Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2707.342ON62627011641e-151
Smik_12.2647.342ON61227010161e-129
YLR206W (ENT2)7.342ON6132709871e-125
Suva_10.3007.342ON6182749661e-122
NCAS0H006707.342ON4832148012e-99
CAGL0A03872g7.342ON5102717405e-90
KAFR0L014607.342ON5502737367e-89
TDEL0C020507.342ON5012707301e-88
Smik_4.757.342ON4601997061e-85
NDAI0D006107.342ON4862707072e-85
ZYRO0F11550g7.342ON5382707042e-84
Skud_4.947.342ON4472706912e-83
TBLA0E004807.342ON5991966919e-82
YDL161W (ENT1)7.342ON4542056801e-81
Kwal_56.246107.342ON5082156742e-80
Suva_4.837.342ON4622056661e-79
KNAG0C038007.342ON4471876614e-79
Kpol_2001.707.342ON5331916432e-75
KNAG0B026507.342ON6462446484e-75
SAKL0F10934g7.342ON4982146323e-74
TPHA0D045607.342ON4872726164e-72
KLLA0C16731g7.342ON4782716052e-70
KLTH0H01430g7.342ON5022716027e-70
Ecym_47317.342ON5142155862e-67
KAFR0B008907.342ON4141415757e-67
TBLA0E020407.342ON7012095589e-62
ACL157C7.342ON5151964803e-52
KLTH0D16896g4.346ON4011422504e-22
Suva_12.2164.346ON4101432452e-21
Kwal_47.168574.346ON3821422414e-21
NDAI0D032004.346ON4351422426e-21
SAKL0G17952g4.346ON4151422409e-21
KLLA0B04587g4.346ON4001422391e-20
Skud_10.3494.346ON4101422391e-20
TDEL0D007104.346ON3751422362e-20
YJR125C (ENT3)4.346ON4081422372e-20
Smik_10.4184.346ON4091422362e-20
KNAG0M003804.346ON4031422353e-20
NCAS0A062104.346ON4231692336e-20
Kpol_1001.24.346ON4181422328e-20
KAFR0B067404.346ON3992322319e-20
AER155C4.346ON3641542272e-19
TBLA0E047604.346ON4261422274e-19
Ecym_11334.346ON3921482256e-19
ZYRO0B14784g4.346ON4241422249e-19
TPHA0B004004.346ON3991702221e-18
CAGL0H04323g4.346ON4121652024e-16
SAKL0H25762g4.17ON2621601832e-14
Kwal_55.206114.17ON2541581735e-13
TDEL0G017404.17ON2571621594e-11
Kpol_388.54.17ON2681421585e-11
TBLA0B062204.346ON3391551581e-10
TPHA0F002304.17ON2802041532e-10
KLTH0E05874g4.17ON2551481443e-09
ZYRO0G07876g4.17ON2591501382e-08
TBLA0G006504.17ON4232121332e-07
Ecym_84074.17ON2541531292e-07
Suva_10.354.17ON2471341274e-07
NCAS0C058404.17ON2671521231e-06
KLLA0D03949g4.17ON2251371221e-06
ACL061C4.17ON2341481184e-06
TBLA0H012108.335ON4911701215e-06
Kpol_344.88.335ON3841721197e-06
KAFR0I014604.17ON2751551161e-05
NDAI0H002804.17ON3101501162e-05
NCAS0B036608.335ON4161731152e-05
Skud_12.304.17ON2471341123e-05
CAGL0E03806g4.17ON2601341105e-05
YHR161C (YAP1801)5.84ON637881136e-05
KLLA0D16654g8.335ON3991871101e-04
Skud_8.2255.84ON621881092e-04
SAKL0H02530g5.84ON669961082e-04
NDAI0J009308.335ON4181731063e-04
Smik_8.2455.84ON627881046e-04
TDEL0F045908.335ON3612121037e-04
ZYRO0F13684g8.335ON4071731038e-04
KAFR0B058008.335ON3821771020.001
KNAG0A051008.335ON421172960.004
Kwal_YGOB_27.112618.335ON404195960.005
CAGL0E01199g8.335ON412178940.008
KLTH0G11902g8.335ON399177930.010
YLL038C (ENT4)4.17ON247100910.013
TBLA0B057705.84ON680120920.017
TBLA0A040408.335ON415180910.022
Smik_12.194.17ON247100890.022
Kwal_27.11263singletonOFF275194870.048
TPHA0A052105.84ON63296860.082
TPHA0C007408.335ON38597800.38
KNAG0E006105.84ON60472800.52
Kpol_1050.735.84ON67154715.8
NDAI0A028305.84ON47377715.9
KLTH0D03784g4.56ON109695708.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.270
         (626 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   452   e-151
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   395   e-129
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   384   e-125
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   376   e-122
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    313   2e-99
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   289   5e-90
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   288   7e-89
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   285   1e-88
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   276   1e-85
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   276   2e-85
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   275   2e-84
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   270   2e-83
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   270   9e-82
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   266   1e-81
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   264   2e-80
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   261   1e-79
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   259   4e-79
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   252   2e-75
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   254   4e-75
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   248   3e-74
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   241   4e-72
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   237   2e-70
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   236   7e-70
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   230   2e-67
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   226   7e-67
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   219   9e-62
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   189   3e-52
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...   100   4e-22
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    99   2e-21
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    97   4e-21
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    98   6e-21
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    97   9e-21
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    97   1e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    97   1e-20
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    96   2e-20
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    96   2e-20
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    96   2e-20
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    95   3e-20
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    94   6e-20
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    94   8e-20
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    94   9e-20
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    92   2e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    92   4e-19
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    91   6e-19
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    91   9e-19
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    90   1e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    82   4e-16
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    75   2e-14
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    71   5e-13
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    66   4e-11
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    65   5e-11
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    65   1e-10
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    64   2e-10
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    60   3e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    58   2e-08
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    56   2e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    54   2e-07
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    54   4e-07
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    52   1e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    52   1e-06
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    50   4e-06
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    51   5e-06
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    50   7e-06
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    49   1e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    49   2e-05
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    49   2e-05
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    48   3e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    47   5e-05
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    48   6e-05
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    47   1e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    47   2e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    46   2e-04
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    45   3e-04
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    45   6e-04
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    44   7e-04
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    44   8e-04
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    44   0.001
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    42   0.004
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    42   0.005
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    41   0.008
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    40   0.010
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    40   0.013
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    40   0.017
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    40   0.022
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    39   0.022
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    38   0.048
TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa] ...    38   0.082
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    35   0.38 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    35   0.52 
Kpol_1050.73 s1050 complement(162665..164488,164492..164527,1645...    32   5.8  
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    32   5.9  
KLTH0D03784g Chr4 complement(367647..370937) [3291 bp, 1096 aa] ...    32   8.0  

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  452 bits (1164), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 225/270 (83%), Positives = 225/270 (83%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAA                          
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                              AYYDIFGNPIS
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  234 bits (596), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 122/173 (70%), Positives = 122/173 (70%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYSXXXXXXXXXX 573
           PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYS          
Sbjct: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYSQPQQQPQYTQ 573

