Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_13.1056.46ON51251224550.0
Suva_13.1176.46ON51351419690.0
YML043C (RRN11)6.46ON50751319500.0
Smik_13.1066.46ON50651219090.0
NCAS0H009006.46ON4954988111e-102
ZYRO0C07172g6.46ON4504927951e-100
NDAI0D008906.46ON5395058031e-100
TDEL0G042406.46ON4444767892e-99
CAGL0J11792g6.46ON5104857361e-90
SAKL0E01980g6.46ON4653507051e-86
KAFR0L004206.46ON4604956963e-85
Ecym_30496.46ON5014596601e-79
KLTH0C10582g6.46ON4814716432e-77
KLLA0C05852g6.46ON4825125893e-69
Kwal_56.225276.46ON4814605797e-68
KNAG0E009106.46ON4863355702e-66
ACL020W6.46ON5395155531e-63
TPHA0J005106.46ON4374615042e-57
TBLA0B005706.46ON5174265093e-57
Kpol_1037.116.46ON4013223981e-42
NCAS0H015405.334ON37470689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_13.105
         (512 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   950   0.0  
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   763   0.0  
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   755   0.0  
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   739   0.0  
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   317   e-102
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   310   e-100
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   313   e-100
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   308   2e-99
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   288   1e-90
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   276   1e-86
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   272   3e-85
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   258   1e-79
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   252   2e-77
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   231   3e-69
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   227   7e-68
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   224   2e-66
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   217   1e-63
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   198   2e-57
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   200   3e-57
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   157   1e-42
NCAS0H01540 Chr8 (296920..298044) [1125 bp, 374 aa] {ON} Anc_5.334     31   9.7  

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/512 (90%), Positives = 462/512 (90%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAV        
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVENNDDDYD 60

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                       VYRRSILQQTKRRRERHWKSVVGELY                NDGRET
Sbjct: 61  YDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQENDGRET 120

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
           GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ
Sbjct: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
           IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR
Sbjct: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
           IFATLIRIPEVQMKSIWGFGVKI              QWMCQIYSSKARFVQNINHRSIV
Sbjct: 241 IFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQNINHRSIV 300

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360
           PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT
Sbjct: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360

Query: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420
           PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL
Sbjct: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420

Query: 421 QTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYE 480
           QTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYE
Sbjct: 421 QTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYE 480

Query: 481 TNAEFLDTQLMDLSPEDNEMAENHHSDEESSE 512
           TNAEFLDTQLMDLSPEDNEMAENHHSDEESSE
Sbjct: 481 TNAEFLDTQLMDLSPEDNEMAENHHSDEESSE 512

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/514 (71%), Positives = 412/514 (80%), Gaps = 3/514 (0%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFEVPITLTNKKFAQRRKLKYQYINH+SRRFD++ K +NTTDSLPTPENSA         
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDEDYD 60

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDG--R 118
                           SI QQTKRRRERHWKSV+GELY                 D    
Sbjct: 61  DDEEERNYESD-AGESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDDQEGDQVEH 119

Query: 119 ETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRK 178
           ET  K  DTDEERKFWKK+EKPE+SFE+WQT S  NK PIN++K+TYH ++KI+KNSLRK
Sbjct: 120 ETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLRK 179

Query: 179 VQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLA 238
           ++IPLLHCTKEN+LYF+ L+KGLEPLQ+PTS  RNYQTRHIITLTNLLH+NVSRHNW LA
Sbjct: 180 MEIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNVSRHNWPLA 239

Query: 239 YRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRS 298
           Y+IFATLIRIP VQ+KSIWG GVKI              QWMCQ+YSSK+RFVQN+N+RS
Sbjct: 240 YKIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSRFVQNVNYRS 299

Query: 299 IVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWV 358
           +VPPFQTGSRTHT+KFA TYLW+ LI+CQKSIE S   D  YDMEN RL+ELID+ISEWV
Sbjct: 300 VVPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEELIDQISEWV 359

Query: 359 LTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKV 418
           L PPFMEDAEV+FIYASCHLLKAD+LSRQFVND    DL+GL++DIKINQVIK+IHYVKV
Sbjct: 360 LIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNNDLVGLNKDIKINQVIKNIHYVKV 419

Query: 419 FLQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDV 478
           FLQTCLDKGGFTIPNRLIE QLK+FE RLYGE QD+ ER +VD YD TD SS +NSFGDV
Sbjct: 420 FLQTCLDKGGFTIPNRLIENQLKSFESRLYGEAQDIHERRMVDDYDNTDNSSADNSFGDV 479

Query: 479 YETNAEFLDTQLMDLSPEDNEMAENHHSDEESSE 512
           YETNAEFLDTQLMDLSP +NEMAENH+SDE+SSE
Sbjct: 480 YETNAEFLDTQLMDLSPVENEMAENHYSDEDSSE 513

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/513 (70%), Positives = 415/513 (80%), Gaps = 7/513 (1%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFEVPITLTN+KFAQRRKLKYQYIN++SRRFD+++K + TTDSLPTPENSA         
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEG 60

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                        YRRS+LQQ KRRRERHW+SVVGE+Y                    +T
Sbjct: 61  QNSEAG------TYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDT 114

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
           G    D+DEERKFWKK+EKPE+SFEIW+T S QNK PIN++KMTYH F+KI+K  LRK++
Sbjct: 115 GIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKME 174

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
           IPLLHCTKEN+LYF+S+S+GLEPL+T TS +RNY+TRHI+TLT+LLH+NVSRHNWSLAY+
Sbjct: 175 IPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYK 234

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
           IFATLIRIP VQ+KS+WG GV+I              QWMCQIYSSK+RFVQNIN+RSIV
Sbjct: 235 IFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIV 294

