Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2687.344ON31831816980.0
YLR205C (HMX1)7.344ON31731815430.0
Smik_12.2637.344ON31831815190.0
Suva_10.2997.344ON32032015130.0
TDEL0C020307.344ON3113099761e-132
KLLA0D12474g7.344ON3123019711e-131
ZYRO0F11594g7.344ON3093069491e-128
SAKL0F11242g7.344ON3093119371e-126
Kwal_56.246247.344ON3073069051e-122
KLTH0H01386g7.344ON3073029021e-121
NCAS0E028907.344ON3153118391e-111
Ecym_47297.344ON3262718311e-110
NDAI0E045007.344ON3273327831e-103
Kpol_530.367.344ON3113127235e-94
TPHA0F029207.344ON3202807044e-91
CAGL0A03905g7.344ON2822516936e-90
ACL154W7.344ON3192746706e-86
KAFR0L014707.344ON3003136192e-78
KNAG0B026407.344ON3023105652e-70
KLLA0D19492g2.20ON49680770.38
TDEL0D012101.256ON77268721.7
NCAS0B036308.331ON2447136722.2
Smik_16.1798.517ON151154712.5
YPL058C (PDR12)8.517ON151154712.5
Skud_16.2258.517ON151154712.5
NCAS0G013702.16ON48763693.6
YLR442C (SIR3)4.327ON978123693.7
Suva_6.518.67ON76349694.5
NCAS0A069205.184ON51844684.9
NDAI0E016208.609ON48775676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.268
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   658   0.0  
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   598   0.0  
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   589   0.0  
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   587   0.0  
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   380   e-132
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   378   e-131
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   370   e-128
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   365   e-126
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   353   e-122
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   352   e-121
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   327   e-111
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   324   e-110
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   306   e-103
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   283   5e-94
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   275   4e-91
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   271   6e-90
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   262   6e-86
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   243   2e-78
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   222   2e-70
KLLA0D19492g Chr4 (1643703..1645193) [1491 bp, 496 aa] {ON} simi...    34   0.38 
TDEL0D01210 Chr4 complement(225620..227938) [2319 bp, 772 aa] {O...    32   1.7  
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    32   2.2  
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    32   2.5  
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    32   2.5  
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    32   2.5  
NCAS0G01370 Chr7 complement(244659..246122) [1464 bp, 487 aa] {O...    31   3.6  
YLR442C Chr12 complement(1019315..1022251) [2937 bp, 978 aa] {ON...    31   3.7  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    31   4.5  
NCAS0A06920 Chr1 (1373157..1374713) [1557 bp, 518 aa] {ON} Anc_5...    31   4.9  
NDAI0E01620 Chr5 (322737..324200) [1464 bp, 487 aa] {ON} Anc_8.6...    30   6.5  

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60
           MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120
           VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL
Sbjct: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120

Query: 121 NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300
           GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI
Sbjct: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300

Query: 301 IAVWVIYLLVKKNFLSIV 318
           IAVWVIYLLVKKNFLSIV
Sbjct: 301 IAVWVIYLLVKKNFLSIV 318

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/318 (90%), Positives = 306/318 (96%), Gaps = 1/318 (0%)

Query: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60
           MEDS+NTIIPSPTDVGALANRINF TRDAHNKINTFMGI+MAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120
           VFDAIEQEIDRLL+DPVTE+ELQTSTILKQFWLEDFRRSTQIYKDLKLLYSN FKSTESL
Sbjct: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLA F+KPPLLQQF+N+IHENI KEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           PNFE+LSQKELVKKGTNFFTFSDLGPTEETRLK EYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300
            GIFDWNF+IVAEIGELNRRELMGKFSFKC+TY+YEEWM +KDSA R+A +T MLL+LSI
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300

Query: 301 IAVWVIYLLVKKNFLSIV 318
           IA+WV+Y LV K+FLSIV
Sbjct: 301 IAIWVLYFLV-KSFLSIV 317

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/318 (91%), Positives = 306/318 (96%)