Query: 574 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYTPDQGISLIDL 626
                                                    YTPDQGISLIDL
Sbjct: 574 NYQQQPQYAEIPQQQQQTQQPQYTQNYQQGSSQPQQPQQQGYTPDQGISLIDL 626

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  395 bits (1016), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/270 (78%), Positives = 215/270 (79%), Gaps = 5/270 (1%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNM+KGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKELVSLLNDDERLREERSMNTRNR    A RP PRRQRT SNP DSSPSYQ++L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EK LEESRITAQEDEQRRRELAQYDDEDPDFQAA                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAA-----LQLSKEEEELKQLQELQRLQN 235

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                              AYYDIFGNPIS
Sbjct: 236 QQQSLSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  208 bits (529), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 98/107 (91%), Positives = 101/107 (94%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKYNDLN LLATGTG DTFGNTGEARIPAQHTKTGTFINSQGTGYKQV +E
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNI 560
           PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQ+P  NSPPQNS N+
Sbjct: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPANSPPQNSINV 535

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  384 bits (987), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/270 (79%), Positives = 218/270 (80%), Gaps = 3/270 (1%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNM+KGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKELVSLLND+ERLREERSMNTRNR AN+A RP PRRQRT SNP DSSPSYQD+L
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EK LEESRITAQEDEQRRRELAQYDDEDPDFQAA                          
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAA---LQLSKEEEELKQLQELQRLQKQQ 237

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                              AYYDIFGNPIS
Sbjct: 238 QSLSQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  208 bits (529), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 104/110 (94%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKY+DLN LLATGTG+DTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT+E
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYS 563
           PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQ+P  NSP QN T I+YS
Sbjct: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPTNSPQQNPTGISYS 537

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  376 bits (966), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/274 (74%), Positives = 211/274 (77%), Gaps = 15/274 (5%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNMVKGYSSTQVLVRDATAND RTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANK----APRPGPRRQRTGSNPRDSSPSY 176
           IIRVKAKELVSLLNDDERLREER+MNTRNR  NK     P P PRRQRT SN  DS P+Y
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 177 QDELEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXX 236
           Q++LEK LEESRITAQEDE RR E+AQYDD+DPDFQAA                      
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAA-----------LQLSKEEEELK 229

Query: 237 XXXXXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                                  AYYDIFGNPIS
Sbjct: 230 QLQELQKQQQLQSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  206 bits (523), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 96/108 (88%), Positives = 103/108 (95%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKYNDLNVLLATGTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQV +E
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNIN 561
           PKNNPFL++QYTGLPST+IVPTQTGYGFGNQPQNP +NSPPQN  N+N
Sbjct: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVN 544

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  313 bits (801), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 176/214 (82%), Gaps = 3/214 (1%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNMVKGYS+TQVLVRDAT+ND+  PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKEL SLL D+ERL+EER++N +NR          RR        D     QDEL
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDED---QDEL 177

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAA 214
           ++ LEESR+TA+EDE+RRR++AQYDD+DPD Q A
Sbjct: 178 QRALEESRLTAEEDERRRRQMAQYDDQDPDLQTA 211

 Score =  169 bits (428), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 78/92 (84%), Positives = 87/92 (94%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSI+DKY+ LN LLATGTG+DTFGNTGE RIPAQHT+TGTFINSQGTGY+QVT++
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQP 545
           PKNNPFL++QYTGLPSTNIV TQTGYGFGN P
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAP 460

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  289 bits (740), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 164/271 (60%), Positives = 190/271 (70%), Gaps = 19/271 (7%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MP Q VRSAKNMVKGYSSTQV+VRDATANDS +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDE 179
           QIIRVKAKEL SLL DDERLREER++N  NR    A R   R +   ++ R+   +Y D+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRN---AYDDD 177

Query: 180 LEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L+K LEESR+TA+E+E RRRE AQY+++DPD  AA                         
Sbjct: 178 LQKALEESRMTAEEEEARRREQAQYENQDPDLLAA---------------LQLSKEEEEL 222

Query: 240 XXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                                YYDIFGNPIS
Sbjct: 223 KKLQDMQRMQELQAQQQQQNVYYDIFGNPIS 253

 Score =  172 bits (436), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 80/89 (89%), Positives = 87/89 (97%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKY++LN LLA+GTG+DTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT+E
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542
           PKNNPFLS+QYTGLPSTNIVP+ TGYGFG
Sbjct: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  288 bits (736), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 181/273 (66%), Gaps = 20/273 (7%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN++KGYSSTQVLVRDAT+ND+R  +IDTLDD+A RSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWC+EN YVIKTLREFR+E+++G D+GQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELVSLLND---DERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQ 177
           IIRVKAKEL SLL D       R   +   R    +        R ++   P D      
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDD------ 174

Query: 178 DELEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXX 237
           D+L++V+EES+ TA+EDE+RR+ELA+YD+EDP+FQAA                       
Sbjct: 175 DDLQRVIEESKKTAEEDERRRKELARYDEEDPEFQAA-----------LQLSKEEEELKN 223

Query: 238 XXXXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                                  YYD+FGNPIS
Sbjct: 224 LQDLQRQQQQLQMLQQQQTSANVYYDVFGNPIS 256

 Score =  159 bits (403), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 87/96 (90%), Gaps = 1/96 (1%)

Query: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE- 513
           RTGN+ I++KY++LN LLA GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQVT+E 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPA 549
            KNNPFL+ QYTGLPS+NIVP+ TGYGFGNQPQ+ A
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGNQPQDSA 484

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  285 bits (730), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/270 (56%), Positives = 185/270 (68%), Gaps = 28/270 (10%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN+VKGYSS QVLVR+ATAN+S  PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR++++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKEL +LL+DDERLREER MN + R      + G RR+R  +  +D    + D+L
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGR------KNGTRRRRRTTGEQD---GFDDDL 171

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ L+ESR+TA+EDE+RR+ L   DD   D QAA                          
Sbjct: 172 QRALDESRLTAEEDERRRKMLGSEDD---DLQAA----------------LQLSKEEEEL 212

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                               YYDIFGNPIS
Sbjct: 213 KRLQEMQKLQQQQTQQQPSQYYDIFGNPIS 242

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 69/90 (76%), Positives = 81/90 (90%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
            RTG+ ++++KY +LN LLATGTG+DTFGNTG+ARIPAQHTKTGTFINSQGTGY+QVT E
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543
           PK NPFL +QYTG+PS+NIVP  TGYGFGN
Sbjct: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  276 bits (706), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 165/199 (82%), Gaps = 9/199 (4%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           I+RVK+KEL +LL+DDERL EER+MN + R      R G  R+ TG +  D+     ++L
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRN-----RKGRSRRGTGRSSNDND----NDL 171