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPST-INDKHYDMENDRLQELIDKISEWVL 359
           PPFQTGSRTHTAKFA TYLW+SLINCQKS+EPS+ I DK +D END LQELIDKISEWVL
Sbjct: 295 PPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKISEWVL 354

Query: 360 TPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVF 419
           TPPFMEDAEVWFIYASCHLLKAD LSRQFVND    DLIGLDRDIKINQVIKHIHYV+ F
Sbjct: 355 TPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTF 414

Query: 420 LQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVY 479
           L+ CLDKGGF +P+RLIE QLK+FE RLYGE QD+QER++ + YD  D SSVENSFGDVY
Sbjct: 415 LKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSFGDVY 474

Query: 480 ETNAEFLDTQLMDLSPEDNEMAENHHSDEESSE 512
           ETNAEFLDTQLMDLSPEDN + E H+SDE+SSE
Sbjct: 475 ETNAEFLDTQLMDLSPEDNGLDEMHYSDEDSSE 507

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/512 (70%), Positives = 405/512 (79%), Gaps = 6/512 (1%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFEVPITLTNKKFAQRRKLKYQYINH SRRF+K+ K + T  SLPTPENSA         
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALSLPTPENSAAENNEEDDG 60

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                        YRR ILQQ KRRRERHWKSVVGE+Y                 +    
Sbjct: 61  ERNGEGG-----AYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTE 115

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
           G K  D DEERKFWKK+EKPE SFE+W+T S QNK PIN++KMTYH F+KI+KNSLRK++
Sbjct: 116 G-KEEDIDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKME 174

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
           +PLLHCTKE++L+F+SLSKGLEPLQ  TS +RNY+T+HIITLTNLLH+NVSRHNWSLAY+
Sbjct: 175 VPLLHCTKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYK 234

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
           IFATLIRIP VQ+KSIWG GV+I              QWMCQIYSSK RFVQ+ N+RSIV
Sbjct: 235 IFATLIRIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSIV 294

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360
           PPFQTGSRTHT+KFATTYLW+SLI CQKS+E   INDK YDMEND LQ+LID+ISEWVLT
Sbjct: 295 PPFQTGSRTHTSKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLT 354

Query: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420
           PPFMEDAEVWFIYASCHLLKADILSRQF ND    DLIGLDRDIKINQVIKHIHYVKVFL
Sbjct: 355 PPFMEDAEVWFIYASCHLLKADILSRQFANDNKTSDLIGLDRDIKINQVIKHIHYVKVFL 414

Query: 421 QTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYE 480
           QTC DKGGFT+PNRLIE QLK FE RLYGE QD++ERE+ D Y+  D +SV NSF DVYE
Sbjct: 415 QTCSDKGGFTVPNRLIESQLKGFESRLYGEAQDLREREMDDDYNSIDDNSVNNSFRDVYE 474

Query: 481 TNAEFLDTQLMDLSPEDNEMAENHHSDEESSE 512
           TNAEFLDTQLMDLSPE+N++ E  +SDE+SSE
Sbjct: 475 TNAEFLDTQLMDLSPENNQLGEIPYSDEDSSE 506

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/498 (38%), Positives = 275/498 (55%), Gaps = 55/498 (11%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MF++P  ++NK+ A  RK++Y YIN LSR++++    ++   SLPTPENSA         
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYNRQDAESS---SLPTPENSASESHESTGE 57

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                              +  +RR +R WK+V+GE                      E 
Sbjct: 58  DE-----------------EVRRRRLKRRWKNVIGEAVSDTDEDEDG----------EEE 90

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
               G  ++ER+F+K HEKP+ S+EIW T +   + P+ ++ +++ K  KI+K++ R++Q
Sbjct: 91  REDEGPENQERRFFKTHEKPQESYEIWSTDN-NKRMPLQKKFISFSKLNKIEKSTKRRMQ 149

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
             LLH +K N + F S+S+G E L TP  T  ++  +HI  LTNLLHINV +  W +AY+
Sbjct: 150 GSLLHSSKFNNICFESISQGQE-LVTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYK 208

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
           IFA ++RIP+V ++SIWG GVKI               WM  +YSS+  ++Q + HR + 
Sbjct: 209 IFALMVRIPKVDIRSIWGIGVKILSQRAATTTLDFLV-WMNSVYSSRINYIQGMTHR-VD 266

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360
           P F++GS+TH++KF  T+LW SLI C  +     I+  +     D+LQ LI+K+SE VL 
Sbjct: 267 PVFRSGSKTHSSKFTITWLWKSLIYCTDTDNDEDIDSDYGGFGRDKLQILIEKVSELVLI 326

Query: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420
           PPFMEDAEVWFIYA CH++KAD LS  F  + + G      RDI  N+VI++I  VK FL
Sbjct: 327 PPFMEDAEVWFIYALCHMVKADQLSLNFNLNQSNGSA----RDIARNEVIQNIQLVKTFL 382

Query: 421 QTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYE 480
           QT + KG F  P R I  QL  FE RLY +             DET+    +N+  D   
Sbjct: 383 QTAMSKGHFEYPERFITRQLNTFEERLYSK-------------DETNSKDKDNNESD--- 426

Query: 481 TNAEFLDTQLMDLSPEDN 498
            N   +D   + L PE N
Sbjct: 427 -NGSSMDNGNIQLVPETN 443

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  310 bits (795), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/492 (37%), Positives = 266/492 (54%), Gaps = 49/492 (9%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFE+P+ +T+K+    RKLKYQYIN+LS+++D +   +N    LPTPENSA         
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKYDGINGISNGQTELPTPENSATETSE---- 56

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                            + QQ +RR  +  KS++GE Y                 +  E 
Sbjct: 57  --------------NEEVGQQKRRRIRKRLKSIIGESYSDL--------------ESDEE 88