Query: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60
           MEDS N IIPSPTD+GALANRINFHTRDAHNKINTFMGI+MAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120
           VFDAIEQEIDRLL+DPVT KELQTS ILKQFWLEDFRRSTQIYKDLKLLYSN FKSTESL
Sbjct: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLA FEKPP+LQQFVN+IHENI+KEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           PNFE+LSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300
            GIFDWNF+IVAEIGELNRRELMGKFSFKCVTYVYEEWM +K+SA RK+FNT +LL+LSI
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI 300

Query: 301 IAVWVIYLLVKKNFLSIV 318
           IA+W +Y LVKK+FLSIV
Sbjct: 301 IAIWTLYFLVKKSFLSIV 318

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/320 (88%), Positives = 301/320 (94%), Gaps = 2/320 (0%)

Query: 1   MEDSTNT--IIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAY 58
           MEDST+T  IIPSPTD+GALANRINFHTRDAHNKINTFMGI+MAIAMRHGFIYRQGILAY
Sbjct: 1   MEDSTSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY 60

Query: 59  YYVFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTE 118
           YYVFDAIEQEIDRLL+D V+EKELQ   ILKQFWLEDFRRSTQIYKDLKLLYSN FKSTE
Sbjct: 61  YYVFDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 120

Query: 119 SLNEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 178
           SLNEFLA FEKPPLLQQFV+DIH+NIR+EPCTILSYCHVLYLALFAGGKLIRSNLYRRLG
Sbjct: 121 SLNEFLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 180

Query: 179 LFPNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIIS 238
           LFPNFE+L+QKELVKKGTNFFTFS+LGPTEETRLK EYKKNYELATRTELTEAQKL+IIS
Sbjct: 181 LFPNFEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIIS 240

Query: 239 VAGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLML 298
           VA GIFDWNF+IVAEIGELNRRELM KFSFKCVTYVYEEWM  K SA RKAF+T MLLML
Sbjct: 241 VAEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLML 300

Query: 299 SIIAVWVIYLLVKKNFLSIV 318
           SI AVW++Y  V++NFLS+V
Sbjct: 301 SITAVWILYYFVRQNFLSVV 320

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 234/309 (75%), Gaps = 2/309 (0%)

Query: 4   STNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFD 63
           S    IP+PTDVGALANRINFHTRDAHNK+N +M +R+A A++HGFIYRQGILA+Y++FD
Sbjct: 3   SVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFD 62

Query: 64  AIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEF 123
           A+EQE+DRLL+DP  ++E Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F
Sbjct: 63  AVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNF 122

Query: 124 LAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF 183
           +      P LQ FV+ IH  ++++ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F
Sbjct: 123 VEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKF 182

Query: 184 ERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGI 243
           E L+ KELV +GTNFFTFSD G   E +L+ +YK+ YELATR EL+E+QK +I+ V+  I
Sbjct: 183 EYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQI 242

Query: 244 FDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSIIAV 303
           FDWN  ++ EIGE+NR ELM KFSFK +TY+ EEW     +   K    ++++M  +I  
Sbjct: 243 FDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEW--KYSTILSKRSKDSIIVMAILIQF 300

Query: 304 WVIYLLVKK 312
            V Y++++K
Sbjct: 301 LVAYIVLRK 309

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  378 bits (971), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 234/301 (77%), Gaps = 1/301 (0%)

Query: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66
           T IPSPTDVGALANRINF TRD HNKIN +M ++MA AMRHGFIYRQGI+AYYYVF AIE
Sbjct: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66

Query: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126
           QEIDRLL  PVT ++ +   IL+QFW E+FRRS ++  DL++LY++ +  +E L EFL  
Sbjct: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126

Query: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERL 186
           F+ P  LQ+FV++IH N++KEP TIL+YCHVLYLALFAGG++++SNLYR +GLFP F  L
Sbjct: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHL 186

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246
           S KELV++ TNFFTFS+ G  +E RL+ +YKK YELATRTELTEA+KL+II V+  IF  
Sbjct: 187 SPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQR 246

Query: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEW-MSDKDSAFRKAFNTAMLLMLSIIAVWV 305
           N  +VAEIGE+NR ELMGKFS+K ++++ EEW  S+K +   K      L++ +++ V+ 
Sbjct: 247 NMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYT 306

Query: 306 I 306
           I
Sbjct: 307 I 307

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  370 bits (949), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 233/306 (76%), Gaps = 5/306 (1%)