Query: 181 EKVLEESRITAQEDEQRRR 199
           ++ L+ SR+TA+EDE+RR+
Sbjct: 172 QRALDASRMTAEEDEKRRK 190

 Score =  165 bits (418), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 84/89 (94%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQS++DKYN LN LLATGTG+DTFGN G+AR+PAQHTKTGTFINSQGTGYKQV+++
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542
           PK NPFLS QYTGLPSTN+VPTQTGYGFG
Sbjct: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  276 bits (707), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 186/270 (68%), Gaps = 9/270 (3%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNM+KGYS+TQVLVRDAT+NDS  PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKEL +LL DDERL+EERS+N +N    ++ R    R R G+N         ++L
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNN--RRSERKN--RSRRGTNATRRGTKSDEDL 175

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           +K LEESRITA+EDE+RRRELAQYD++D D+Q A                          
Sbjct: 176 QKALEESRITAEEDERRRRELAQYDNQDTDYQTA----LQLSKEEEELKKLQELQRLQQL 231

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                               YYDIFGNPIS
Sbjct: 232 QQQQQQQMQFQQQPQQQEQVYYDIFGNPIS 261

 Score =  156 bits (394), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 72/89 (80%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKYN+LN LLA+GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+ ++
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 514 P-KNNPFLSNQYTGLPSTNIVPTQTGYGF 541
           P K NPFL+NQYTGLPS+NIVP+ TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 174/270 (64%), Gaps = 26/270 (9%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MP QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH+++   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKEL +LL DDERLR ER     ++GA            +   PR +  SY  E+
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERG---EDKGAPPR-----MMSPSPPTPRRN--SYDSEM 170

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ L+ SR+TA+EDE+RR+ L   ++ED D + A                          
Sbjct: 171 QRALDASRLTAEEDERRRKTL---NNEDADLETA-------------LQLSKEEEELKRL 214

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                               YYDIFGNPIS
Sbjct: 215 QELQKAQQDQQRLSQMQPQGYYDIFGNPIS 244

 Score =  152 bits (384), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 68/90 (75%), Positives = 80/90 (88%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
            RTGNQSISDKYNDLN LLA  TG+DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ ++E
Sbjct: 423 VRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNE 482

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543
           PK NPFL  Q+TG+P++++VP+ TGYGFGN
Sbjct: 483 PKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  270 bits (691), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 142/270 (52%), Positives = 179/270 (66%), Gaps = 31/270 (11%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           I+RVKAKEL +LL+DDERL EER+MN + R          +R+ TG N  D      D+L
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGR-----KRRGTGRNDEDD-----DDL 170

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ ++ SR+TA+EDE+RR+       +D D++ A                          
Sbjct: 171 QRAIDASRMTAEEDERRRK-------QDEDYETA--------------LQLSKEEEELKR 209

Query: 241 XXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                               YYDIFGNPI+
Sbjct: 210 LQDLQRMQQVHAQQQQQQPMYYDIFGNPIT 239

 Score =  162 bits (409), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 72/89 (80%), Positives = 84/89 (94%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQS++DKY  LN LLATGTG+DTFGN G++R+PAQHTKTGTFINSQGTGY+QV+++
Sbjct: 337 TRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND 396

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542
           PK NPFL++QYTGLPSTNIVPTQTGYGFG
Sbjct: 397 PKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  270 bits (691), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 129/196 (65%), Positives = 160/196 (81%), Gaps = 8/196 (4%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQF+RS KNMVKGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE----SGF 116
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DEGQIIRVKAKELVSLLNDDERLREERSMNTR-NRGANKAPRPGPRRQ---RTGSNPRDS 172
           D+GQI+RV+A EL SLL DDERLREERS+++R  R +   PR  P+R+   R+  N + +
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 173 SPSYQDELEKVLEESR 188
              Y D+L+K +EES+
Sbjct: 181 DDHYDDDLQKAIEESK 196

 Score =  169 bits (429), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%)

Query: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514
           RTGNQ ISDKYN+LN LLATGTG+DTFGNTG+ RIPAQHT TGTFINSQGTGYKQ  ++P
Sbjct: 471 RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYINDP 530

Query: 515 KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPP 554
           KNNPF+SNQYTGLPSTN+VP+ TGYGFGNQPQ     S P
Sbjct: 531 KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQTTASQP 570

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  266 bits (680), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 127/205 (61%), Positives = 159/205 (77%), Gaps = 10/205 (4%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           I+RVKAKEL +LL+DDERL EER+MN + R                      S    D+L
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGR----------RRRGTGRSDENDDDL 170

Query: 181 EKVLEESRITAQEDEQRRRELAQYD 205
           ++ +  SR+TA+EDE+RR++   Y+
Sbjct: 171 QRAISASRLTAEEDERRRKQDEDYE 195

 Score =  156 bits (395), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 82/87 (94%)

Query: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514
           RTGNQS++DKY+ LN LLATGTG+DTFGN GEARIPAQHTKTGTFINSQGTGY+QV+ +P
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 515 KNNPFLSNQYTGLPSTNIVPTQTGYGF 541
            +NPFL++QYTGLPST++VPTQTGYGF
Sbjct: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  264 bits (674), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 131/215 (60%), Positives = 164/215 (76%), Gaps = 16/215 (7%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M K  +R AKN+V GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           I+RVKA+EL +LL DDERLREERS+ T+NR         PRR       R ++ S  ++L
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNR--------KPRR-------RPTAGSEDEDL 165

Query: 181 EKVLEESRITA-QEDEQRRRELAQYDDEDPDFQAA 214
           ++ +EESR+TA QE+ +RRR+L  YD+   D Q A
Sbjct: 166 QRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTA 200

 Score =  156 bits (395), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 82/89 (92%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSI++K+++LN LLA+GTGLDTFGNTG+ RIPAQHTKTG FINSQGTGYKQV+S 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542
           PK+NPFL  QYTGLPSTN+VP+ TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  261 bits (666), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 125/205 (60%), Positives = 159/205 (77%), Gaps = 10/205 (4%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQ VRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           I+RVKAKEL SLL+D+ERL EER+MN + R                    + S    D+L
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGR----------RRRRTNRSSEDDDDL 170

Query: 181 EKVLEESRITAQEDEQRRRELAQYD 205
           ++ ++ SR+TA EDE+RR++   Y+
Sbjct: 171 QRAIDASRMTADEDERRRKQDEDYE 195

 Score =  165 bits (417), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 87/93 (93%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQS++DKY+ LN LL TGTG+DTFGN G+ R+PAQHTKTGTFINSQGTGY+QV+++
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQ 546
           PK+NPFL++QYTGLPSTN+VP QTGYGFGNQPQ
Sbjct: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQ 444

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  259 bits (661), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (81%), Gaps = 9/187 (4%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN+VKGYS T+VLVRDATAN+S  PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDELEKVL 184
           KAKEL SLL D+ERL+EER+MN R RG       GP+R+  GS  R++     ++L++ +
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRG-------GPKRRSGGSRERNNRSD--EDLQRAI 171

Query: 185 EESRITA 191
           EES+ TA
Sbjct: 172 EESKRTA 178

 Score =  157 bits (397), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TR+GNQ+ISDKY+ LN LLA+GTG+DTFGNTGE RIPAQHT+TGTFINSQGTGY+QV ++
Sbjct: 338 TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNND 397

