Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.269singletonON1091095887e-80
KNAG0C055005.352ON58591710.21
KLTH0C10956g6.29ON143325623.4
ZYRO0G20966g1.307ON58547623.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.269
         (109 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.269 Chr12 (500398..500727) [330 bp, 109 aa] {ON}  (NOVEL)     231   7e-80
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    32   0.21 
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...    28   3.4  
ZYRO0G20966g Chr7 complement(1721609..1723366) [1758 bp, 585 aa]...    28   3.9  

>Skud_12.269 Chr12 (500398..500727) [330 bp, 109 aa] {ON}  (NOVEL)
          Length = 109

 Score =  231 bits (588), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MFLYSRIAERERGGAPGHCSITPNPGVNPPSCGGHQPMFESVYYMAQLLRSDNAGCEQVQ 60
           MFLYSRIAERERGGAPGHCSITPNPGVNPPSCGGHQPMFESVYYMAQLLRSDNAGCEQVQ
Sbjct: 1   MFLYSRIAERERGGAPGHCSITPNPGVNPPSCGGHQPMFESVYYMAQLLRSDNAGCEQVQ 60

Query: 61  MAGRCRYGSVHLKIDIWTDVGYLHGYNRTGTWQWPLVLIEVFAHPGIHP 109
           MAGRCRYGSVHLKIDIWTDVGYLHGYNRTGTWQWPLVLIEVFAHPGIHP
Sbjct: 61  MAGRCRYGSVHLKIDIWTDVGYLHGYNRTGTWQWPLVLIEVFAHPGIHP 109

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 32.0 bits (71), Expect = 0.21,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 12/91 (13%)

Query: 11  ERGGAPGHCSITPNPGVNPPSCGGHQPMFESVYYMAQLLRSDNAGCEQVQMAGRCRYGSV 70
           ER G P     TP P V  P+        ++VY  A+ ++  NA  EQ + A    Y  V
Sbjct: 437 ERKGTP-----TPTPQVVTPARTPDPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVV 491

Query: 71  HLKIDIWT-----DVGYLHGY-NRTGTW-QW 94
             K++ W      D+ YL  +     TW +W
Sbjct: 492 ETKVNNWKGDKEGDIRYLLSHLTEIVTWVEW 522

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar
           to uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3
           DNA binding protein involved in transcriptional
           regulation
          Length = 1433

 Score = 28.5 bits (62), Expect = 3.4,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 13  GGAPGHCSITPNPGVNPPSCGGHQP 37
           G   GH S+ P+  V+PP   GH+P
Sbjct: 250 GIVEGHPSLMPSDDVSPPKLVGHEP 274

>ZYRO0G20966g Chr7 complement(1721609..1723366) [1758 bp, 585 aa]
           {ON} similar to uniprot|P38352 Saccharomyces cerevisiae
           YBR280C Hypothetical ORF
          Length = 585

 Score = 28.5 bits (62), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 14  GAPGHCSITPNPGVNPPSCGGHQPMFESVYYMAQLLRSDNAGCEQVQ 60
           G  G  + T   G++PPS G HQ ++E +  M         G E ++
Sbjct: 236 GTGGQINTTGAIGISPPSLGPHQNLYEPLEEMEAKTTETVPGNEHIR 282

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.141    0.486 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,955,544
Number of extensions: 418400
Number of successful extensions: 517
Number of sequences better than 10.0: 7
Number of HSP's gapped: 517
Number of HSP's successfully gapped: 7
Length of query: 109
Length of database: 53,481,399
Length adjustment: 79
Effective length of query: 30
Effective length of database: 44,422,785
Effective search space: 1332683550
Effective search space used: 1332683550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)