Query: 9   IPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IP+PTDVGALANRINFHTRDAHNKIN +M +R+A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63

Query: 69  IDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFE 128
           +DR++     EKE+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL    
Sbjct: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123

Query: 129 K-PPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLS 187
              P LQ FV+ IH+N+++EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ LS
Sbjct: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183

Query: 188 QKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWN 247
            +ELV++GTNFFTFS+ G   E +L+  YK+ YELATR ELTE QK +IISV+  IF WN
Sbjct: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243

Query: 248 FHIVAEIGELNRRELMGKFSFKCVTYVYEEW-MSDKDSAFRKAFNTAMLLMLSIIAVWVI 306
              +AEIGELNR+ELMG  SF+ +TY++EEW  +DK S  +K      +L++  +   ++
Sbjct: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFL---IV 300

Query: 307 YLLVKK 312
           YL++++
Sbjct: 301 YLVLRR 306

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  365 bits (937), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 177/311 (56%), Positives = 230/311 (73%), Gaps = 4/311 (1%)

Query: 5   TNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDA 64
           + T IPSPTDVGALANRINFHTRD+HNKIN  M +++A AM+HG IYRQGILA+YY+F A
Sbjct: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61

Query: 65  IEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFL 124
           +EQEID LL +  T  ELQT  IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL
Sbjct: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121

Query: 125 AKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184
                PP  Q FV  IH+ +R++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+
Sbjct: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181

Query: 185 RLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIF 244
            L+ +++V++GTNFFTFS+ G   E +L+ EYKK YELATR ELTE QK +II V+  IF
Sbjct: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241

Query: 245 DWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW-MSDKDSAFRKAFNTAMLLMLSIIAV 303
           DWN  ++ E+GE+NR ELMGKFSFK V+++ EEW  S+K S   K     +L++ +I+  
Sbjct: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLS---KENKITILVIFAILQF 298

Query: 304 WVIYLLVKKNF 314
            + Y L++K F
Sbjct: 299 LLAYWLLRKLF 309

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  353 bits (905), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/306 (54%), Positives = 225/306 (73%), Gaps = 2/306 (0%)

Query: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66
           + IPSPTDVGALANRINF+TRD HNKI+  M ++ A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 2   STIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIE 61

Query: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126
           QEIDRLL +  T +E+QT  IL QFW+  F R+ +IY+DLKLLY+  F S E L+ FL +
Sbjct: 62  QEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQ 121

Query: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERL 186
              PP  Q FV+ +HE++R  P +IL++CHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 122 NTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDL 181

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246
           + +E+V+KGTNFFTFSD G   E +L+ EYK+ YELATR  LTE QKL I+ VA   F+W
Sbjct: 182 TPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEW 241

Query: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSIIAVWVI 306
           N  +++EIGE+NR+ELMGK SFK V++  +EW   +    R+   + +L   ++I + V+
Sbjct: 242 NTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQ--KSIVLATGAVIQILVM 299

Query: 307 YLLVKK 312
           Y +++K
Sbjct: 300 YWMLRK 305

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 221/302 (73%), Gaps = 2/302 (0%)

Query: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66
           T IPSPTDVGALANRINFHTRD HNKI+  M  + A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61

Query: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126
           QE+DRL  +  T +E QT  IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL +
Sbjct: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121

Query: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERL 186
               P LQ FV+ +H +IR  P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246
           + +E+V++GTNFFTFSD G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+W
Sbjct: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241

Query: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEWM-SDKDSAFRKAFNTAMLLMLSIIAV-W 304
           N  +V EIGE+NR+ELMGK SF+ +T+V EEW  SDK +  +K+   A  ++L I+ + W
Sbjct: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301

Query: 305 VI 306
           V+
Sbjct: 302 VL 303

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  327 bits (839), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 214/311 (68%), Gaps = 2/311 (0%)

Query: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60
           M   TNTIIPSPTD  ALANRINF TRDAHNKIN  M I++AIA+RHGFIYRQGIL YYY
Sbjct: 1   MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYY 60

Query: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120
           +F  +E+EI +L   P T +E++   +L + W+ +F R+  + KDL+LLY + + + E+L
Sbjct: 61  IFKVVEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEAL 120