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544
            K NPFL+ QYTGLPSTNIVPTQTG+GFGNQ
Sbjct: 398 DKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  252 bits (643), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 151/191 (79%), Gaps = 13/191 (6%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MPKQFVRSAKN+VKGYSSTQV+VR+AT+NDS  P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKEL SLLND+ERLR+ER MN              R  R         PS  DEL
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNR-------------RGGRRERARPRRRPSDDDEL 167

Query: 181 EKVLEESRITA 191
           ++ +EES+ TA
Sbjct: 168 QRAIEESKRTA 178

 Score =  165 bits (418), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 86/90 (95%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQ I+DK+ +LN LLA+GTG+DTFGNTGEARIPAQHTKTGTFINSQGTGY+QVT++
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543
           PKNNPFL++QYTGLPSTNIVP+ TGYGFGN
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  254 bits (648), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 170/244 (69%), Gaps = 32/244 (13%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M +QFVRSAKN++KGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMNTRNRGANKA------------------------ 155
           QI+RVKA++LV LL   E+L   ++   R RGA++                         
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKA--KRARGASRRDRGRRRGGDRGGGEYRQRGDDPED 178

Query: 156 ---PRP--GPRRQRTGSNPRDSSPSYQDELEKVLEESRITAQEDEQRRRELAQYDDEDPD 210
              PRP  GP  QR G     +  +  D+L++ +EES+ T QEDE+RRR+L+ YD+EDP+
Sbjct: 179 EYYPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPE 238

Query: 211 FQAA 214
           FQAA
Sbjct: 239 FQAA 242

 Score =  139 bits (351), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/92 (72%), Positives = 78/92 (84%), Gaps = 3/92 (3%)

Query: 456 TGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE-- 513
           TGNQ +++KY++LN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQV SE  
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 514 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544
            P +NPFL++QYTGLPST IVP  TGYGFGNQ
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQ 587

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  248 bits (632), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 165/214 (77%), Gaps = 12/214 (5%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M K  +R+AKN+V GYSS QVLVR+AT+N+   P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           IIRVKAKEL SLL D+ERL EER+M  + RG  +     P R R G         Y D+L
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRR----PERSRGGE-------EYDDDL 169

Query: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAA 214
           ++ LEESR+TA+E+E+RRR  +  +D+D DFQ A
Sbjct: 170 QRALEESRLTAEEEERRRRTDSGSNDDD-DFQTA 202

 Score =  158 bits (399), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 1/91 (1%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTS- 512
           TRTGNQSIS KYNDLN LLA+GTGLDTFGNTG+ RIPAQHT+TG FINSQGTGYKQVT+ 
Sbjct: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433

Query: 513 EPKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543
           +PKNNPFL+ QYTGLPST++VP+ TGYGFGN
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  241 bits (616), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 144/272 (52%), Positives = 173/272 (63%), Gaps = 37/272 (13%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  QFVRS KN+VKGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES--GFDE 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E+  G D+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQD 178
           GQIIRVKAKEL +LL DDERLREER +N R               R GS+         +
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNR----RPPARNGSD---------E 167

Query: 179 ELEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXX 238
           +L++ LEESR TA+EDE++RR     + +D D QAA                        
Sbjct: 168 DLQRALEESRRTAEEDERKRR----LNQDDSDLQAA------------------LQLSKE 205

Query: 239 XXXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                                 YYD+FGNPIS
Sbjct: 206 EEELKRLQELQSSMHMQQQQPVYYDVFGNPIS 237

 Score =  154 bits (388), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%)

Query: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514
           RTGN+ +++KYN+LN LLA+GTG+DTFGNTGE RIPAQHT+TGTFINSQGTGY+Q + E 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 515 KNNPFLSNQYTGLPSTNIVPTQTGYGFG 542
           K NPFLSNQYTGLPS+NI+PTQTGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  237 bits (605), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/271 (48%), Positives = 163/271 (60%), Gaps = 26/271 (9%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M K F+RSAKN+V GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDE 179
           +I+RVKAKEL +LL D+ERL+EER M  + R                   R       D+
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGG------------RKNRRDDNEDDDD 168

Query: 180 LEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L++ LEESRITA+E+E+RR++L    D D   QAA                         
Sbjct: 169 LQRALEESRITAEEEERRRKQLMMQGD-DSSLQAA------------LELSKEEEELRRL 215

Query: 240 XXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                                YYDIFGNPIS
Sbjct: 216 QQLQAQQQAALWQQQQQQQPMYYDIFGNPIS 246

 Score =  154 bits (388), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 70/91 (76%), Positives = 85/91 (93%), Gaps = 1/91 (1%)

Query: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE- 513
           RTGNQSISDK+++LN LLA+GTG+DTFGNTGE R+PAQHTKTGTFINSQGTGYKQ+T++ 
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544
           PK+NPFL++QYTG+PS+ I P+ TGYGFGNQ
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFGNQ 450

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  236 bits (602), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 170/271 (62%), Gaps = 21/271 (7%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M K  +R AKN+V GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180
           I+RVKA+EL +LL D+ERLREER +               + +      R +S SY D++
Sbjct: 121 IVRVKARELTALLQDEERLREEREL---------------KGRNRRPRRRKNSDSYDDDM 165

Query: 181 EKVLEESRITA-QEDEQRRRELAQYDDEDPDFQAAXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ++ LEESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 166 QRALEESRMTAEQEEAERRRKLEMYDNSADDLQTA-----LQLSKEEEELRRLRELQMQQ 220

Query: 240 XXXXXXXXXXXXXXXXXXXXAYYDIFGNPIS 270
                                YYD+FGNPIS
Sbjct: 221 QMQQAQQQMFGLQQQQTQQPMYYDVFGNPIS 251

 Score =  157 bits (396), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 2/93 (2%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQS++DK++DLN LLA+GTGLDTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV++ 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 514 P--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544
           P  K+NPFL  QYTGLPST++VP+ TGYGFGNQ
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  230 bits (586), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/215 (55%), Positives = 155/215 (72%), Gaps = 13/215 (6%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQ +RSAKN++ GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDE 179
           Q+IRVKAKEL++LL DDERL+EER  N R     K P+  P     G +P         +
Sbjct: 121 QLIRVKAKELIALLRDDERLKEER--NLRLGRGKKNPQNVPETNPDGVDP---------D 169

Query: 180 LEKVLEESRITAQEDEQRRRELAQYDDEDPDFQAA 214
           L++ LEESRITA+E E+RRR+LA+  ++  + QAA
Sbjct: 170 LKRALEESRITAEE-EERRRKLAEKTEDAEELQAA 203

 Score =  156 bits (394), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 1/91 (1%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSISDKY +LN LLATGTG+DTFGNTG+ARI +QHTKT TFINS GTG+KQV++E
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 514 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543
            PK+NPFL+ QYTGLPSTNIVP+ TGYGFGN
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  226 bits (575), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 123/141 (87%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN+VKGYSSTQ LVRDAT+N    P ID L +LA+ +Y++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WC+EN Y+IKTLREF +E+ESG D+GQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELVSLLNDDERLREERSM 145
           +AKEL SLL D+ERLREER++
Sbjct: 121 RAKELTSLLMDEERLREERAL 141

