNEQPK+KGTK SKKQ
Sbjct: 1   MSVSTAKRSLDLVSSGSLAEFDDSKPHHEEIENEHTSNGTRDNDDNEQPKRKGTKTSKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTL 120
           DLDPETKQKRTAQNRAAQRAF              VQ LE+IQQQNEVEATFLRDQLVTL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLVTL 120

Query: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSEEIQENVRQKMNF 180
           VNELKKYRPETRNDSKVLEYLA RDPNL            RPIITP++EIQENV+QKMNF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPNDEIQENVKQKMNF 180

Query: 181 TFQYALDNDS---KNLEKQLPSPNDPSHSAPIPTTQAQKKXXXXXXXXXXXXXXXXNSHD 237
           TFQY LDNDS   KN E+QLPSPNDP+HS  IP  Q QKK                NS+D
Sbjct: 181 TFQYPLDNDSDENKNKERQLPSPNDPNHSVSIPIAQKQKKSSNTTDSSSATLDSLSNSND 240

Query: 238 VLNNTPNSSSSMDWLDNVIYTNRFVAGGDGSKLEVKXXXXXXXXXXXXXXXXXXXXXSEF 297
           VLNNTPNSSSSMDWLDNVIYTN+FV+G DG K E K                     SEF
Sbjct: 241 VLNNTPNSSSSMDWLDNVIYTNKFVSGDDGCKRETKNVDSNLFSNDFNFENQFDEQVSEF 300

Query: 298 CSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHSXXXXXXXXXXX 357
           CSKMNQVCGTRQCPIPKKPVSTLD+EVFASSSILSANSP+LTNTWESHS           
Sbjct: 301 CSKMNQVCGTRQCPIPKKPVSTLDKEVFASSSILSANSPSLTNTWESHSNITVNTPANVI 360

Query: 358 XXDTSL----SGFGQLGFELTTSRHAAEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 413
             DTS+    S FGQLGF +  + H                                   
Sbjct: 361 GNDTSIDTSFSSFGQLGFGVAANHHDV------------------------NNDNTSSTG 396

Query: 414 XXXXXXXXXXXXXXVIPFISDSPFDMNQVTNFFSPGSTXXXXXXXXXXXPSLSQNTKDDV 473
                         V+PFIS+SPFDM+QVTNFF PG T            +  QN+KDD+
Sbjct: 397 NKNGSNKNSTNNDDVLPFISESPFDMDQVTNFFCPGPTNTINNVAASANSNFLQNSKDDI 456

Query: 474 PFINAGLAFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNSXXXXXXXXXXXXXX 533
           PFINA LAFPDEN TNIQLQP SESQSQNKFDYDMFFRDSS+ GN+              
Sbjct: 457 PFINANLAFPDENSTNIQLQPISESQSQNKFDYDMFFRDSSKEGNN--LFEEFLEEDDDD 514

Query: 534 XXXXXXKATNASDDESSLIRNQLINEEXXXXXXXXXXXXXXEKETSPKTNSGGTQXXXXX 593
                 KA N SDDESSLI+NQLINEE              E E++ + +S   +     
Sbjct: 515 DDDGNKKAYNTSDDESSLIKNQLINEE-------PQSTLKNESESAQRKDSYVQEAIDNN 567

Query: 594 XXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINA 653
                   VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINA
Sbjct: 568 NGNGNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINA 627

Query: 654 EDVQLALNKHMN 665
           EDVQLALNKHMN
Sbjct: 628 EDVQLALNKHMN 639

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/677 (59%), Positives = 441/677 (65%), Gaps = 39/677 (5%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60
           MSVSTAKRSLD+ SPGSLAEF+ S + HDEIENEHR   TRD +D+EQPKKKG+K SKKQ
Sbjct: 1   MSVSTAKRSLDVVSPGSLAEFEGSKSRHDEIENEHRRTGTRDGEDSEQPKKKGSKTSKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTL 120
           DLDPETKQKRTAQNRAAQRAF              VQ LE+IQQQNEVEATFLRDQL+TL
Sbjct: 61  DLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITL 120

Query: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSEEIQENVRQKMNF 180
           VNELKKYRPETRNDSKVLEYLA RDPNL             PI TP+++IQENV+QKMNF
Sbjct: 121 VNELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNF 180

Query: 181 TFQYAL-----DNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKXXXXXXXXXXXXXXXXNS 235
           TFQY L     +++SKN+ KQLPSPNDPSHSAP+P  Q QKK                NS
Sbjct: 181 TFQYPLDNDNDNDNSKNVGKQLPSPNDPSHSAPMPINQTQKKLSDATDSSSATLDSLSNS 240

Query: 236 HDVLNNTPNSSSSMDWLDNVIYTNRFVAGGDGSKLEVKXXXXXXXXXXXXXXXXXXXXXS 295
           +DVLNNTPNSS+SMDWLDNVIYTNRFV+G DGS  + K                     S
Sbjct: 241 NDVLNNTPNSSTSMDWLDNVIYTNRFVSGDDGSNSKTKNLDSNMFSNDFNFENQFDEQVS 300

Query: 296 EFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHSXXXXXXXXX 355
           EFCSKMNQVCGTRQCPIPKKP+S LD+EVFASSSILS+NSPALTNTWESHS         
Sbjct: 301 EFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNSPALTNTWESHSNITDNTPAN 360