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
                  +EERKF++K+EKP+ +FE WQ    + + PI R ++ Y++  +IQ++ LR+++
Sbjct: 89  QPVEEVDNEERKFYRKYEKPQLTFEKWQ-CDPRKRTPIQRNRINYNRMNRIQRHGLRRME 147

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
             L   ++ N+ +F + ++G +           +Q +HI TLT+LLHINV +  W LAY+
Sbjct: 148 TSLAVASRTNKTFFHATTQGYQLFDPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYK 207

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
            FA LIRIP V ++++WG G +I              QWM  +YS+K  F  ++N+R + 
Sbjct: 208 CFALLIRIPGVDVRTLWGLGERI-LAERQPTRSLEFLQWMSSVYSTKLPFADDVNYR-MA 265

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360
           P F  GS+THT K+ TT+LW  LI     +E   ++ K      +  Q L+D+ISE VL 
Sbjct: 266 PVFTKGSKTHTPKYTTTWLWECLIRYANGLEDLEMDSKS---AAENFQSLMDRISEMVLG 322

Query: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420
           PP+M+D EVWFIYA CH++KAD LS+QF        L G  RDI  NQVI+HI   K  L
Sbjct: 323 PPYMDDPEVWFIYALCHMVKADTLSQQF-----DPRLTGSARDIASNQVIQHIQNTKSHL 377

Query: 421 QTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFGDVYE 480
           Q C  KGGFT P R I  QL  FE RLYG+       E  D  ++    S E+    +Y 
Sbjct: 378 QQCSSKGGFTFPKRYIARQLAAFEARLYGKIDAYDMDEEEDEDNDAHSPSDESG---MYP 434

Query: 481 TNAEFLDTQLMD 492
            N   LDTQL+D
Sbjct: 435 EN---LDTQLID 443

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  313 bits (803), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/505 (38%), Positives = 280/505 (55%), Gaps = 55/505 (10%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKV----AKTTNTTDSLPTPENSAVXXXX 56
           MFE+PI   NK+ A  RK++Y YIN LS+++++         N    LPTPE+SA     
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESHD 60

Query: 57  XXXXXXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXX--------XXXXXXX 108
                                     ++R  R WKSV+GE Y                  
Sbjct: 61  DDDATTSDDLI--------------KRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDV 106

Query: 109 XXXXXXNDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKF 168
                 +D  E+     + +EERKF+KK+EKP+ +FEIWQT +L+ + PIN+  +TY K 
Sbjct: 107 DVEDEMSDHHESAHHIHE-NEERKFFKKYEKPQETFEIWQTNNLK-RVPINKSMITYTKL 164

Query: 169 QKIQKNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHI 228
           +KI+K + RK+ +PLLH +K N+L F ++S+GLE L TP  TI N+  +HI  LT LL++
Sbjct: 165 KKIEKQAKRKITVPLLHASKINKLCFEAMSEGLE-LVTPLVTIENFSLQHIEKLTTLLYL 223

Query: 229 NVSRHNWSLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKA 288
           NVSR NW +AYRIF  LIRI ++ ++SIWG GV+I               WM  +YSS+ 
Sbjct: 224 NVSRENWDIAYRIFTLLIRIKKLDIRSIWGIGVRI-LSEKSPTKTLDFLNWMNSVYSSRL 282

Query: 289 RFVQNINHRSIVPPFQTGSRTHTAKFATTYLWASLI------------NCQKSIEPSTIN 336
            F+Q IN+R + P F++GSRTHT K+  T+LW SLI            N  +S+E  + +
Sbjct: 283 NFIQGINYR-MDPVFKSGSRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSS 341

Query: 337 DKHYDMENDR--LQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQF---VND 391
           +   D+  DR  L +LI+KISE VL PPFMED+EVWFIY+ CH++ AD LS +F   +++
Sbjct: 342 ELDIDINIDRNNLLDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKFNPLISN 401

Query: 392 GTKGDLIGLDRDIKINQVIKHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGET 451
           G++G       DI+ NQVI+HI   K +LQT ++KG F  P + I  QL  +E RLY   
Sbjct: 402 GSRG-------DIERNQVIQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYASD 454

Query: 452 QDVQEREIVDGYDETDISSVENSFG 476
                  + D   +  +  + N + 
Sbjct: 455 PTSNNNNVTDEDVDMQLQDIPNPYS 479

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  308 bits (789), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/476 (38%), Positives = 265/476 (55%), Gaps = 40/476 (8%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFE P+ LT ++    +KL+YQY+N+LS +F+++ + TNT + LPTPENSA         
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLERITNT-NGLPTPENSAAESSE---- 55

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                             LQ+ K+R  R  KS  GE Y                N+    
Sbjct: 56  --------------NEEALQRKKKRIRRRLKSAAGESYSDSESDEVD-------NNHDNE 94

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
             ++ + D+ERKF   +E P+ SFE WQ      + PI R K+++ K+Q++++++ RK+ 
Sbjct: 95  VVEDEEEDQERKFLNNYELPQESFEKWQDDP-SKRVPIQRSKISFTKYQRLRRHAKRKMN 153

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
             +   +K N++Y  ++S+G E +         +Q +HI  LT LLH++VSR  W  AY 
Sbjct: 154 TSIDLASKRNKIYMDTISEGFEMVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYT 213

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
            FA LIR+P+V +++IWG G  +               WM  +YSS++ F +++NHR+  
Sbjct: 214 CFALLIRVPKVDIRNIWGIG-DLILREREPIKSLEFLSWMSSVYSSRSAFAEDVNHRT-P 271

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQK-SIEPSTINDKHYDMENDRLQELIDKISEWVL 359
           P F  GS+TH  KFATT++W SLI C K S+E   +        ND LQ+LI++ISE VL
Sbjct: 272 PVFTKGSKTHVPKFATTWMWESLIQCTKNSLETGELEQIE---SNDGLQDLIERISEMVL 328