 Score =  154 bits (390), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/94 (78%), Positives = 83/94 (88%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTG+QSISDKY+ LN LLATGTG+DTFGNTG  RIPAQHTKTGTFINSQGTGYKQV++ 
Sbjct: 314 TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTN 373

Query: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQN 547
             NN FL++QYTGLPS+NIVP+QTGYGFGN   N
Sbjct: 374 GFNNVFLNSQYTGLPSSNIVPSQTGYGFGNSTVN 407

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  219 bits (558), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 114/209 (54%), Positives = 147/209 (70%), Gaps = 5/209 (2%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAP-RPGPRRQRTGSNPRDSSPSYQDE 179
           +IRVKA EL+ LL D ERL  ER MN R R     P R GP R+   S PR   P  +++
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRR--PSMPR--RPEDEED 176

Query: 180 LEKVLEESRITAQEDEQRRRELAQYDDED 208
           +++ LEES+ TA+EDE RRR+  + + +D
Sbjct: 177 VDRALEESKKTAEEDEARRRKDQEREKQD 205

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/79 (69%), Positives = 59/79 (74%)

Query: 455 RTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSEP 514
            TGN  IS KY++LN LLA GTG+DTFGN G  RIPAQHTKTGTFINSQGTGYKQVTS  
Sbjct: 595 HTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSS 654

Query: 515 KNNPFLSNQYTGLPSTNIV 533
              P L  QYTGLP+   V
Sbjct: 655 SPIPLLPTQYTGLPAQTAV 673

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  189 bits (480), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 141/196 (71%), Gaps = 20/196 (10%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQ +RSAKN+V GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSM----NTRNRGANKAPRPGPRRQRTGSNPRDSSPS 175
           QIIRVKA+ELV+LL D+ERLREER+M    N RNR A+  P P            D  P 
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQAS-VPPPA----------EDLDP- 168

Query: 176 YQDELEKVLEESRITA 191
              +L++ LEESRITA
Sbjct: 169 ---DLQRALEESRITA 181

 Score =  159 bits (401), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 85/91 (93%), Gaps = 1/91 (1%)

Query: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513
           TRTGNQSI+DKY++LN LLA+GTGLDTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV +E
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 514 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543
            PK+NPF++ QYTGLPSTN+VP+ TGYGFGN
Sbjct: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score =  100 bits (250), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+NMV  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G  
Sbjct: 76  FTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +A ELV LL+DD ++R ER
Sbjct: 136 VRNRAHELVLLLDDDGKIRTER 157

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   PKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
            K++ R A+N+V  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + K LV LL+DD ++R ER
Sbjct: 135 NVRTRVKALVELLSDDSKIRAER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G  
Sbjct: 76  FTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +A EL  LL+DD ++R ER
Sbjct: 136 VRNRAHELALLLDDDAKVRAER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 97.8 bits (242), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  + +EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +AK LV LL DD  +R+ER
Sbjct: 136 VRNRAKLLVELLQDDSNIRQER 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 97.1 bits (240), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ ++  +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + K+L +L+YL++ GSE  +   R N  +IK L  F + +  G D+G  
Sbjct: 76  FTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +A+ELV LLN+D+++R ER
Sbjct: 136 VRNRAQELVKLLNNDDQIRAER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + K+L +L+YLV+ GSE  +   R N  ++K L  F + +  G D+G  
Sbjct: 76  FTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +A +LV LL  DE++R+ER
Sbjct: 136 VRNRASQLVKLLESDEQIRQER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R + K L+ LL+DD ++R ER
Sbjct: 136 VRTRVKTLIELLSDDNKIRAER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
           L +K    WR + K+L +LDYL+R  SE  +   R +  +IK L  F + +  G D+G  
Sbjct: 76  LTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +AK L  LL+DDE +R ER
Sbjct: 136 VRNRAKALAELLSDDETIRAER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R + K L+ LL+DD ++R ER
Sbjct: 136 VRTRVKALIELLSDDNKIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R + K L+ LL+DD ++R ER
Sbjct: 136 VRTRVKALIDLLSDDNKIRAER 157

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 84/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  ++  +  VR+AT N+    S   ++ +AQ +Y+  +  E+M ML +R
Sbjct: 16  KKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +LDYL+R GSE  +   R    +++ L  F + +  G D+G  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGVN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +AK++V LL DD  +R+ R
Sbjct: 136 VRNRAKQIVELLQDDAAVRDAR 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 91/169 (53%), Gaps = 3/169 (1%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +LDYL++ GSE  +   R +  V+K L+ F + +  G D+G  
Sbjct: 76  FTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPR 170
           +R +   L+ LL DD  +R+ER          K    G      G+NPR
Sbjct: 136 VRNRVTTLIELLRDDNSIRQERKKARETAKKYKGVAGG--SAAMGANPR 182

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 94.0 bits (232), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N++  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + K+L +L+YL++ GSE  +   R +  +IK L  F + +  G D+G  
Sbjct: 76  FTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R KA+ L +LL DDE++R ER
Sbjct: 136 VRNKAQSLTALLKDDEQIRAER 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 117/232 (50%), Gaps = 23/232 (9%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + KSL +LDYL+R GSE  +   R +  +I+ L  F + +  G D+G  
Sbjct: 76  FTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDS-----SPSY 176
           +R +AK L  LL+DD ++R+ER          K    G    R G +   S     S  +
Sbjct: 136 VRNRAKALGELLSDDTKIRQERKKARETAKKYKGLAGGSANPRAGFSASTSHGISVSADF 195

Query: 177 QDELEKVLEES--------RITAQED---------EQRRRELAQYDDEDPDF 211
             + E+V            + T++E+         E  ++E+A+ DDED +F
Sbjct: 196 DSDEEEVTRHEGSGFHDNVQSTSEENGQCNDLLFTEADQQEVAEQDDEDDEF 247

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N++  Y+  +  VR+AT N+    S   +  +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + KS+ +L+YLV+ GSE  +   R N  +I+ L  F + +  G D+G  
Sbjct: 76  FLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREE----RSMNTRNRG 151
           +R + K LV LL DDE +R E    RSM  + +G
Sbjct: 136 VRNRTKALVKLLEDDELIRAERKKARSMQEKYKG 169

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +L+YL+  G+E  +   R +  +I+ L  F + +  G D+G  
Sbjct: 76  FTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGAN 135

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +A+ + SLL+ D+ +R  R
Sbjct: 136 VRSRAQAMTSLLSSDDAIRSAR 157

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 84/148 (56%), Gaps = 1/148 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+S       +  +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + KS+ +L+YL+  GSE  +   R    +IK L  F + +  G D+G  
Sbjct: 76  FVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREERSMNTRN 149
           +R + + LV LLN+DE++R ER    RN
Sbjct: 136 VRNRTQALVQLLNNDEQIRIERKKARRN 163

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 51  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFRR 110

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G  
Sbjct: 111 FTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGIN 170