Query: 356 XXXXDT-----SLSGFGQLGFELTTSRHAAEEXXXXXXXXXXXXXXXXXXXXXXXXXXXX 410
               D      S SGFG+LGF+++ + +   +                            
Sbjct: 361 VIATDATKYENSFSGFGRLGFDMSANHYVVND--------------------NSTGSTDS 400

Query: 411 XXXXXXXXXXXXXXXXXVIPFISDSPFDMNQVTNFFSPGSTXXXXXXXXXXXPSLSQNTK 470
                            V+PFIS+SPFDMNQVTNFFSPGST           PSL Q++K
Sbjct: 401 TGSTGNKNKKNNNNSDDVLPFISESPFDMNQVTNFFSPGSTGIGNNAASNTNPSLLQSSK 460

Query: 471 DDVPFINAGLAFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNSXXXXXXXXXXX 530
           +D+PFINA LAFPD+N TNIQLQPFSESQSQNKFDYDMFFRDSS+ GN+           
Sbjct: 461 EDIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNN-------LFGE 513

Query: 531 XXXXXXXXXKATNASDDESSLIRNQLINEEXXXXXXXXXXXXXXEKETSPKTNSG--GTQ 588
                    KA N SDDESSLI+NQLINEE              E E S K  S      
Sbjct: 514 FLEDDDDDKKAANMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNAD 573

Query: 589 XXXXXXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG 648
                        VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG
Sbjct: 574 KINNGNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG 633

Query: 649 VVINAEDVQLALNKHMN 665
           VVINAEDVQLALNKHMN
Sbjct: 634 VVINAEDVQLALNKHMN 650

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/680 (55%), Positives = 429/680 (63%), Gaps = 50/680 (7%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60
           MS+S AKRSLDL S  SLA+ DDS +HHDE+EN+H HD   D+DDN+QP++KG+K SKKQ
Sbjct: 1   MSISAAKRSLDLVSSSSLAQSDDSVSHHDEVENDHIHDDMHDNDDNDQPRRKGSKTSKKQ 60

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTL 120
           DLDPETK KRTAQNRAAQRAF              V  LE+IQQ+NEVEATFLRDQLVTL
Sbjct: 61  DLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLRDQLVTL 120

Query: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSEEIQENVRQKMNF 180
           V+ELKKYRPETRNDSKVLEYLA RDPNL             PI+TP+++IQ+NV+QKMNF
Sbjct: 121 VSELKKYRPETRNDSKVLEYLARRDPNL-HPPNSNTNNNSEPIVTPNDDIQKNVKQKMNF 179

Query: 181 TFQYAL---DNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKXXXXXXXXXXXXXXXXNSHD 237
           TFQY L   DND KN+EKQLPSPNDP+HSA +P    QKK                N++D
Sbjct: 180 TFQYPLDNDDNDGKNMEKQLPSPNDPNHSAHVPIAPTQKKLSDATDSSTATLDSFSNNND 239

Query: 238 VLNNTPNSSSSMDWLDNVIYTNRFVAGGDG------SKLEVKXXXXXXXXXXXXXXXXXX 291
           VLN TPNSSSSMDWLDNV+YTN+FVAGGD       SK + K                  
Sbjct: 240 VLNITPNSSSSMDWLDNVMYTNKFVAGGDQKNASNESKSKPKGVDSNMFSNDFNFENQFD 299

Query: 292 XXXSEFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHSXXXXX 351
              SEFCSKMNQ CGT+QCPIPKK V  LD+EVFASSS+LSANSP LTNTW+SHS     
Sbjct: 300 EQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVFASSSVLSANSPVLTNTWDSHSNVTTN 359

Query: 352 XXXXXXXXDTSLSGFGQLGFELTTSRHAAEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 411
                    +S S FGQ GF+L T+ +A  +                             
Sbjct: 360 TPANITTNGSSSSSFGQPGFDLNTNHYATND----------------------------- 390

Query: 412 XXXXXXXXXXXXXXXXVIPFISDSPFDMNQVTNFFSPG-STXXXXXXXXXXXPSLSQNTK 470
                           ++PFIS+SPFDMNQVTNFFSPG +            PSL Q+TK
Sbjct: 391 KYTDNSDNNKTNNYNDILPFISESPFDMNQVTNFFSPGTNNTTNANTTNSHNPSLQQSTK 450

Query: 471 DDVPFINAGLAFPDENPTNIQLQPFSESQSQNKFDYDMFFRDSSRAGNS-----XXXXXX 525
           DD+PFIN  LAFPD+NPTNIQLQP S+SQ QNKFDYDMFFRDSS+ GN+           
Sbjct: 451 DDIPFINTSLAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKEGNNLFEEFLEEDDD 510

Query: 526 XXXXXXXXXXXXXXKATNASDDESSLIRNQLINEEXXXXXXXXXXXXXXEKETSPKTNSG 585
                         +A NASDDES+LI+N+LINEE                E     NS 
Sbjct: 511 DDDDDGNDGNDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSS 570

Query: 586 GTQXXXXXXXXXXXXXVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCS 645
            ++             VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCS
Sbjct: 571 NSE-----DVNDNDNEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCS 625

Query: 646 ERGVVINAEDVQLALNKHMN 665
           ERGVVINAEDVQLALNKHMN
Sbjct: 626 ERGVVINAEDVQLALNKHMN 645

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 105/329 (31%), Positives = 149/329 (45%), Gaps = 64/329 (19%)