Query: 360 TPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVF 419
            PP+M+ +EVWFIY  CHL+KADILS QF      G L G  RDI  NQVI+HI   K  
Sbjct: 329 APPYMDASEVWFIYGLCHLIKADILSNQF-----DGRLAGSARDIASNQVIQHIQRTKSC 383

Query: 420 LQTCLDKGGFTIPNRLIEIQLKNFELRL--YGETQDVQEREIVDGYDETDISSVEN 473
           LQTCL KG F  P R IE QL+ FE RL    +T D  + E+   +D+ D  S+E+
Sbjct: 384 LQTCLSKGDFKYPKRYIERQLEEFEKRLDRQEDTPDDSDHEVESLHDKLDTQSIES 439

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  288 bits (736), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 174/485 (35%), Positives = 258/485 (53%), Gaps = 44/485 (9%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRF--DKVAKTTNTTDSLPTPENSAVXXXXXX 58
           MFEVPIT   ++    R+++YQYIN LSR++   + +K     +SLPTPENSAV      
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANSLPTPENSAVEND--- 57

Query: 59  XXXXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGR 118
                            +S  Q   R + +  K  +GE Y                +D  
Sbjct: 58  -----------------QSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNE 100

Query: 119 ETGRKNGDTDEERKFWKKHEKPERSFEIW---QTASLQNKGPINRRKMTYHKFQKIQKNS 175
                N     E+ F++K+EKPE SFE+W    + + + K  + +  + Y +  ++++ +
Sbjct: 101 FANDMNKF---EKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIA 157

Query: 176 LRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNW 235
            ++V+  ++H    N+ YF   S+G E L+ P   I +Y  +HI  LT +L  +VS+ NW
Sbjct: 158 KKRVEKNVVHMPLVNKRYFDIKSEGYEVLE-PLVDIDSYLLKHIEILTQILFSSVSQGNW 216

Query: 236 SLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNIN 295
            +AYR F+ LIRIPEV +++IWG G +I              +WM  +YSSK  FVQ+  
Sbjct: 217 DIAYRTFSLLIRIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHC 276

Query: 296 HRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSI---EPSTINDKHYDMEN-------D 345
           HR   P F++GSRTHT K+A T+LW  LI   + I   E   +N    + +N       D
Sbjct: 277 HRK-APVFRSGSRTHTPKYALTWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMD 335

Query: 346 RLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIK 405
           +L ELIDKISE VL PP+++D E+WFIY+ CH++ AD LS +F        L G  RDI 
Sbjct: 336 KLTELIDKISEMVLVPPYLDDPEIWFIYSMCHMVHADYLSGKF----NCQRLSGSRRDIA 391

Query: 406 INQVIKHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDE 465
            NQV +HIHYVK +LQ C  KG F  P + I+ +L+ FE R+Y +    +  ++ + YD 
Sbjct: 392 RNQVTQHIHYVKTYLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDN 451

Query: 466 TDISS 470
           T  S+
Sbjct: 452 TSYSN 456

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  276 bits (705), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 217/350 (62%), Gaps = 22/350 (6%)

Query: 128 DEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQIPLLHCT 187
           D E+    K+ KP+ ++E+W T   +N+ P+N   MTY +++KI K + R+V   L + +
Sbjct: 103 DYEKHVKNKYYKPQETYELWTTGP-ENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSS 161

Query: 188 KENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYRIFATLIR 247
           K +  +F ++  G EP +T  S + NYQT HI  LTNLLH+NV   NW +AYR F+ LIR
Sbjct: 162 KNSAAFFSAIYNGYEPYET--SQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIR 219

Query: 248 IPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIVPPFQTGS 307
           +P V ++SIWG GV+I              +WM  ++S+K  F Q  NH ++ P F++GS
Sbjct: 220 LPGVDIRSIWGIGVRI-LKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNH-AMDPVFRSGS 277

Query: 308 RTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLTPPFMEDA 367
           +THT KF T++LW +L+ C    E    N+ + D+  ++LQ L +KISE VLTPP+M+D 
Sbjct: 278 KTHTPKFVTSWLWETLMGCTSKDE----NNGNRDV--NKLQFLTEKISELVLTPPYMDDP 331

Query: 368 EVWFIYASCHLLKADILSRQFV-NDGTKGDLIGLDRDIKINQVIKHIHYVKVFLQTCLDK 426
           ++WFIYA CH+++AD LS+QF+ N+  K    G  RDI  NQVI+HI   K FLQTC +K
Sbjct: 332 KIWFIYALCHIVEADHLSQQFIENEHIKN---GSRRDIARNQVIQHITNAKNFLQTCQEK 388

Query: 427 GGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISSVENSFG 476
           GGF  P + IE QL NFE RLY  T+D     +++ +D    SS  N F 
Sbjct: 389 GGFQFPKQHIEKQLSNFENRLYQRTED-----LLNNFDSD--SSASNEFN 431

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  272 bits (696), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 168/495 (33%), Positives = 265/495 (53%), Gaps = 62/495 (12%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFE+P+ + +K  +  RKL+Y+YIN  +RRF++     +  + + TPE S          
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER----KDDRNGMITPETSE--------- 47

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                               + ++R++R W  V+GE Y                 +    
Sbjct: 48  -------------------DELQQRKKRDWLHVIGE-YGSDDDERSGGQQDDEEEEEEVI 87

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
                  +EERKF+KK +KP+ ++E W   S + K  I R  +TYH++ K+ +   RK+ 
Sbjct: 88  DEDYNLNNEERKFFKKIDKPQETYEHW--PSHRKKTRIQRDILTYHRYNKVSRYVERKMA 145

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
             L+H + +NR +F+    G+E ++       N+Q + I TLTNLL++NV+R NW +AY+
Sbjct: 146 NSLVHVSSKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYK 205