Query: 122 IRVKAKELVSLLNDDERLREER 143
           +R +AK L  LL DD ++R ER
Sbjct: 171 VRTRAKALTELLGDDNKIRAER 192

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 90/170 (52%), Gaps = 2/170 (1%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N++  Y+  +  VR+AT N+    S   +  +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K    WR + KSL + DYL++ GSE  +   R +  +IK L  F + +  G D+G  
Sbjct: 76  YTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELVSLLNDDERLREER-SMNTRNRGANKAPRPGPRRQRTGSNPR 170
           +R KA+ LV+ L DD+ +R ER      ++  N         +  G NPR
Sbjct: 136 VRNKAQSLVAFLKDDDLIRAERKKARETSKKFNNVAGGSAAAETLGQNPR 185

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 88/165 (53%), Gaps = 1/165 (0%)

Query: 3   KQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFRR 75

Query: 63  LNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
             +K G  WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G  
Sbjct: 76  FTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGVN 135

Query: 122 IRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTG 166
           +R +A  L +LL DD  +R ER      +   K    G     TG
Sbjct: 136 VRNRAAALTALLADDSSIRAERKKARETKKKYKGVAGGVTSMNTG 180

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 87/160 (54%), Gaps = 12/160 (7%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+RS +NM  G S+T+V V+ AT +D  + +   L ++++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGF 116
           +  G Y +       H+ K+LT++ YL+  GS + V W R+  Y++ TLREF    +   
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DEGQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAP 156
              + +R+ + +L  LL DD  L+E R   T+ R +   P
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQERRRELTQFRSSISTP 158

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 83/158 (52%), Gaps = 8/158 (5%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
            +++ +N+  G SST+V  R+AT +D    +  +L ++L+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  N-----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDE 118
           +        K   H+ K+LT++ YL+  GS+  V+W R   Y+I TL+EF   + +    
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAP 156
              IR  A  L ++L D+E LR+ RS  T  R +   P
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRRSDVTLFRSSISTP 158

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 87/162 (53%), Gaps = 10/162 (6%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDAT-ANDSRTPSIDTLDDLAQRSYDSVDFFEIMDML 59
           MP   + S + +V+  S+T++ V+ AT  N+S   +   +++++  +Y      EI+ ++
Sbjct: 1   MP--LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVV 56

Query: 60  DKRLNDKG-----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES 114
            KRL   G     K   H+ K+LT++ YL+  GS + + W R N  ++  L+EF  ++ +
Sbjct: 57  RKRLMGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRN 116

Query: 115 GFDEGQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAP 156
               GQ IR  +++L +L+ DD+ L   R+   + R +  +P
Sbjct: 117 DEKIGQQIRAMSQDLCTLIKDDDLLENRRAEVIQFRSSISSP 158

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 8/142 (5%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V++AT ++  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
            K        H+ K++T++ YL+  GS + + W R N  + + L++F   +E      + 
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQ 123

Query: 122 IRVKAKELVSLLNDDERLREER 143
           IR  A +L  L+NDDE L   R
Sbjct: 124 IRYIAGDLCILINDDELLEARR 145

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 80/155 (51%), Gaps = 3/155 (1%)

Query: 2   PKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
            K+F R A+N +   +  +  VR+AT ND    S+  +  +   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KS+ +L YL+  GS   V   + N  +IK L  F   ++ G+++  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IIRVKAKELVSLLNDDERLRE--ERSMNTRNRGAN 153
            I    + L+ L+ DD  L +  E+S N++++  N
Sbjct: 135 KISKATERLIELMTDDHLLNDLREKSKNSKHKIFN 169

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 95/204 (46%), Gaps = 20/204 (9%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN-- 64
           S +N V+  S T+  VR AT +D  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
              +  K   H+ K+LT++ YL+  GS + + W R N  + + L+ F  +N      GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 IRVKAKELVSLLNDDERLREERSMNTRNRGANKAP------------RPGPRRQRTGSNP 169
           I     ++ +++NDD+ L ++R    + R +   P                 R RTG + 
Sbjct: 124 IVFICNDICNIINDDDMLEQKRKDVVQFRSSISFPGRKSTDNSHIKTNSSATRGRTGFSL 183

Query: 170 RDSSPSYQDELEKVLEESRITAQE 193
           RD      ++ EK ++ +  T  E
Sbjct: 184 RDRFDERINQKEKQIDSTSETVNE 207

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 6/148 (4%)

Query: 15  GYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN-----DKGK 68
           G S T++  ++AT +D  + +  +L ++++  +Y S    EI  ++ KRL+        K
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
              H+ K+LT+  YL+  GS   V W R   Y+I +L+EF   +         IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LVSLLNDDERLREERSMNTRNRGANKAP 156
           L  +L DDE LR+ RS  T  R +   P
Sbjct: 131 LSVILRDDELLRQRRSDVTLFRSSISTP 158

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 6/150 (4%)

Query: 13  VKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKG---- 67
           V G SST++ VR AT  D +T +  TL ++++  +Y      EI  +L +RL+  G    
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 68  -KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKA 126
            K   H+ K+LT++ YL+  GSE  V W R N    + L+      +      + IR  +
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMS 128

Query: 127 KELVSLLNDDERLREERSMNTRNRGANKAP 156
            ++   + DDE L  ++      R +  +P
Sbjct: 129 NQICDCVKDDELLENKKKEIIEFRSSISSP 158

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 106/212 (50%), Gaps = 19/212 (8%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
              S +N V+  S T++ VR AT ++  + +  TL ++++  +Y +    EI+ +L KRL
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 64  NDKGKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDE 118
              GK        H+ K+LT++ YL+  GS   + W  EN  + + ++ F   +++  DE
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFE-VSDTIHDE 119

Query: 119 GQIIRVK--AKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSY 176
              I+++  ++ ++ L+N+ E L ++R+     R +  +P    R+    S+ R S+ S 
Sbjct: 120 KFAIQIRDLSERILELINNRELLEQKRNEVDEFRSSISSPG---RKSTDNSHIRKSTDSL 176

Query: 177 QDELEKVLEE--SRITAQEDEQRRRELAQYDD 206
              + K L E  +   +  DE R+  +   D+
Sbjct: 177 ---IRKSLGERSTNFRSSLDEMRKSSMGYSDN 205

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 81/153 (52%), Gaps = 17/153 (11%)

Query: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDML 59
           MP  F+ S +++  G SST V V+ AT +     +  +L +++A  +Y      EI  +L
Sbjct: 1   MP--FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVL 56

Query: 60  DKRLNDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRH-- 110
            KRL   G Y +       ++ K+LT++ +LV  GSE C+ W R +  +I++ ++F    
Sbjct: 57  KKRL--VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

Query: 111 -ENESGFDEGQIIRVKAKELVSLLNDDERLREE 142
            E +   ++ Q++  K  +L++  N  E +R+E
Sbjct: 115 GEKKQMVNQIQLLSCKLCQLLTDSNLLEDMRKE 147

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 69/134 (51%), Gaps = 7/134 (5%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L +F+ ++      G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 VSLLNDDERLREER 143
             LL DDE L  +R
Sbjct: 133 HELLQDDELLERQR 146