Query: 46  NEQPKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQ 105
           N  PKK     S + +LD E K KRTAQNRAAQRAF              V  L NIQ+Q
Sbjct: 26  NAIPKKNNASKSSRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQ 85

Query: 106 NEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIIT 165
           NE+E+ FLR QL+TLV ELKKYRPET NDS+VL YLA  +                    
Sbjct: 86  NEIESEFLRSQLITLVKELKKYRPETANDSQVLNYLAKHE-------------------- 125

Query: 166 PSEEIQENVRQKMNFTFQYALDNDSKNLEK----------QLPSPNDPSHSAPIPTTQAQ 215
            +    EN+ +K NF+F +  D+++   +K           +PSP++       P T + 
Sbjct: 126 -NGNFNENLSKKSNFSFAFPWDDNNATTDKSDNLNTTTNNNIPSPDNS------PVTASN 178

Query: 216 KKXXXXXXXXXXXXXXXXNSHDV------LNNTPNSSSSMDWLDNVIYT----------- 258
            K                N++++      L++    S S++WLDN+++T           
Sbjct: 179 DKKNYPSSVSSIEPLNQNNNNNISSLSPSLDDNDGISPSINWLDNMLHTEDLFNEQLSSF 238

Query: 259 -NRFVAGGDGSKLEVKXXXXXXXXXXXXXXXXXXXXXSEFCSKMNQVCGTRQCPIPKKPV 317
            N  ++  D ++ +                       ++FC KMNQVCGTR  PIPKK  
Sbjct: 239 SNTPISRNDSNESKNPMTDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKST 298

Query: 318 STLDQEVFASSSILSANSPALTNTWESHS 346
           S L           + ++P  TNT++S S
Sbjct: 299 SNLPS---------TESTPLFTNTFDSPS 318

 Score =  122 bits (306), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 51/63 (80%), Positives = 59/63 (93%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPSK+ +LLRCSE+WDRIT HPKYSDID+DGLC ELMAKAKCSE+GVV+NAEDVQ AL+
Sbjct: 418 VVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALS 477

Query: 662 KHM 664
           KH+
Sbjct: 478 KHL 480

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  129 bits (324), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPS++  LLRCSEIWDRIT HPKYSDID+DGLCSELMAKAKCSERGVVINA+DVQ+ALN
Sbjct: 525 VVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALN 584

Query: 662 KHM 664
           KHM
Sbjct: 585 KHM 587

 Score =  124 bits (310), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 143/319 (44%), Gaps = 51/319 (15%)

Query: 44  DDNEQPKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQ 103
           D+    K   ++  + Q+LDPET+ KR AQNRAAQ+AF              V  LEN+ 
Sbjct: 5   DNGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLT 64

Query: 104 QQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYL---------------------A 142
           + NEVE  FLRDQL  LV EL+KYRPET+ D KVL+YL                     +
Sbjct: 65  KLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLEKHKGGAAGAGNGAATGSVSTS 124

Query: 143 SRDPNLPXXXXXXXXXXXRPIITPSEEIQENVRQKMNFTFQYALDNDSKNLEKQLPSPND 202
           +R  +L               I P  +I   +RQ +  +F    +N   N+  QL  P +
Sbjct: 125 TRHTDLAASNANRVSKDSS--ILPGAKI---IRQDLE-SFN---ENRHFNVTGQLTPPGN 175

Query: 203 PSHSAPIPTTQAQKKXXXXXXXXXXXXXXXXNSHDVLNNTPNSSSSMDWLDNVIYTNRFV 262
            S S    +  A  K                N+    N  P  +SS DWLD+V+ +++ +
Sbjct: 176 TSSSTTANSVAANAKKQSIPHSDSSDSNESKNT---WNTDP--TSSEDWLDDVMTSHKQI 230

Query: 263 A-GGDGSKLEVKXXXXXXXXXXXXXXXXXXXXXSEFCSKMNQVCGTRQCPIPKKPVSTLD 321
           + G  GS ++                       SEFC+K+NQ CGT+ CPIP+   S   
Sbjct: 231 SRGQSGSGIDFN--------------NFFDEQVSEFCTKLNQACGTKACPIPQSK-SAAT 275

Query: 322 QEVFASSSILSANSPALTN 340
             +  +SS  ++NSP + N
Sbjct: 276 TPLPGTSSNGNSNSPMIIN 294

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  129 bits (323), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 73/117 (62%), Gaps = 16/117 (13%)

Query: 548 ESSLIRNQLINEEXXXXXXXXXXXXXXEKETSPKTNSGGTQXXXXXXXXXXXXXVVPSKE 607
           E  L+ N LINEE                 +S   N+  T              +VPS++
Sbjct: 536 EKKLVANNLINEE----------------PSSTNKNNNLTSTSKEQENNDFDDFIVPSRD 579

Query: 608 GSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664
           G LLRCSEIWDRIT HPKYS++D+DGLCSELM KAKCSERGVV+NAEDVQ+AL KHM
Sbjct: 580 GGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMALTKHM 636

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 82/148 (55%), Gaps = 7/148 (4%)

Query: 1   MSVSTAKRSLDL--ASPGSLAEFDDSAAHH----DEIENEHRHDSTRDDDDNEQPKKKGT 54
           +  +T KR LDL         +F+   A++    D  EN   +   + D DN+   ++  
Sbjct: 4   VGTTTGKRQLDLIDQQQQQQQQFETQNANNTRPKDSTENATTNPMKKQDLDNKTNTEQSN 63