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIV 300
           IFA LIRIP+V ++S+W  G +I              +WM  +YS++  F+Q IN+R   
Sbjct: 206 IFAMLIRIPKVDIRSVWNVGNRI-LYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYR-FD 263

Query: 301 PPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLT 360
           P F++GS+ HT K+   +LW SL+   + +         ++ +++ + +LIDKI+E VL 
Sbjct: 264 PVFRSGSKNHTPKYTLQWLWNSLLEYTEQL---------FENDDENIDKLIDKIAEMVLI 314

Query: 361 PPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFL 420
           PPFM+D E+WFIY+ CH++KAD LS +F         +G  RDI +NQVI+HI+ VK +L
Sbjct: 315 PPFMDDPEIWFIYSMCHMVKADFLSSKFDTHS-----VGSMRDISMNQVIQHINDVKRYL 369

Query: 421 QTCLDK--GGFTIPNRLIEIQLKNFELRLYGETQDVQERE-IVDGYDETDISSVENSFGD 477
             C +K  G +     +I  QLK FE+RLY E     E E  +DG +E ++        +
Sbjct: 370 NVCKEKSQGQYESNEMIITKQLKAFEVRLYKEPVFPLEPENDLDGDNEEEVDE-----SN 424

Query: 478 VYETNA---EFLDTQ 489
           V+E +A   EF DTQ
Sbjct: 425 VFEDSANYFEFDDTQ 439

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  258 bits (660), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 168/459 (36%), Positives = 241/459 (52%), Gaps = 36/459 (7%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKT-------TNTTDSLPTPENSAVX 53
           MFE PI   N K  +RRKLKY+YIN L R+++ +  T       T  T  LPTP NSA  
Sbjct: 1   MFESPIISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAAE 60

Query: 54  XXXXXXXXXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXX 113
                                   + +  +R+R    +S++G                  
Sbjct: 61  ASDGDGRE-------------EDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGS 107

Query: 114 X-NDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQ 172
             +DG E G  + + D E+ F+ K+  PE ++E+W T S+ N+ PI RR M+YH F+ I+
Sbjct: 108 EDDDGYEDGYLD-EKDPEKIFYSKYYVPEETYEVW-TTSINNRIPIQRRSMSYHVFRTIE 165

Query: 173 KNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSR 232
           K + +KV   L   +K+   +F  +  G E    P   I NYQ  H+  L +LL+IN+ R
Sbjct: 166 KYAHKKVAASLALSSKKLTGFFEVIRSGYE--TCPRERITNYQKVHLHHLVDLLYINILR 223

Query: 233 HNWSLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQ 292
            ++  AYR F+ LIR+  V ++S+W  G KI              +WM  + +S + F Q
Sbjct: 224 GDFDTAYRCFSLLIRMNFVDLRSMWNLGSKI-LEHYNLDDQERFLEWMSTVLTSNSAFPQ 282

Query: 293 NINHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELID 352
           N  ++ + P F++GSRTH   F  ++LW  L N  K    S+ +D ++         L+D
Sbjct: 283 NSKNQ-LDPVFRSGSRTHIPNFVLSWLWLVLENAVKERVFSSGHDINW---------LLD 332

Query: 353 KISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKH 412
           KISE VL PP+M+DAEVWFIYA C+ +KAD LS Q   +G+   L G   DI  NQVI++
Sbjct: 333 KISELVLRPPYMDDAEVWFIYAMCYFIKADKLSLQLKQEGSLNGLKGSQLDIARNQVIEN 392

Query: 413 IHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGET 451
           IH+VK  L+ C +KGGF  P R+IE QL  FE RLY E+
Sbjct: 393 IHHVKNHLRICEEKGGFQYPKRVIEAQLVEFEKRLYPES 431

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  252 bits (643), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/471 (33%), Positives = 240/471 (50%), Gaps = 42/471 (8%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFE+P+    K+    RKL+YQYIN L + + KV    N   +LPTPENSA         
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGD- 59

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                        +  +     +RRR+R   SV+G                    +  E 
Sbjct: 60  -------------HNSADATSRRRRRKRRLLSVLGHAETDTELSDM---------EAEEG 97

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
             +    D E++F+ +HEKP+ +FE+W T   Q   P+N   ++Y   ++I+K++ ++V 
Sbjct: 98  SHEADQADSEKEFFTRHEKPQETFEVWNT-DRQKAVPMNTATLSYDTCKQIEKHAQKRVS 156

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
             + H +K    +F+++  G E   T   T  ++   HI  L  LLH N+ +  W  AYR
Sbjct: 157 AGMAHISKNANFHFQAMKDGYE---TVAETPESHHLVHIAQLNELLHTNIMKGKWDTAYR 213

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQ----WMCQIYSSKARFVQNINH 296
            F+ LIR+P + ++S+WG G +I              +    W+  I+SS++ F Q +N 
Sbjct: 214 CFSLLIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNF 273

Query: 297 RSIVPPFQTGSRTHTAKFATTYLWASLI-NCQKSIE-PSTINDKHYDMENDRLQELIDKI 354
             + P F+ GS+TH AKF   +LW  L  +C    E PS       D  N +L  L++++
Sbjct: 274 L-MDPVFRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSA-----EDASNRKLSHLLERL 327

Query: 355 SEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIH 414
           SE VL PP+MED EVWFI+A CHL+ AD LS++F++  TK     L+RDI  NQV +HI 
Sbjct: 328 SEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFIS--TKLRTSELERDISRNQVTQHIT 385

Query: 415 YVKVFLQTC-LDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYD 464
              + ++TC   K  F+ P R+IE QL  FE RLY  + +    ++  G++
Sbjct: 386 NAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFE 436