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 72/152 (47%), Gaps = 8/152 (5%)

Query: 13  VKGY--SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT  D    +  TL ++++  +Y      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WRH-----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
             H     + K+LT++ YL+  GS   V W R N  +I  L   + E       G  I+ 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKS 126

Query: 125 KAKELVSLLNDDERLREERSMNTRNRGANKAP 156
            A +L+ L+ DD+ L E R    + R +  +P
Sbjct: 127 IAADLMELIQDDDLLEERRKDVVQFRSSISSP 158

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 74/137 (54%), Gaps = 8/137 (5%)

Query: 15  GYSSTQVLVRDAT-ANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT +N+S   +   +++L+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKA 126
                 V K+LT+++YL+  GSE  VLW R +   I+ L+++   N+    + + I+  +
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDKDKSKVKQIKSLS 130

Query: 127 KELVSLLNDDERLREER 143
           +++   L +D+ L + R
Sbjct: 131 EDISKNLKEDDFLEKRR 147

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 66/148 (44%), Gaps = 6/148 (4%)

Query: 15  GYSSTQVLVRDATA-NDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S   + ++   +Y      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
              H+ K+LT+ +YL+  GSE+ V W +    +++ L++F   NE        IR  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 129 LVSLLNDDERLREERSMNTRNRGANKAP 156
           L+ L+ +   L + R    R R +   P
Sbjct: 131 LLELMQNPALLEDHRRSVVRFRSSISTP 158

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 75/170 (44%), Gaps = 30/170 (17%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   Q+ +R AT  DS  P+   LD +     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV-------RFGSENCVLWCRENF 99
                               G  WR V KSL VL +L+       +       L     F
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNHYGF 138

Query: 100 YVIKTLREFRHENES-GFD--EGQIIRVKAKELVSLLNDDERLREERSMN 146
           +    L  ++ +N S G D    ++I++K +E++ L+ND++ L ++   N
Sbjct: 139 FKHDILEIYQVQNSSDGKDSKHQEVIQLKCQEIIELINDEKLLLQKHDAN 188

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 31/172 (18%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ +R AT  D+  P+   L  + +  Y SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENFY--- 100
                              G  WR + K L V++YL+   SE    N V  C EN     
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIF 139

Query: 101 ---VIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDDERLREERSMNTRN 149
              ++    EF ++ +    E  I + K + +++L++D E LREERS N +N
Sbjct: 140 NSNILNYKIEFCNDGKMEVHERGIQK-KCEVIINLVDDPEFLREERSKNKKN 190

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 77/155 (49%), Gaps = 18/155 (11%)

Query: 5   FVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F  S +N+V  YS T++ VR AT  +    S  TL ++++  +Y +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN 112
                  N  G    K    V K+ T++ YL+  GS + + W + N  V++ L +    N
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 113 ESGFDEGQIIRVKA----KELVSLLNDDERLREER 143
               DE   I  +A    K+++ L+ND++ L + R
Sbjct: 121 HITDDEDLHILNQAQKITKDIILLINDNKLLEKRR 155

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 81/150 (54%), Gaps = 17/150 (11%)

Query: 8   SAKNMVKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLND- 65
           + KN V+  + T+  V+ AT ++  T +  TL ++++  +Y      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLRE---FRHENESG 115
               K   H     + K+LT++ YL+  GS   + W R NFY+++ + +   F+ ++ S 
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA 123

Query: 116 FDEGQI--IRVKAKELVSLLNDDERLREER 143
            D   I  I+V A+++ +L+N++  L + R
Sbjct: 124 -DSKMIGQIKVIAEDMTNLINNENLLEQRR 152

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 76/173 (43%), Gaps = 31/173 (17%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENFYVI 102
                               G  WR V K L V+D+L+   SE    N VL C      I
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRN 149
            T RE  +      ++G++      IR K ++++  + D   L++ERS N +N
Sbjct: 139 LT-REIPNFKVKFSNDGKMEIHERGIRKKGEDILQYMEDPHFLKKERSKNRKN 190

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 7/134 (5%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L  F  ++     + + IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 VSLLNDDERLREER 143
           + LL DD  L ++R
Sbjct: 133 LELLQDDGLLEKQR 146

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 71/134 (52%), Gaps = 12/134 (8%)

Query: 8   SAKNMVKGY--SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT ++    +  TL ++++  +Y      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEG 119
                +  +   HV K+LT++ YL+  GS + + W + + YVI+ L  F  E +S  DE 
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF--EAQSSSDEP 119

Query: 120 QI--IRVKAKELVS 131
            +  IR    ++++
Sbjct: 120 MVNQIRFLCNDIIT 133

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   + +  DF+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R GS++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGSKDVALRYYSRNLEFFDIENIR 92

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 76/187 (40%), Gaps = 31/187 (16%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT  DS  P+   L  + +  Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV----RFGSENCVLWCRENFYVI 102
                               G  WR V K L +L+YL+    R    + VL C +    I
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRNRGANKAP 156
            T    ++  +   D G++      I+ K + ++ L+ D   L+ ERS    N     A 
Sbjct: 139 LTKETMQYRVDFSSD-GKMELHERGIKKKCEHIIQLIEDTSYLKRERSKTAENTQKIVAG 197

Query: 157 RPGPRRQ 163
             G R +
Sbjct: 198 SAGSRSE 204

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   +    DF+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G ++  L  + R   F+ I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   + DS +F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            ++R G  +  +    +      LR+  H   S  D
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFHSKLSSGD 100

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 76/173 (43%), Gaps = 31/173 (17%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K LTV++YL   V  G E N V+ C +    I
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRN 149
            T RE         ++G++      IR K ++++  L D   L++ER  N +N
Sbjct: 139 LT-REIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLEDPSFLKQERLKNKKN 190

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   +    DF+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G+++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGAKDVALRYYSRNLEFFDIENIR 92

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 90/212 (42%), Gaps = 37/212 (17%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+NM+  Y   Q+ +R AT  D+  P+   L+ + +  Y  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVIK 103
                              G  WR V K L V+++L   V  G E N V  C      + 
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVADGDELNQVRSCLVTHKHLL 139

Query: 104 TLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRNRGANKAPR 157
           + RE      +  ++G++      IR K + ++ LL+D + L++ER  + +N   N   R
Sbjct: 140 S-REVAQYRVAMSNDGKMEVHERGIRKKCENILQLLDDTQYLKKERRAHAKN---NLKIR 195

Query: 158 PGPRRQRTGSNPRDSSP---SYQDELEKVLEE 186
                    +NP D+S     Y D  E V EE
Sbjct: 196 QQAESSLYNANPIDTSAMSSEYLDSDEGVEEE 227

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 74/173 (42%), Gaps = 31/173 (17%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT  DS  P+   L+ + +  Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K LTV++YL   V  G E N V  C      I
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLLLNVSDGDELNQVRSCLTTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRN 149
            + RE         ++G++      I+ K + ++ +L D + L+ ER  + +N
Sbjct: 139 LS-REVLEYRVKFSNDGKMEVHERGIKKKCEFIIQMLEDSQFLKRERQKHVKN 190