Query: 55  KISKK-QDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFL 113
             SKK Q LDPE + KRTAQNRAAQRAF              V  L  IQ+QNE+E+ FL
Sbjct: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFL 123

Query: 114 RDQLVTLVNELKKYRPETRNDSKVLEYL 141
           R QL+TLVNELKKY+P   N SKVL Y+
Sbjct: 124 RSQLITLVNELKKYKPNNENASKVLNYI 151

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 47/116 (40%), Gaps = 38/116 (32%)

Query: 295 SEFCSKMNQVCGTRQCPIP-----------------KKPVSTLDQEVFASSSILS----- 332
           S+FC KM+  CGTR  PIP                 K P+S L+    A S++++     
Sbjct: 323 SDFCGKMSMACGTRSNPIPKSKSNVSTPQSIMNSNNKSPISPLNDSTLAKSNVITTSNIF 382

Query: 333 ---ANSPA-----LTNTW-------ESHSXXXXXXXXXXXXXDTSLSGFGQLGFEL 373
              +N+P      LTNTW        S+              + ++  FGQLGF +
Sbjct: 383 DHQSNTPQAINSNLTNTWGIPSASPNSNDSSPNNIVPTQDNSNVNM-NFGQLGFMM 437

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  128 bits (321), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/63 (82%), Positives = 59/63 (93%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           +VPS++G LLRCSEIWDRI+ HPKYSD+D+DGLCSELM KAKCSERGVV+NAEDVQLAL 
Sbjct: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERGVVVNAEDVQLALT 583

Query: 662 KHM 664
           KHM
Sbjct: 584 KHM 586

 Score =  107 bits (268), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 72/154 (46%), Positives = 89/154 (57%), Gaps = 13/154 (8%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGT------ 54
           MS +TAKR L+L  P S  +F  S     E+E   R+ ST D    ++ +  GT      
Sbjct: 1   MSTTTAKRPLEL-DPNSRLQFAQSKEQQQELE---RY-STEDAGSRKKQEVSGTSNAAAT 55

Query: 55  -KISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFL 113
             ++KKQ LD E K KRTAQNRAAQRAF              V  L  IQ+QNE+E+ FL
Sbjct: 56  TNMTKKQ-LDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFL 114

Query: 114 RDQLVTLVNELKKYRPETRNDSKVLEYLASRDPN 147
           R QL+TLVNELKKYR    N+SKVLEYL+  + N
Sbjct: 115 RGQLITLVNELKKYRDPNPNESKVLEYLSQHNGN 148

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 26/95 (27%)

Query: 295 SEFCSKMNQVCGTRQCPIPKKPVST---------------LDQEVFASSSILSANSPA-- 337
           S+FC KMN  CGTR  P+PK   +T                 +++   S++ + N+P   
Sbjct: 295 SDFCGKMNMACGTRYDPVPKSKSNTSTPQNNNSSLLSPPSNSKQIANQSNLFNLNTPPNL 354

Query: 338 -LTNTWESHSXXXXXXXXXXXXXDTSLSGFGQLGF 371
            +TNT++ +S                   FGQLG 
Sbjct: 355 NITNTFDFNSPLDSPQQQN--------QAFGQLGM 381

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  123 bits (308), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 134/302 (44%), Gaps = 48/302 (15%)

Query: 49  PKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEV 108
           P  KG+K  +K  LD ETK KRTAQNRAAQRAF              VQ LE   +   V
Sbjct: 42  PAAKGSKPGRKP-LDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVV 100

Query: 109 EATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSE 168
           E+ FLR QL+TLVNELKKYRP   ND +VL+YLA  +   P                  +
Sbjct: 101 ESEFLRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPT----------------DK 144

Query: 169 EIQENVRQKMNFTFQYALDNDSKNLEKQLPSPNDPSHSAPIPTTQAQKKXXXXXXXXXXX 228
           EI+++V++KM+FTF +    D K  E Q         +   P+  +              
Sbjct: 145 EIEQSVQKKMDFTFAFPW-KDRKEAEAQ---------AQHFPSPGSSMLSSSSASVNSAA 194

Query: 229 XXXXXNSHDVLNNTPNSSSSMDWLDNVIYTN------RFVAGGDGSKLEVKXXXXXXXXX 282
                       +T  S+S+  W+DNV Y++      +F   GD +              
Sbjct: 195 SPSNKRRSTASRSTSTSTSTTGWMDNVFYSDDAQKLPQFAIKGDST-------ADPLFSN 247

Query: 283 XXXXXXXXXXXXSEFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTW 342
                       S+FC+KMN+ CGTR+CPIP         +V AS  I       LTN+W
Sbjct: 248 EFNFDDQFDEQVSQFCTKMNKACGTRECPIPGFTPQMASPQV-ASPQI-------LTNSW 299

Query: 343 ES 344
           ++
Sbjct: 300 DT 301

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 57/64 (89%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPS++G LL+CSE+WDRITTHPKYS ID+DGLC ELM KAKCSE+GVV+ AEDVQ  L+
Sbjct: 402 VVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKGVVVQAEDVQRVLD 461

Query: 662 KHMN 665
           KHM+
Sbjct: 462 KHMD 465

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  119 bits (298), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 49/63 (77%), Positives = 58/63 (92%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPSK+G LL+CSEIWDRIT HPKYSD+D+DGLC ELM KAKCSERGVV+NA+DV+ ALN
Sbjct: 419 VVPSKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERGVVVNADDVKDALN 478