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  231 bits (589), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 156/512 (30%), Positives = 249/512 (48%), Gaps = 66/512 (12%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKV----------AKTTNTTDSLPTPENS 50
           MF++P+   + +  +RRK++YQYIN L R++D++          ++  N T+ + TPENS
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 51  AVXXXXXXXXXXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXX 110
                                         + K RR+R  +SV+G               
Sbjct: 61  ESSEAEAADL--------------------EKKHRRKRRLQSVLGNALDSSDEEL----- 95

Query: 111 XXXXNDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQK 170
                DG E G    + D E +F++ H KP+ +FE+W   +   + PI R+K+TY+  +K
Sbjct: 96  -----DGDEDG--TDENDPETQFYESHIKPQHTFEVWNVNTAL-RTPIQRKKITYNAVKK 147

Query: 171 IQKNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINV 230
           ++K + + V   L + TK+  +YF++L  G +    P   +   +T H+  L  LL+ NV
Sbjct: 148 LEKAATKSVTKKLNYQTKKLNMYFQALKFGFDVY--PKPQLSKQKTMHLAHLNQLLYTNV 205

Query: 231 SRHNWSLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARF 290
              NW +AYR F+ LIR+ +V ++S+W  G +I              +W+  ++ S+ +F
Sbjct: 206 LNQNWEIAYRCFSILIRLEDVDVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQF 265

Query: 291 VQNINHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQEL 350
            Q  N+ S+ P F+ GSRTHT  F  T+LW  L         S ++ + +      LQ L
Sbjct: 266 NQGTNY-SLDPVFRCGSRTHTPTFVLTWLWTRLFIATSG--SSAVDKEKF------LQSL 316

Query: 351 IDKISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVI 410
           ID++ E VL+PP+M+D+E+W+I+   HL+ A  LS +F    +K  L+G   DI  NQVI
Sbjct: 317 IDRLDEMVLSPPYMDDSEIWYIFGLTHLVMASELSSKFRQ--SKDILLGSRADIARNQVI 374

Query: 411 KHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYDETDISS 470
           +HI+  K  LQ C     +  P  +IE QL   E  LY +         V+  DE+  SS
Sbjct: 375 QHINNAKNCLQMCKANSNYEFPENVIEHQLVQLERSLYTDELS------VNCTDESAKSS 428

Query: 471 VENSFGDVYETNAEFLDTQLMDLSPEDNEMAE 502
            E+     Y       D+ L D+ P D +  E
Sbjct: 429 DEDGIEHSYPNE----DSNLPDVGPLDTQQYE 456

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  227 bits (579), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 150/460 (32%), Positives = 225/460 (48%), Gaps = 41/460 (8%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXXXX 60
           MFE+P+   + +    RKL+YQYIN LS+   ++  +     +LPTPENSA         
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTPENSAAEDASDGDQ 60

Query: 61  XXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGRET 120
                          R IL            SV+G +                 ++ +E+
Sbjct: 61  DSEDAGSRRRRRK--RRIL------------SVLGHIDSESELSDVDMSTESHHSELQES 106

Query: 121 GRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQ 180
                    E++F+  HEKP+ ++E W T   +    +    ++Y + + I+  + R+V 
Sbjct: 107 ---------EKEFFSHHEKPQDTYETWNT-DRRKAVSMTTATLSYAENKLIEARAQRRVI 156

Query: 181 IPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYR 240
             + H ++  R +F S+ +G E    P+     +QT HI  L  LLHINV    W  A+R
Sbjct: 157 ERIGHFSRIARSHFNSIKRGYEIYSRPSQV---HQTTHITHLNELLHINVMEGQWETAFR 213

Query: 241 IFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQ----WMCQIYSSKARFVQNINH 296
            F+ LIR+P V ++S+WG GV+I                   W+  IY+S++ F   +N 
Sbjct: 214 CFSILIRLPGVDIRSMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNF 273

Query: 297 RSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYD--MENDRLQELIDKI 354
             + P F+TGS+ HTAKF + +LW  L        P  + ++  D    N +L +L++K+
Sbjct: 274 L-MDPVFRTGSKKHTAKFVSAWLWEMLFAAC----PDKLEERQADNGSGNRKLIQLLEKL 328

Query: 355 SEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKHIH 414
           SE VL PP+MED E+WFIYA CHL+ AD LS++F    T  +   L+RDI  NQV +HI 
Sbjct: 329 SEMVLIPPYMEDPEIWFIYALCHLVSADELSQRFT--FTYSESTELERDISRNQVTQHIT 386

Query: 415 YVKVFLQTCLDKG-GFTIPNRLIEIQLKNFELRLYGETQD 453
                ++TC  KG  F  P R+IE QL  FE RLY    D
Sbjct: 387 NAHNCIRTCEAKGDDFFFPRRIIEEQLAFFERRLYEHVGD 426

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  224 bits (570), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 195/335 (58%), Gaps = 26/335 (7%)

Query: 131 RKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQIPLLHCTKEN 190
           RK++K HEKPE  +E+W  A+ + K PI R+ ++Y++ Q I++ + RK+++PLLH ++  
Sbjct: 110 RKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVR 169

Query: 191 RLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYRIFATLIRIPE 250
              F +   G + +     T  +++ +HI  L  LLH ++S  NW+LAY++FA LIR+P 
Sbjct: 170 SSEFSAEIDGYDVVSRGDETT-HFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPR 228

Query: 251 VQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQNINHRSIVPPFQTGSRTH 310
           V ++++W  GV I              +WM  +YS+K RF+QN+NHR + P F++GSRTH
Sbjct: 229 VDIRAVWNLGVAI-LARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHR-LPPAFRSGSRTH 286

Query: 311 TAKFATTYLWASLINCQKSIE---PSTINDKHYDMENDRLQELIDKISEWVLTPPFMEDA 367
           TA++ TT+LW SL    +  +   P+T+         + L+ L DK SE +LTPP+M+D+
Sbjct: 287 TAQYTTTWLWLSLRAATEQAQEGAPTTL---------EPLELLTDKTSELLLTPPYMDDS 337