Query: 121 NEFLA--KFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 178
             FL     E PP+L  F+  IH++I + PC+I +YCHVLYLALFAGGK+IRS +Y+ LG
Sbjct: 121 QLFLETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLG 180

Query: 179 LFPNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIIS 238
             PNF  LS KE+ +KGTNFF F   G  EET+LKLE+KKNYEL TR  L E +K  II 
Sbjct: 181 FLPNFNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIE 240

Query: 239 VAGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLML 298
            +  IFD+N   + E+G +N+ +LM K +FK VTY+ EEW  + +   ++  +  M++M+
Sbjct: 241 TSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMV 300

Query: 299 SIIAVWVIYLL 309
            +  ++  ++L
Sbjct: 301 LLHMLFAFFIL 311

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  324 bits (831), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/271 (57%), Positives = 200/271 (73%)

Query: 8   IIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQ 67
           +IPSPTDVGALANRINF TRD H K + F+  +MA+AMRHGFIYRQGILA+YY+F A+EQ
Sbjct: 21  MIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQ 80

Query: 68  EIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKF 127
           +IDRLL  P T++ELQ S IL+QFW E+FRRS ++ +DL+  Y + + +   L +FL  F
Sbjct: 81  QIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDF 140

Query: 128 EKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLS 187
           E PP LQ+FV+ I +   + P TIL+YCHVLY ALFAGGK++RSN+YR +GLFP  + +S
Sbjct: 141 ELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGIS 200

Query: 188 QKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWN 247
             E  + GTNFFTFSD G  EE +L+ +YKKNYELATR  L E QKL+II V+   F   
Sbjct: 201 AAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAV 260

Query: 248 FHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278
             I+ EIGE N++ELM  FSFK +T++  EW
Sbjct: 261 MDILGEIGETNKKELMNIFSFKLLTFLSNEW 291

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  306 bits (783), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 218/332 (65%), Gaps = 26/332 (7%)

Query: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60
           M  ST TIIPSPTD  ALANRINFHTRDAHNKI+  M +++A+A+RHG IYRQGIL YYY
Sbjct: 1   MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYY 60

Query: 61  VFDAIEQEIDRLL--HDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTE 118
           +F A+E EI+ LL  +   T+++ +T ++L + WL +F R+ +++KDLKLLYS+ F++ +
Sbjct: 61  IFQAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQ 120

Query: 119 SLNEF------LAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSN 172
            L  F      L    K   L QFVN IH +I+  PC IL+YCHVLYLALFAGGK+I+S 
Sbjct: 121 DLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSK 180

Query: 173 LYRRLGLFPNFERLSQKELVKKGTNFFTFSDLGP--------TEETRLKLEYKKNYELAT 224
           +Y+ LG  PNF  LS KEL    TNFF F++           + E +LKL++K+N+EL T
Sbjct: 181 IYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNT 240

Query: 225 RTELTEAQKLQIISVAGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDS 284
           R+ L E +KL II +A  IF WN   + E+G+ N++ELM  FSFK + Y++EEW      
Sbjct: 241 RSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEW------ 294

Query: 285 AFRKAFNTAMLLMLSIIAVWVIYLLVKKNFLS 316
                FN ++      I ++VI LL+ + F+S
Sbjct: 295 ----KFNDSIKKNFKAILMFVILLLLIQFFVS 322

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  283 bits (723), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 209/312 (66%), Gaps = 11/312 (3%)

Query: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66
           + IPSPTDVGALANRINF TRD HNK++ FMGIR+A+A++HGFIYR+G++ +Y++F+ IE
Sbjct: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62

Query: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTE-SLNEFLA 125
            EID +L++   + + Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ 
Sbjct: 63  TEIDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119

Query: 126 K---FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPN 182
                     LQ FV  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP 
Sbjct: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179

Query: 183 FERLSQKELVKKGTNFFTFSDLGPTEETRLKLE--YKKNYELATRTELTEAQKLQIISVA 240
           FE LS KE++ +GTNF+ F+D    E T +KL   YKKNYEL+TR EL E QKL +I  +
Sbjct: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239

Query: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300
             +F    + +AE+G  NR ELM  FS+K  T++ EEW    +S+       +++ +L I
Sbjct: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEW--KYNSSISPFLKKSLMFILII 297