Query: 662 KHM 664
           +H+
Sbjct: 479 RHI 481

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/106 (57%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 44  DDNEQPKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQ 103
           D   +P KK T  + K  LD E + KRT QNRAAQRAF              V  L  IQ
Sbjct: 28  DSGAEPLKKRTHTASKP-LDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQ 86

Query: 104 QQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASRDPNLP 149
           +QNEVE+ FLR QLVTLV+ELKKYRPET NDSKVLEYLA  D N+P
Sbjct: 87  KQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLAKHD-NVP 131

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 5/49 (10%)

Query: 295 SEFCSKMNQVCGTRQCPIPK-KPVSTLDQEVFASSSILSANSPALTNTW 342
           S+FC +MN+ CG++  P+PK K  S     V +  S+L+    +L+NTW
Sbjct: 244 SDFCVRMNEACGSKTNPVPKSKKGSVFSNSVLSPPSLLN----SLSNTW 288

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 139/300 (46%), Gaps = 49/300 (16%)

Query: 37  HDSTRDDDDNEQPKKKGTKISKKQDLDP---ETKQKRTAQNRAAQRAFXXXXXXXXXXXX 93
           H    D++   Q K+KGTK + K    P   E K KRTAQNRAAQRAF            
Sbjct: 26  HKRPLDNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELE 85

Query: 94  XXVQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR-----DPNL 148
             V  LE +++QNEVE  FLR QL+TL++ELKKYRPE   D++VLEYLA R     D + 
Sbjct: 86  DKVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYLAKREEEKKDNSQ 145

Query: 149 PXXXXXXXXXXXRPIITPS---EEIQENVRQKMNFTFQYALDNDSKNLE------KQLPS 199
                          ++ S     I++N+++KM+FTF++   +++   +        + S
Sbjct: 146 DRSGGSANTSEEGADVSHSSSESHIRDNIQKKMDFTFEFPWKDNAGRTQFPSPGSSSVSS 205

Query: 200 PNDPSHSAPIPTTQAQKKXXXXXXXXXXXXXXXXNSHDVLNNTPNSSSS---MDWLDNVI 256
            + PS S+  P                          +  NNTP++SS+   M + D+ +
Sbjct: 206 NHKPSFSSNAP-------------------------FNATNNTPSTSSASLDMFYQDDAL 240

Query: 257 --YTNRFVAGGDGSKLEVKXXXXXXXXXXXXXXXXXXXXXSEFCSKMNQVCGTRQCPIPK 314
             +T+  +  G+ S                          SEFC++MNQ CGTR  P+P+
Sbjct: 241 PKFTSSSLERGNNSG--TIADAGFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQ 298

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 56/63 (88%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPS++G LL+C EIWDRIT+HPKYSD+D+DGLC EL  KAKCSE+GVV+NA+DVQ AL 
Sbjct: 504 VVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKGVVVNADDVQKALA 563

Query: 662 KHM 664
           KHM
Sbjct: 564 KHM 566

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score =  117 bits (293), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (88%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPS +G LL+CSE+WDRIT+HPKYSD+D+DGLC ELMAKAKCSERGVV+ AEDVQ ALN
Sbjct: 516 VVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALN 575

Query: 662 KHM 664
             +
Sbjct: 576 NRV 578

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 99/192 (51%), Gaps = 24/192 (12%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60
           MS ++AKR L+       AE                 D   D   +++P+KKG K  +K 
Sbjct: 1   MSTTSAKRPLEPTVSLDFAE-----------------DEADDSPTSDEPRKKGGKPGRKP 43

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTL 120
            LD E K KRTAQNRAAQRAF              V  LE + QQ+ VE  FLR QLVTL
Sbjct: 44  -LDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTL 102

Query: 121 VNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSEEIQENVRQKMNF 180
           V ELK+YRPE  NDS+VL+YLA  +                   + S+EI+E+VR+KM+F
Sbjct: 103 VTELKRYRPENPNDSQVLQYLAKTE------NSKSDDSSQNKKDSESKEIEESVRRKMSF 156

Query: 181 TFQYALDNDSKN 192
           TF +   N+  N
Sbjct: 157 TFAFPWKNEFNN 168

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 295 SEFCSKMNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHS 346
           SEFC+K+ QVCGT+ CPIP+K  S+        S I+       +NTW++ S
Sbjct: 325 SEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIV------FSNTWDTPS 370

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  115 bits (288), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 58/64 (90%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVP+++G+LL+CSE+WDRIT+HPKYSDID+DGLC EL  KAKCSE+GVV+N +DVQ AL 
Sbjct: 521 VVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRALT 580

Query: 662 KHMN 665
           KHM+
Sbjct: 581 KHMS 584

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (65%), Gaps = 1/93 (1%)

Query: 50  KKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVE 109
           K+KG+K  +K  LD E K KRTAQNRAAQRAF              V+ LE +++Q+E+E
Sbjct: 19  KRKGSKPGRKP-LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELE 77

Query: 110 ATFLRDQLVTLVNELKKYRPETRNDSKVLEYLA 142
           + FLR QL  L+ E++KYRP   +DS+VL +LA
Sbjct: 78  SEFLRSQLQKLLAEIQKYRPRQSSDSQVLNFLA 110

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 22/26 (84%), Gaps = 1/26 (3%)