Query: 368 EVWFIYASCHLLKADILSRQFVNDGTKG--DLIGLDRDIKINQVIKHIHYVKVFLQTCLD 425
           EVWFIY SC+ +KADILSR   +D T           D++ N+V++ I   +  L T  +
Sbjct: 338 EVWFIYCSCYFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEE 397

Query: 426 KGG---------FTIPNRLIEIQLKNFELRLYGET 451
           K           + +P   I+ QL+  E RL  ++
Sbjct: 398 KSDQARHRAHAYWELPTGYIKRQLQQIEKRLTAQS 432

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  217 bits (553), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 155/515 (30%), Positives = 247/515 (47%), Gaps = 53/515 (10%)

Query: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNT-------TDSLPTPENSAVX 53
           MFE PI   +K+  Q+R LKY+Y++ + R+++++   +++       +   PTP+NSA  
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 54  XXXXXXXXXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXX 113
                                      +  +R+    +S++G                  
Sbjct: 106 ASDGDALEGDVDTAA------------RRLKRKRLRLQSILGHATLDAEEGDLGSEEEDD 153

Query: 114 XNDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQK 173
            N G          D E++F+ ++ KPE ++E+W T S +N+ PI R+ ++Y  F++I+ 
Sbjct: 154 LNGGSTA------KDYEKQFFARYYKPEYTYELWAT-SPKNRVPIRRKMLSYQAFKQIEN 206

Query: 174 NSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRH 233
            S ++++  L   TK+   Y   +  G E    P   + NYQ  H+  L  LL+ N+   
Sbjct: 207 YSNQRMKATLSLSTKKAAAYHEVMRLGYE--TCPKEEVTNYQKLHLNHLVGLLYSNIISE 264

Query: 234 NWSLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKARFVQN 293
           NW  AYR FA LIR+  V ++SIW  G  I              +WM  +++S + F QN
Sbjct: 265 NWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFL-EWMGTVFTSHSVFSQN 323

Query: 294 -INHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELID 352
            +N   I P F++GSR HT  F   +LW  L    +      + D    M       L++
Sbjct: 324 KVNL--IDPVFRSGSRAHTPNFMLAWLWLVL----RGATADEVLDSTRSM-----AWLLE 372

Query: 353 KISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVN-DGTKGDLIGLDRDIKINQVIK 411
           K+SE VL PP+M+DAE+WF+YA C+ ++AD LS Q  + +G K  L G   DI   QV +
Sbjct: 373 KVSELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIK--LHGSKLDIAKTQVTQ 430

Query: 412 HIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDG--YDETDIS 469
           +I  VK  L++C +KG FT P R+I+ QL  FE RLY  T     +E  DG  +D  +  
Sbjct: 431 YICSVKNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTH----KEQTDGNSFDTYESD 486

Query: 470 SVENSFGDVYETNAEFLDTQLMDLSP---EDNEMA 501
           + E +      +  +F D    +  P   ED++ A
Sbjct: 487 TGEQNDNPTMVSETDFHDPNFRNFKPDVAEDDDTA 521

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  198 bits (504), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 133/461 (28%), Positives = 224/461 (48%), Gaps = 44/461 (9%)

Query: 1   MFEVPIT--LTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVXXXXXX 58
           MFE+P++  +T   F   +KL+YQYIN ++ + ++++K     + LPTP  S        
Sbjct: 1   MFELPVSSNITINAF-NLKKLRYQYINDINAKHNELSK-----NELPTPVTSENDTGGED 54

Query: 59  XXXXXXXXXXXXXXVYRRSILQQTKRRRERHWKSVVGELYXXXXXXXXXXXXXXXXNDGR 118
                                +  + RR R WKS++GE                   +  
Sbjct: 55  LDGDSEHNLTSEDA-------EVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFED- 106

Query: 119 ETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRK 178
                NG TDEE+K++ +++KP+ SFE W++ +L+ +  +N+  +TY++F+K +K   +K
Sbjct: 107 -----NGPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKK 161

Query: 179 VQIPLLHCTKENRLYFRSLSKGLEPLQ----TPTSTIRNYQTRHIITLTNLLHINVSRHN 234
            ++  +H  K  +  F  +  G EP+     +    ++NY   H+  LT+L++ N+ +  
Sbjct: 162 YKVKTMHLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQK 221

Query: 235 WSLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYSSKAR-FVQN 293
           W +AY+ F  L+RIP+V ++ +W  G  I              QW+  +YS+K R FVQ 
Sbjct: 222 WDIAYKCFTFLLRIPDVDIRRVWNLG-SIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQG 280

Query: 294 INHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDK 353
           IN+R+    F  GSR  T  +  T LW  L          T++      E++ +  LI++
Sbjct: 281 INYRNDQTNFNGGSRRLTPLYTKTLLWHKL----------TLSSDSETCESE-IDSLIEQ 329

Query: 354 ISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKG------DLIGLDRDIKIN 407
           I+E V+ PP+ ED E+W+I+A CHL+KAD LS +      +       D    D +I  N
Sbjct: 330 IAEMVVIPPYSEDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNN 389

Query: 408 QVIKHIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLY 448
           ++   I+  K +L+       F  P R IE +LK  E R +
Sbjct: 390 KITICINNCKKYLRKATQDKNFDYPARTIETKLKTIETRTF 430

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  200 bits (509), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 225/426 (52%), Gaps = 51/426 (11%)

Query: 116 DGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTA--------SLQNKG--PINRRKMTY 165
           D        G T+EE KF+ ++++P+ SFE+W T+         L++ G  PINR K+++
Sbjct: 87  DDEYNSDSTGTTNEETKFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISF 146