Query: 301 IAVWVIYLLVKK 312
           I   +  +L+ +
Sbjct: 298 IQFTLASVLLNR 309

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  275 bits (704), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 139/280 (49%), Positives = 191/280 (68%), Gaps = 9/280 (3%)

Query: 8   IIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQ 67
           IIPSPTDV ALANRINF TRD HNKI  FM IR+A+A+RHGFIYRQG++A+Y++F  IE 
Sbjct: 6   IIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIEN 65

Query: 68  EIDRLLHDPVTE---KELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTES----- 119
           EID LL+   +E    ++QT  ILK F++ +FRR   + +DL +LY   FK         
Sbjct: 66  EIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDF 125

Query: 120 LNEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGL 179
           LN      E  P L  F + I +  +++P TI++YCHVLYLALFAGGK+++SN+ + +GL
Sbjct: 126 LNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGL 185

Query: 180 FPNFERLSQKELVKKGTNFFTFSDLGPTE-ETRLKLEYKKNYELATRTELTEAQKLQIIS 238
           FP F+ +S +E+  +G+NFF F+     + +++L+ EYKKNYEL+TR EL E QK  II 
Sbjct: 186 FPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIE 245

Query: 239 VAGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278
           V+  IF    +++AEIG  NR +LMG F+ K +TY+ EEW
Sbjct: 246 VSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEW 285

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  271 bits (693), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 135/251 (53%), Positives = 173/251 (68%), Gaps = 11/251 (4%)

Query: 37  MGIRMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLH----------DPVTEKELQTST 86
           M +R A+A+RHG +YRQGILA+YYVF AIEQEID LL             V++++L  S 
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 87  ILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFEKPPLLQQFVNDIHENIRK 146
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   + PP LQ FV+ +H  +R+
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 147 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLSQKELVKKGTNFFTFSDLGP 206
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE LS KEL +KGTNFFTFSD G 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 207 TEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWNFHIVAEIGELNRRELMGKF 266
             E +LK +YKKNYELATR  L E  KL+II VA  IF+ N  I+ EIG+LN+  L    
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239

Query: 267 SFKCVTYVYEE 277
               + YV+EE
Sbjct: 240 KLDLLQYVFEE 250

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  262 bits (670), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 183/274 (66%), Gaps = 1/274 (0%)

Query: 5   TNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDA 64
            + ++P PTD GALANRINFHTR+ H+K + F+  + A+A+RH  IYRQG+LA YY+F +
Sbjct: 14  ASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRS 73

Query: 65  IEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFL 124
           +EQ IDRLL  P T  E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL
Sbjct: 74  VEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133

Query: 125 AKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184
             +E PP L   V DI     ++P TIL++CHVLYLALFAGG+++RS L R+LGL P   
Sbjct: 134 DSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAA 193

Query: 185 RLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIF 244
            LS +E   +GT+FFTF   G  EE + ++ YK+ YELATRT L+EA+K  +I  A   F
Sbjct: 194 GLSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADF 252

Query: 245 DWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278
           D    ++AE+   NR+EL+G  S++ +T++ EEW
Sbjct: 253 DHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEW 286

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  243 bits (619), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 197/313 (62%), Gaps = 20/313 (6%)

Query: 9   IPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           +PSPTD  ALANRINFHTRD HN I+  M I+   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 69  IDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFE 128
           ID +    ++        IL+ F+ + FRR  QI KDLK L  N+ +  +S +++L+   
Sbjct: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLS--- 114

Query: 129 KPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFERL 186
             P L +F+N I  N+ + P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+++
Sbjct: 115 SRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246
           S  +++   TNFF F D     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233

Query: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKA-FNTAMLLMLSIIAVWV 305
           NF+++ EIG +N+ ELM  F++K VTYV EEW       FRK      ++L L I  ++V
Sbjct: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEW------KFRKPQIKKYVILFLIIFHLFV 287

Query: 306 IYLLVKKNFLSIV 318
              L KK +L  +
Sbjct: 288 FINLFKKFYLQAI 300

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  222 bits (565), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/310 (39%), Positives = 181/310 (58%), Gaps = 24/310 (7%)