Query: 295 SEFCSKMNQVCGTRQCPI-PKKPVST 319
           SEFC++MN+VCGTR+CP+ P  P ST
Sbjct: 292 SEFCTRMNEVCGTRECPVAPALPPST 317

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  114 bits (285), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVP+++G LL+CSEIWDRIT HPKYSDID+DGLC EL  KAKCSE+GVV+N++DVQ AL 
Sbjct: 506 VVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALA 565

Query: 662 KHMN 665
           KHM+
Sbjct: 566 KHMS 569

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 49  PKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEV 108
           PK+KG+K  +K  LD E K KRTAQNRAAQRAF              V+ LE +++Q+E+
Sbjct: 18  PKRKGSKPGRKP-LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEM 76

Query: 109 EATFLRDQLVTLVNELKKYRPETRNDSKVLEYLA 142
           E+ FLR QL  L+ E++KYRP+  +DS+VL+YLA
Sbjct: 77  ESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYLA 110

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 19/20 (95%)

Query: 295 SEFCSKMNQVCGTRQCPIPK 314
           S FC++MN+VCGTR+CP+P+
Sbjct: 280 SVFCTQMNEVCGTRECPLPQ 299

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  111 bits (277), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 54/63 (85%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           ++PS +G LL+CSE+WDRIT HP+YSD+D+DGLC EL  KAKCSE+GVV+NAEDVQ AL 
Sbjct: 520 IIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKALI 579

Query: 662 KHM 664
            HM
Sbjct: 580 SHM 582

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 76/144 (52%), Gaps = 15/144 (10%)

Query: 1   MSVSTAKRSLDLASPGSLAEFDDSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQ 60
           MS STAKR  D    GS  +  DS             DS  ++  +    K+  +   ++
Sbjct: 1   MSTSTAKRPFDNKRAGSPDDGTDS-------------DSGGNNSGSSPASKRRERKPGRK 47

Query: 61  DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTL 120
            L+ E K KRTAQNRAAQRAF              V  LE++ +Q+E+E  FLR+Q+  L
Sbjct: 48  PLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNL 107

Query: 121 VNELKKYRPE--TRNDSKVLEYLA 142
           ++ELK+Y PE   + DS +L+YLA
Sbjct: 108 LSELKRYNPELPKKRDSILLDYLA 131

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 1/26 (3%)

Query: 295 SEFCSKMNQVCGTRQCPIPK-KPVST 319
           S FCSK++  CGT+  PIPK  PVST
Sbjct: 262 SSFCSKLSMACGTKSNPIPKASPVST 287

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  107 bits (268), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 55/63 (87%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           V+P+ +G LL+CSE+WDRIT HP+YSDID+DGLC ELM  AKCS++GVV++++DVQ AL+
Sbjct: 528 VIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKGVVVDSKDVQKALS 587

Query: 662 KHM 664
            HM
Sbjct: 588 NHM 590

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 17/130 (13%)

Query: 55  KISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLR 114
           K+ +K   D E K KRTAQNRAAQRAF              V  LE ++QQN+VE+ FLR
Sbjct: 45  KVGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLR 104

Query: 115 DQLVTLVNELKKYRPETRNDSKVLEYLASRDPNLPXXXXXXXXXXXRPIITPSEEIQENV 174
           +QL  +++ELKKYRPE  +D KVLEYLA  + N                   +E+I++N+
Sbjct: 105 NQLTLMIDELKKYRPEKSSDIKVLEYLAKHEEN-----------------GSTEKIKKNI 147

Query: 175 RQKMNFTFQY 184
           ++K +F+F+Y
Sbjct: 148 QRKEDFSFEY 157

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 295 SEFCSKMNQVCGTRQCPIPK 314
           S FC KMNQ CGT+Q P+PK
Sbjct: 304 SSFCVKMNQACGTKQNPVPK 323

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 40/59 (67%), Positives = 52/59 (88%)

Query: 606 KEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664
           K  + ++CSE+WDRIT+HPKYSD+D+DGLC+ELM KAKCSE+GVV+ A+DVQ AL KH+
Sbjct: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKALTKHL 607

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 47  EQPKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQN 106
           ++ KKK  K+ +K   D E K KRTAQNRAAQRAF              V+ LE + +++
Sbjct: 31  KETKKKSNKVGRKLS-DQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKS 89

Query: 107 EVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR--DPNL 148
           E+E+ FLRDQL  L+ EL++YRPE +ND+KV EYL++   DP++
Sbjct: 90  EIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYLSTHKFDPSV 133

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  101 bits (251), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 52/63 (82%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           VVPS +  L+RCSEIWDRITT+P+Y+D+D+DGLC ELM  AKCS++GVV+ ++DV   L 
Sbjct: 412 VVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVHKVLA 471

Query: 662 KHM 664
           KHM
Sbjct: 472 KHM 474

 Score = 94.7 bits (234), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%)

Query: 58  KKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQL 117
           +K D+D E + +RTAQNRAAQRAF              V  LENI Q+NEVE  FLR Q+
Sbjct: 35  RKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRSQV 94

Query: 118 VTLVNELKKYRPETRNDSKVLEYLA 142
           +TLVNELKKYR ET +DSK+L+ ++
Sbjct: 95  LTLVNELKKYRSETTSDSKILKLVS 119

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           +VP  +G LL C EIWDRITT+P+YSDID+DGLC ELMA AKCS++GV+++++DVQ  L+
Sbjct: 443 IVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLS 502