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 80/177 (45%), Gaps = 41/177 (23%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ VR AT  D+  P+   L+ + +  +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVL-----W 94
                              G  WR V K LTV++YL   V  G E     +C+L      
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCLLTHKHIL 139

Query: 95  CRE--NFYVIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDDERLREERSMNTRN 149
            RE  NF +     +F ++ +    E  I R K ++++ +L+D   L++ER  N +N
Sbjct: 140 TREVLNFKI-----KFSNDGKMEVHERSI-RKKGEKILQMLDDSRFLKQERLANKKN 190

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 72/172 (41%), Gaps = 29/172 (16%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSENCVL-WCRENFYVIKTL 105
                               G  WR V K LTV+++L+    E   L   R +    K +
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLMLNVDEGDELNQIRSSLQTHKHI 138

Query: 106 --REFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRN 149
             RE         ++G++      IR K + +V  + D   L+ ER+ N +N
Sbjct: 139 LTREVAQYRVKFSNDGKMEVHERGIRKKGETIVQFMEDPHFLKRERNKNKQN 190

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 83/195 (42%), Gaps = 37/195 (18%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  DS  P+   L  + +  Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K L VL+YL   V  GSE + V+ C      I
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRI 138

Query: 103 --KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRNRGANK 154
             + + +FR +  +   +G++      I+ K ++++  L D   L+ ER+ +++N  A K
Sbjct: 139 LSRDVMQFRVDFSA---DGKMEVHERGIKKKCEQILQYLEDPSYLKRERAKHSKN--AVK 193

Query: 155 APRPGPRRQRTGSNP 169
             R       T S P
Sbjct: 194 IHRSAAAFPSTASMP 208

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 76/178 (42%), Gaps = 41/178 (23%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT  DS  P+   L  + +  Y  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCRE- 97
                               G  WR V K L V++YL   V  G E     +C+L  +  
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLLMNVDDGDEINQVRSCLLTHKHL 138

Query: 98  ------NFYVIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDDERLREERSMNTRN 149
                 NF +     +F ++ +    E + IR K + ++  + D + L++ER  N +N
Sbjct: 139 ISKEVLNFKI-----KFSNDGKMEVHE-RGIRKKGELIMQFIEDSKFLKQERLKNKKN 190

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 76/177 (42%), Gaps = 39/177 (22%)

Query: 6   VRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  DS  P+   L  + +  Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCREN 98
                               G  WR V K L VL+YL   V  GSE     +C+L     
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLL--THK 136

Query: 99  FYVIKTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRN 149
             + + + +FR +  +   +G++      I+ K ++++  + D   L+ ER+ + +N
Sbjct: 137 HILTRDVMQFRVDFSA---DGKMEVHERGIKKKCEQMIQYIEDPAYLKRERAKHNKN 190

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +I+ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 50/120 (41%), Gaps = 20/120 (16%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   S D  DF EI+  L  R++D    W  V KSL V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  YLVRFGSENCVLWCREN---FYVIKTLREFRHENESGFDEG---------QIIRVKAKEL 129
            L+R G ++  L    N   F+ +  +      N S F  G         Q + V+AKE 
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGI------NTSKFSSGDVRALERYNQYLLVRAKEF 118

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 33/180 (18%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT  D+  P+   L  + +  Y  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVIK 103
                              G  WR V K L V+D+L   V  G E N V  C      I 
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHIL 139

Query: 104 TLR------EFRHENESGFDEGQIIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPR 157
           T +       F ++ +    E + IR K++ ++  ++D   LREER  + +N  ANK  R
Sbjct: 140 TSQVASYKIPFSNDGKMEIHE-RGIRKKSELILQYMDDPRFLREERIKSRKN--ANKIHR 196

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +++ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQ 112

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 83/194 (42%), Gaps = 37/194 (19%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT  DS  P+   L  + +  Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI- 102
                              G  WR V K L VL+YL   V  GSE + V+ C      I 
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRIL 139

Query: 103 -KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERSMNTRNRGANKA 155
            + + +FR +  +   +G++      I+ K ++++  L D   L+ ER+ +++N  A K 
Sbjct: 140 SRDVMQFRVDFSA---DGKMEVHERGIKKKCEQILQYLEDPSYLKRERAKHSKN--AVKI 194

Query: 156 PRPGPRRQRTGSNP 169
            R       T S P
Sbjct: 195 HRSAAAFPSTASMP 208

>TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa]
           {ON} Anc_5.84 YGR241C
          Length = 632

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    ++ +   + D  DF EI+  L  R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKLAPPKDKYIEPILMGTNDPHDFREIVKALHSRVNDSA--WTVVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            L+R G  +  +    N      L    H N S  D
Sbjct: 65  VLMREGDRDVAIKYFSNNLNYFGLAGIHHSNFSNGD 100

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A+  D+  P+   L  + +  Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT      P    +D +   +    DF EI+  L  R+ D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRFGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

>Kpol_1050.73 s1050
           complement(162665..164488,164492..164527,164531..164686)
           [2016 bp, 671 aa] {ON}
           complement(162665..164488,164492..164527,164531..164686)
           [2016 nt, 672 aa]
          Length = 671

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 503 QGTGYKQVTSEPKNNPFLSNQYTGLPSTN--IVPTQTGYGFGNQPQN-PAVNSP 553
           Q TG+ Q   +    P L+NQ TG  S+N  + P+ TG GFG   Q  PA  SP
Sbjct: 510 QNTGFIQ---QSATVPNLTNQQTGFFSSNTQVTPSFTGAGFGGYTQQAPATMSP 560

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 17 SSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKS 76
          +S + LV+ AT      P    +D +   + ++++F +I+  L  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>KLTH0D03784g Chr4 complement(367647..370937) [3291 bp, 1096 aa] {ON}
            some similarities with uniprot|P39935 Saccharomyces
            cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4) gamma
            mRNA cap-binding protein (eIF-4F) 150K subunit highly
            homologous to Tif4632p homologs of mammalian p220
          Length = 1096

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 14/95 (14%)

Query: 78   TVLD---YLVRFGSENCVLWCRENFYVI--KTLREFRHENESGFDEGQIIRVKAKELVSL 132
            TVLD   Y++   +E+  +  R  F ++  K LRE +H N +  DEG        + +  
Sbjct: 948  TVLDQLFYMLDKITESSEISSRIKFKLVDMKELREVKHWNSTKRDEG-------PKTIQQ 1000

Query: 133  LNDDERLREERSMNTRNRGANKAPRPGPRRQRTGS 167
            ++++E  +  ++M  R R    + R G RR  + S
Sbjct: 1001 IHEEEAAK--KAMEERERKMKGSSRSGSRRNNSNS 1033

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,438,475
Number of extensions: 1794633
Number of successful extensions: 6916
Number of sequences better than 10.0: 140
Number of HSP's gapped: 7123
Number of HSP's successfully gapped: 168
Length of query: 626
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 510
Effective length of database: 40,180,143
Effective search space: 20491872930
Effective search space used: 20491872930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)