Query: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66
           + IPSPTD  ALANRINFHTRD HN+++    ++  +A+RH FIY   +  +Y VF  +E
Sbjct: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62

Query: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126
           Q ID L+    +E       IL +F++ +FRR+ +I +DL  L    + + ES      +
Sbjct: 63  QRIDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQ 112

Query: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF--- 183
           +  PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF   
Sbjct: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172

Query: 184 ----ERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISV 239
               E +S   LV   TNFF F++    +E +L+  YK+NYELATR  LTE QKL +I+ 
Sbjct: 173 NGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231

Query: 240 AGGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLS 299
           +  +F   F ++ EI + N  ELM   SFK VTY  EEW       F K F   +L  ++
Sbjct: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEW------KFNKNFKRGVLWGVA 285

Query: 300 IIAVWVIYLL 309
            +A ++  +L
Sbjct: 286 FLAQFLFVVL 295

>KLLA0D19492g Chr4 (1643703..1645193) [1491 bp, 496 aa] {ON} similar
           to uniprot|Q07729 Saccharomyces cerevisiae YDL238C GUD1
           Guanine deaminase a catabolic enzyme of the guanine
           salvage pathway producing xanthine and ammonia from
           guanine activity is low in exponentially-growing
           cultures but expression is increased in post-diauxic and
           stationary-phase cultures
          Length = 496

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 12/80 (15%)

Query: 145 RKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLSQK--ELVKKGTNFFTF- 201
           RKE C  LS   VLYLA   G K++  NL  ++G F   +    +  +L  KG+N   F 
Sbjct: 391 RKEECK-LSVAEVLYLATMGGAKVL--NLSDKIGSFDVGKEFDAQLIDLSTKGSNVSIFP 447

Query: 202 ------SDLGPTEETRLKLE 215
                   + P  + R+KLE
Sbjct: 448 WQKVTNDKIQPNGKDRIKLE 467

>TDEL0D01210 Chr4 complement(225620..227938) [2319 bp, 772 aa] {ON}
           Anc_1.256 YJL105W
          Length = 772

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 99  STQIYKDLKLLYSNLFKSTESLNEFLAKFEK-PPLLQQFVNDIHENIRKEPCTILSYCHV 157
           S  +YK +K   +N +K  E LN++  K  + PP+L +   ++ EN  + P  +  Y + 
Sbjct: 558 SQSLYKTVKSKMNNRYKLNEILNQYQGKKRRQPPILSRMAKEVLENEERAPKVLADY-NE 616

Query: 158 LYLALFAG 165
             LA+  G
Sbjct: 617 KKLAITCG 624

>NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8.331
           YDR150W
          Length = 2447

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 53/136 (38%), Gaps = 23/136 (16%)

Query: 12  PTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQEIDR 71
           P  +   +N +  HT +  N +N F+  R A          + +L       AI QE  +
Sbjct: 39  PPILARTSNDVAIHTNNNENMMNPFVADRNA---DFSIELSENLLKECRKLQAINQEKSK 95

Query: 72  LLHDPVTEKELQTSTILKQFWLEDFRRST------------------QIYKDLKLLYSNL 113
            L D   E E     + K   L+++R S                   Q+  DLK+    L
Sbjct: 96  ALEDKTKENEKINEKLNK--ALKEYRNSKDTNWELENKLMDISNQFKQVKNDLKIKDLEL 153

Query: 114 FKSTESLNEFLAKFEK 129
            K  +SLN+ +A+ EK
Sbjct: 154 EKINKSLNDKMAEVEK 169

>Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] {ON}
            YPL058C (REAL)
          Length = 1511

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 161  ALFAGGKLIRSNLYRRLG-LFPNFERLSQKELVKKGTNFFTFSDLGPTEETRLK 213
            AL   G+ I   +++    LF  F+RL    L+KKG     F D+GP  ET LK
Sbjct: 1028 ALADSGQSILCTIHQPSATLFEQFDRLL---LLKKGGKMVYFGDIGPNSETLLK 1078

>YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}
            PDR12Plasma membrane ATP-binding cassette (ABC)
            transporter, weak-acid-inducible multidrug transporter
            required for weak organic acid resistance; induced by
            sorbate and benzoate and regulated by War1p; mutants
            exhibit sorbate hypersensitivity
          Length = 1511