Query: 662 KHM 664
           + +
Sbjct: 503 RRL 505

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%)

Query: 59  KQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLV 118
           K+  + + + KR AQNRAAQ+AF              V+ LENI ++NE+E  FLR QL+
Sbjct: 11  KEQNNADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLL 70

Query: 119 TLVNELKKYRPETRNDSKV 137
           +LVNELKKYR +  +D ++
Sbjct: 71  SLVNELKKYRIDKNDDFRL 89

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 55/63 (87%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLALN 661
           V+ +++GS L+CS++W R+T HPKYS++D+DGLC+ELM +AKCSE+GVV+ + DVQ AL+
Sbjct: 496 VIRAEDGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKGVVVESRDVQKALS 555

Query: 662 KHM 664
           K++
Sbjct: 556 KYL 558

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 52/91 (57%)

Query: 55  KISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLR 114
           K+ +K   D + K KRT QNR AQRAF              V  LE + +  E+E  FLR
Sbjct: 29  KVGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLR 88

Query: 115 DQLVTLVNELKKYRPETRNDSKVLEYLASRD 145
            +L ++ +ELKKYRP   +D +VLEYLA ++
Sbjct: 89  SRLKSMADELKKYRPAQSSDLEVLEYLAKKE 119

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (61%)

Query: 59  KQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLV 118
           ++ LD   K +RTAQNRAAQRAF              +  LE I+  NEVE+TFLRD ++
Sbjct: 26  RKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRDYMM 85

Query: 119 TLVNELKKYRPETRNDSKVLEYLASRDPNLP 149
            L+ +++KYRP    DSKVL+YL+ +  N P
Sbjct: 86  DLICDMQKYRPNNSTDSKVLKYLSLKKKNQP 116

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 612 RCSEIWDRITTH-PKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 664
           +CS IW R  T  PK+SD D+D LC EL+ KAKCS+ G +VI + DV+  L KH 
Sbjct: 421 KCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 46/59 (77%), Gaps = 1/59 (1%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQLAL 660
           +VP+ +  +L C++IWDRIT  PKY+  D++ LC+ELM+KAKCS++GVV+++ DV   L
Sbjct: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVL 586

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 54  TKISKKQ-DLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATF 112
           T  SK Q D + E K KRTAQNRAAQRAF              V  LE + + +E E +F
Sbjct: 19  TTTSKVQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSF 78

Query: 113 LRDQLVTLVNELKK 126
           LR QL+    EL+K
Sbjct: 79  LRSQLILFGTELRK 92

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 50  KKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVE 109
           ++KG K  +K  LD E K +RTAQNRAAQRAF              V+ LE  + Q+E E
Sbjct: 39  RRKGNKPGRKP-LDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSERE 97

Query: 110 ATFLRDQLVTLVNELKKYRP 129
              LR+Q+V+L+ ELKKYRP
Sbjct: 98  VQSLRNQVVSLLRELKKYRP 117

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (52%)

Query: 51  KKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEA 110
           K+G K + ++ +D E K KRTAQNRAAQRAF              +  L+ +  +   E 
Sbjct: 6   KEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSET 65

Query: 111 TFLRDQLVTLVNELKKYRPETRNDSKVLEYL 141
            +L++ L  L+ E+ KYRP    D  +L+ L
Sbjct: 66  EYLKECLSELLTEVTKYRPANEKDQGILKRL 96

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 605 SKEGS-LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG----------VVINA 653
           S EG  +LRC +I   +     Y  +D + LC+ELM KAK S+ G          VVI A
Sbjct: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473

Query: 654 EDVQLALNKHM 664
            D+Q  L KH+
Sbjct: 474 GDLQRTLAKHI 484

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 47  EQPKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQN 106
           E  KK G    +K  LD E K KRT QNR AQRA+              +  LE +   N
Sbjct: 10  ETAKKVGRPGRRK--LDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYN 67

Query: 107 EVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASRDP 146
           E  A  +   L  L+ E  K+R E   D  V E L +RDP
Sbjct: 68  EDRAELMAAHLRDLLGEANKFRGEKPRDKTVRELLTARDP 107

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAK--CSERGVVINAEDVQLA 659
           +   + GS   C+ +   +T  P Y + D++ LC ELM K K    +  + +  EDV+ A
Sbjct: 318 IAEKRCGSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSA 377

Query: 660 LNKHM 664
           L +H+
Sbjct: 378 LERHI 382

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%), Gaps = 9/62 (14%)

Query: 612 RCSEIWDRIT--------THPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNK 662
           +CS+IW+RI         + P++ D D+D LC+ELM KA+CS  G +VI   D++ +L K
Sbjct: 458 KCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQSLMK 517

Query: 663 HM 664
           H 
Sbjct: 518 HF 519

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 37/53 (69%)

Query: 96  VQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASRDPNL 148
           +  LE I+ +N +E +FLR  +  L+NE+ K+RP+   DSK+L+YL+ R+ ++
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLSMRNTHM 60

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 50  KKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVE 109
           K++G K  +K  LD E K +RTAQNRAAQRAF              V+ LE  +   E E
Sbjct: 23  KRRGNKPGRK-PLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECE 81

Query: 110 ATFLRDQLVTLVNELKKYR 128
              LR  ++ LV EL+++R
Sbjct: 82  VQSLRGHVIALVRELRRWR 100

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 49  PKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEV 108
           PK+K  +  +K+ +D E K +RTAQNRAAQRAF              V+ LE    QN+ 
Sbjct: 29  PKRKVGRPGRKR-IDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKT 87