Query: 166 HKFQKIQKNSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNL 225
           ++  +++K + +K++  L HCTK  + + +++S+G E       T  ++   HI  L NL
Sbjct: 147 NRLNRVKKFTNKKLEARLQHCTKRLKTHIKAISEGYETSYRDKQTT-SFNNIHIENLINL 205

Query: 226 LHINVSRHNWSLAYRIFATLIRIPEVQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYS 285
           L+ N+   N++ AY IF+ +IR+P + +++ W  G  I               W+  IYS
Sbjct: 206 LYYNICEKNFNQAYHIFSLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYS 265

Query: 286 SKARFVQNINHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMEND 345
           S  ++  +IN+++  P F   SR HT KF T++LW +L         S I+ K  D+ + 
Sbjct: 266 SNQKYNNSINYKT-APAFTQSSRNHTGKFTTSFLWMTL---------SLIHTKFSDLTSR 315

Query: 346 RLQEL--------------IDKISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVND 391
            ++E+              ++K+SE VL PPF+ED+E+W+IY+  HL    IL+R  + +
Sbjct: 316 NIKEIVEELNYLKKKLKKFVEKLSEMVLAPPFIEDSEIWYIYSLSHL----ILARMLMFE 371

Query: 392 GTKGDL--IGLDRDIKINQVIKHIHYVKVFLQTCL-DKGGFTIPNRLIEIQLKNFELRLY 448
               D+    +++DI  N++I +I + K  LQ    ++  +    + IEI+LK+ E +LY
Sbjct: 372 TRNNDISQTSVEKDITKNEIISNIQHCKSHLQKVRENQNDYNFKFQKIEIELKDMEKKLY 431

Query: 449 GETQD---VQEREIVDGYDETDISSVENSFGDVYETNAEFLDTQLMDLSPEDNEMAENHH 505
             + D   + E E +D  D  D  + EN+F   +E N E  + QLM  +P  +E    ++
Sbjct: 432 DTSSDEEILNEEEFLDNEDVLD--NEENNFN--HEINFEHKNNQLM--TPSYDEPIYKYN 485

Query: 506 SDEESS 511
            D+E S
Sbjct: 486 LDDEFS 491

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 11/62 (17%)

Query: 1  MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKV-----------AKTTNTTDSLPTPEN 49
          MFE P+ + +K  A  RK++YQYIN  ++R+ ++           +  + T  +LPTPE 
Sbjct: 1  MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQLYGDTIPSSSLESNRSRTPITLPTPEA 60

Query: 50 SA 51
          SA
Sbjct: 61 SA 62

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  157 bits (398), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 169/322 (52%), Gaps = 24/322 (7%)

Query: 131 RKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRKVQIPLLHCTKEN 190
           +K++ +++KPE SFE W  ++ +++  INR+ M+Y K+ K+ K S +K+Q+PL+   ++ 
Sbjct: 97  KKYFSRYDKPEDSFERW-ASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKL 155

Query: 191 RLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLAYRIFATLIRIPE 250
           +  F S+  G E +    +   N+   ++  LT+L++ ++ + NW +AYR F  LIR+P+
Sbjct: 156 QENFLSVIDGYELIDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPK 215

Query: 251 VQMKSIWGFGVKIXXXXXXXXXXXXXXQWMCQIYS--SKARFVQNINHRSIVPPFQTGSR 308
             ++ IW  G  I              +    I+S   K  F Q +N+R   P F  GSR
Sbjct: 216 TSIRKIWNLGSMIIENLEGINKTIEFLKLFNNIHSRYKKKIFNQTVNYRE-APVFNDGSR 274

Query: 309 THTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELIDKISEWVLTPPFMEDAE 368
             T  +  T LW  +     S   S+    +Y+       ELI+ +SE  L PPFMED+E
Sbjct: 275 NKTPIYIKTLLWKEITTTSTSSRTSS----NYN-------ELIEYLSELTLIPPFMEDSE 323

Query: 369 VWFIYASCHLLKADILS---RQFVNDGTKGDLIGLDRDIKINQVIKHIHYVKVFLQTCLD 425
           +W+IY   HL +A+ LS     ++++ +        +DI  N+V+++I   + FL+   +
Sbjct: 324 IWYIYGIVHLQRANELSMNLEHYIDNSSSS------KDIANNEVVQNIKLAQKFLKKAKE 377

Query: 426 KGGFTIPNRLIEIQLKNFELRL 447
                +P R I + +KN E R+
Sbjct: 378 LSKIEVPERQITLMIKNIEGRM 399

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 1  MFEVP-ITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENS 50
          MFEVP I  T +     +KL+YQY+NH+  R     +       LPTP +S
Sbjct: 1  MFEVPTIDSTKRSVVNFKKLRYQYMNHMYER----NRYNKNGQGLPTPVSS 47

>NCAS0H01540 Chr8 (296920..298044) [1125 bp, 374 aa] {ON} Anc_5.334
          Length = 374

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 157 PINRRKMTYHKFQKI--QKNSLRKVQI---PLLHCTKENRLYFRSLSKGLEPLQTPTSTI 211
           P+ R +     FQK    K  LRK+ +   PL+ CT E      +   G EP++    T 
Sbjct: 35  PLFRSQEKLETFQKTAHSKIGLRKIYLEEKPLIECTVEKAECPETF--GGEPIENLVITT 92

Query: 212 RNYQTRHIIT 221
           + YQT+  IT
Sbjct: 93  KTYQTKEAIT 102

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,992,307
Number of extensions: 2172245
Number of successful extensions: 7254
Number of sequences better than 10.0: 36
Number of HSP's gapped: 7364
Number of HSP's successfully gapped: 44
Length of query: 512
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 398
Effective length of database: 40,409,475
Effective search space: 16082971050
Effective search space used: 16082971050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)