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 161  ALFAGGKLIRSNLYRRLG-LFPNFERLSQKELVKKGTNFFTFSDLGPTEETRLK 213
            AL   G+ I   +++    LF  F+RL    L+KKG     F D+GP  ET LK
Sbjct: 1028 ALADSGQSILCTIHQPSATLFEQFDRLL---LLKKGGKMVYFGDIGPNSETLLK 1078

>Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] {ON}
            YPL058C (REAL)
          Length = 1511

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 161  ALFAGGKLIRSNLYRRLG-LFPNFERLSQKELVKKGTNFFTFSDLGPTEETRLK 213
            AL   G+ I   +++    LF  F+RL    L+KKG     F D+GP  ET LK
Sbjct: 1028 ALADSGQSILCTIHQPSATLFEQFDRLL---LLKKGGKMVYFGDIGPNSETLLK 1078

>NCAS0G01370 Chr7 complement(244659..246122) [1464 bp, 487 aa] {ON}
           Anc_2.16 YDL239C
          Length = 487

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 106 LKLLYSNLFKSTESLNEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAG 165
           L++ Y++L    + L  +L ++EKP LL++FVN++H  +  EP  +++   V Y      
Sbjct: 406 LQMSYTDLPDKIQRLAVYL-QYEKP-LLRKFVNELHRMVFGEPIDLVNKAAVAYSQFSKT 463

Query: 166 GKL 168
           G +
Sbjct: 464 GDM 466

>YLR442C Chr12 complement(1019315..1022251) [2937 bp, 978 aa] {ON}
           SIR3Silencing protein that interacts with Sir2p and
           Sir4p, and histone H3 and H4 tails, to establish a
           transcriptionally silent chromatin state; required for
           spreading of silenced chromatin; recruited to chromatin
           through interaction with Rap1p
          Length = 978

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 9/123 (7%)

Query: 77  VTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFEKPPLLQQF 136
           V + EL  +  L + WL+DF    QI  + +   S++ K  +   +FL ++   P  ++F
Sbjct: 127 VNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIED--RDFLVRYACEPTAEKF 184

Query: 137 VN-DIHENIRK----EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLSQKEL 191
           V  DI + IR+    EP     Y     +++   G+     +  ++G+  + +RL++K  
Sbjct: 185 VPIDIFQIIRRVKEMEPKQSDEYLK--RVSVPVSGQKTNRQVMHKMGVERSSKRLAKKPS 242

Query: 192 VKK 194
           +KK
Sbjct: 243 MKK 245

>Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)
          Length = 763

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 88  LKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKF-EKPPLLQQ 135
           + Q W +  ++ST ++K  KLL S  F S+ES N F  K  EK P L Q
Sbjct: 285 VSQSWNKVIKKSTSLWK--KLLVSENFVSSESFNSFNLKLSEKYPKLPQ 331

>NCAS0A06920 Chr1 (1373157..1374713) [1557 bp, 518 aa] {ON}
           Anc_5.184
          Length = 518

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 137 VNDIHENIRKEPCTILSYCHVL-YLALFAGGKLIRSNLYRRLGL 179
           VN I E ++K  CT   +     ++A+F  GK+   + +R  GL
Sbjct: 291 VNSIRETVKKYNCTFTPFLQACWFVAMFNNGKIFHMDSWREWGL 334

>NDAI0E01620 Chr5 (322737..324200) [1464 bp, 487 aa] {ON} Anc_8.609
           YOR198C
          Length = 487

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 11/75 (14%)

Query: 56  LAYYYVFDAIEQEIDRLL-HDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLF 114
           + +Y + D+++QE  +LL H+    KE+    I  Q  L++  R  QI++ +K+L SN+ 
Sbjct: 54  IDHYQISDSVQQERKKLLDHN----KEI----IKNQADLKN--RRNQIFESIKILDSNIK 103

Query: 115 KSTESLNEFLAKFEK 129
           +    +NE L K  K
Sbjct: 104 RRNNEINEKLGKKHK 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,218,165
Number of extensions: 1431259
Number of successful extensions: 5859
Number of sequences better than 10.0: 51
Number of HSP's gapped: 6057
Number of HSP's successfully gapped: 51
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)