Query: 109 EATFLRDQLVTLVNELKKYRPETRNDSKVLEYL 141
              FL   L +L++E+ KYR +  +D ++L +L
Sbjct: 88  TTDFLLCSLKSLLSEITKYRAKNSDDERILAFL 120

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 613 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 664
           C  I + I++ PKYS +D+D LCSEL+ KAKC++   +V+ A D+Q AL + +
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKCTDDCKIVVKARDLQSALVRQL 408

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 49  PKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEV 108
           PK+K  +  +K+ +D E K +RTAQNRAAQRAF              ++ LE    QN+ 
Sbjct: 13  PKRKVGRPGRKR-VDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKS 71

Query: 109 EATFLRDQLVTLVNELKKYRPETRNDSKVLEYL 141
              FL+  L +L++E+ KYR +  ND ++L +L
Sbjct: 72  VIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 613 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 664
           C  I   I++ PKYS +D+D LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 59  KQDLDPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGL--ENIQQQNEVEATFLRDQ 116
           ++ LD + K KRT QNR AQRAF              V  L  EN+ +   +E  FL+  
Sbjct: 14  RKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEIIE--FLKQN 71

Query: 117 LVTLVNELKKYRPETRNDSKVLEYLA 142
           ++TL+ E+K YR +T  D K+L+ + 
Sbjct: 72  VMTLLGEIKNYRKQTNKDKKLLDTIG 97

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 613 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCS-ERGVVINAEDVQLALNKHM 664
           CS I   I++ PK+S +D+D LC ELM KAKCS +  +++ A  +Q  L + +
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLARQL 381

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 65  ETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTLVNE 123
           E K +RTAQNRAAQ+AF               + LE+   Q++V   +L+  L +L+ E
Sbjct: 11  EAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLE 69

>Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON}
           YHL009C (REAL)
          Length = 331

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 56/116 (48%), Gaps = 14/116 (12%)

Query: 23  DSAAHHDEIENEHRHDSTRDDDDNEQPKKKGTKISKKQDLDPETKQKRTAQNRAAQRAFX 82
           DS  HH++  ++  H   ++D+    P  +   I   +++  ++K K+ AQNRAAQ+AF 
Sbjct: 106 DSGNHHNDNNSDINHSYEKNDN---SPSSRTPSIPHSENISDDSKAKKKAQNRAAQKAFR 162

Query: 83  XXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVL 138
                           L+ +Q +  +E+   R  L+  + EL+K   E   ++++L
Sbjct: 163 ERKEAR----------LKELQDK-LLESEKNRQSLLKEIEELRKVNTEINAENRLL 207

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 610 LLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVI 651
           LL   +IW  +  HPK +  D++ L +EL   A CS   ++I
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILI 281

>Skud_16.294 Chr16 complement(541842..545453) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 106 NEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR 144
           N+V+ +FL D+L  L+   KK  P+ +N ++VL+YL  +
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLGDK 333

>Smik_16.249 Chr16 complement(453693..457304) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 106 NEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR 144
           N+V+ +FL D+L  L+   KK  P+ +N ++VL+YL  +
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLGDK 333

>Suva_9.231 Chr9 (372034..372771) [738 bp, 245 aa] {ON} YIR018W
           (REAL)
          Length = 245

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 63  DPETKQKRTAQNRAAQRAFXXXXXXXXXXXXXXVQGLENIQQQNEVEATFLRDQLVTLVN 122
           D E  QK+  QNR AQRA+              ++ L  I +  E + T L+D       
Sbjct: 58  DDEELQKKKRQNRDAQRAYRERKNNKLQVLEDTIESLTKIIKNYESKLTRLQD------- 110

Query: 123 ELKKYRPETRNDSKVLEYLASRDPNLP 149
           EL++   E R     L+ LA R P++P
Sbjct: 111 ELQERNSENRALQLKLDALAPRQPSVP 137

>YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}
           RPA135RNA polymerase I second largest subunit A135
          Length = 1203

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%)

Query: 106 NEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR 144
           N+V+ +FL D+L  L+   KK  P  +N ++VL+YL  +
Sbjct: 295 NDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDK 333

>ZYRO0E02838g Chr5 (215374..218964) [3591 bp, 1196 aa] {ON} highly
           similar to uniprot|P22138 Saccharomyces cerevisiae
           YPR010C RPA135 RNA polymerase I subunit A135
          Length = 1196

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 111 TFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR 144
           +FL D+L  L+   KK  P+ RN ++VL+YL  +
Sbjct: 293 SFLTDRLELLLRGFKKRYPQLRNRTQVLQYLGDK 326

>Suva_16.331 Chr16 complement(581588..585199) [3612 bp, 1203 aa]
           {ON} YPR010C (REAL)
          Length = 1203

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 106 NEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYLASR 144
           ++V+ +FL D+L  L+   KK  P+ +N ++VL+YL  +
Sbjct: 295 DDVKDSFLTDRLELLLRGFKKRYPQLQNRTQVLQYLGDK 333

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,594,413
Number of extensions: 2006731
Number of successful extensions: 11376
Number of sequences better than 10.0: 95
Number of HSP's gapped: 11604
Number of HSP's successfully gapped: 133
Length of query: 665
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 549
Effective length of database: 40,180,143
Effective search space: 22058898507
Effective search space used: 22058898507
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)