Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2667.346ON43643623070.0
Suva_10.2977.346ON43643622420.0
Smik_12.2617.346ON43643622050.0
YLR203C (MSS51)7.346ON43643621860.0
TDEL0C020207.346ON42540717990.0
Kpol_530.357.346ON42540417670.0
SAKL0F11286g7.346ON42340217650.0
NCAS0E028807.346ON42941917550.0
TPHA0F029307.346ON43640417480.0
CAGL0A03927g7.346ON43741717340.0
Kwal_56.246317.346ON42240217140.0
KLTH0H01342g7.346ON42241017090.0
ZYRO0F11616g7.346ON41540216770.0
Ecym_47277.346ON42940816580.0
KNAG0B026307.346ON43841116590.0
NDAI0E044807.346ON44341116380.0
KLLA0D12430g7.346ON41840216330.0
NCAS0A141207.346ON42743415590.0
TBLA0E005007.346ON43741815360.0
ACL152W7.346ON42840215270.0
NDAI0A019307.346ON45041715190.0
KAFR0B008407.346ON42643315050.0
KNAG0C037507.346ON42442114720.0
TBLA0H002802.406ON149887732.5
Suva_13.1425.550ON58482688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.266
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   893   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   868   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   853   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   846   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   697   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   685   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   684   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   680   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   677   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   672   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   664   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   662   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   650   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   643   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   643   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   635   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   633   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   605   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   596   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   592   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   589   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   584   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   571   0.0  
TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON...    33   2.5  
Suva_13.142 Chr13 (227330..229084) [1755 bp, 584 aa] {ON} YML017...    31   8.0  

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 425/436 (97%)

Query: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240
           AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR
Sbjct: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360
           VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET
Sbjct: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/436 (94%), Positives = 417/436 (95%)

Query: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALYAPSGAAQ+YSHLLRRSP NRLVV HQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDK YHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLF YTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240
           AVTKMLSYPITIGS+LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATT+NR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHF+GPECLYKRDKQEYVKSATPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360
           +DETL+F HHTDFF VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM ALLET
Sbjct: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLMDDIN VKSKYGKEMDILMDPV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/436 (92%), Positives = 413/436 (94%)

Query: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALY PSGA Q+YSHLLRRS +NRLV+ HQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDK YHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQ QGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240
           AVTKMLSYPITIGS+LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+L  TKNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHF+GPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360
           VDETL+FIH TDFF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM+ALLET
Sbjct: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DD+N VKSKYGKEMDILMDPV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/436 (91%), Positives = 414/436 (94%)

Query: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MT LYAPSGA Q+Y HLLR+SP+NRLVV HQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDK YHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240
           AVTKMLSYPITIGS+LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+  TTKNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQ+FEIHF+GPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360
           VDETL+FI+ T+FF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM+ALLET
Sbjct: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DDIN VKSKYGKEMD+LM+PVRNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/407 (78%), Positives = 363/407 (89%), Gaps = 2/407 (0%)

Query: 28  VYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPV 87
           V++Q RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPV
Sbjct: 20  VFNQ-RRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPV 78

Query: 88  TGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFP 147
           TGK+INYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFP
Sbjct: 79  TGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFP 138

Query: 148 QQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPK 207
           Q Q +D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I SVLH+FSPYSLNPK
Sbjct: 139 QGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPK 198

Query: 208 GPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLF 267
           GP+TLEGLKSLAALRYTLYPLEN+++ ++TK+R MRIFILGARAEAQLPGHVWKQLQ+LF
Sbjct: 199 GPVTLEGLKSLAALRYTLYPLENKTI-SSTKDRPMRIFILGARAEAQLPGHVWKQLQYLF 257

Query: 268 PEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYD 327
           PEQ FE+HFVGPECL  ++K +YV S+TPVV+RVDET+ F++HTDFF V HEAQDFFPYD
Sbjct: 258 PEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYD 317

Query: 328 PYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGK 387
           PY+DVFF FHPG+ +PE+  SW+ ETM+ LLETKCAIFTTGFNK DL+ D++AVK KYGK
Sbjct: 318 PYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGK 377

Query: 388 EMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           E+D+LM+PV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 378 EVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/404 (77%), Positives = 357/404 (88%), Gaps = 2/404 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 21  KRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           D+ +NLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH+FSPYSLNPKGP+TL
Sbjct: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200

Query: 213 EGLKSLAALRYTLYPLENRS--VLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270
           EGLKSLAALRYTLYP +N+S  V   T++R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260

Query: 271 NFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYM 330
            FEIHF+GPEC   ++K +Y+ S+TP+V++VD+TL+ + H D+F VFHEAQDFFPYDP++
Sbjct: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320

Query: 331 DVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMD 390
           DVFFTFHPGYA PE+   W+GETM+ALL+TKCAIFTTGF+K+DL+ DI+ VK++YG E+D
Sbjct: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380

Query: 391 ILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           +LMDPV+NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/402 (77%), Positives = 352/402 (87%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH++GFVRNALGL           +NRFHPWDQSPS DLR RAA IR LA CPVTGK+I
Sbjct: 21  KRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GSVLH+FSPY+LNPKGPITL
Sbjct: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200

Query: 213 EGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP ++R V A TK+R MRIFILGARAEAQLPGHVWKQ QFLFPE NF
Sbjct: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260

Query: 273 EIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332
           E+HF+GPE  Y R+K+EY+ S+TP+V+RVDETL F++HTD+F VFHEAQDFFPYDPY+D+
Sbjct: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320

Query: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392
           FF FHPG+A+PES   WMG+TM  LLETKCAIFTTGFN++DL+ D+ AV+ KYG EMD+L
Sbjct: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380

Query: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PVRN+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/419 (75%), Positives = 360/419 (85%), Gaps = 3/419 (0%)

Query: 17  LLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERA 76
           LL R+ +N  V  +QTR HLMGFVRNALGL           ENRFHPWDQSPS DLRERA
Sbjct: 14  LLPRNAFN--VAGNQTR-HLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERA 70

Query: 77  AKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLR 136
           A+IRTLA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLR
Sbjct: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130

Query: 137 SGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVL 196
           SGRPFPEFDFP+ QG D+ VN+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGSVL
Sbjct: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190

Query: 197 HKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLP 256
           H+FSPYSL PKGPI+LEGLKSLAALRYTLYP++NR V++TTK R MRIFILGARAE+QLP
Sbjct: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250

Query: 257 GHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDV 316
           GHVWKQLQ+LFPEQ FEIHF+GPE  Y +DK++Y++  TP+ + VDETL+ I+HT++F  
Sbjct: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310

Query: 317 FHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMD 376
            HEAQDFFPYDPYMDVFF FHPG+AS E    WM +TM+ LL+TKCAIFTTGF K DL++
Sbjct: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370

Query: 377 DINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           DI  V+ KYGKE+DILM P +NVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/404 (75%), Positives = 356/404 (88%), Gaps = 1/404 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +R LMGFV+NALGL           ENRFHPWDQSPS DLRERAA+IRTLA CPVT K+I
Sbjct: 33  KRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEI 92

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHHSREAWE DK YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIH 152

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           D+ VNLTNWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGPITL
Sbjct: 153 DRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITL 212

Query: 213 EGLKSLAALRYTLYPLENRSVLA-TTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           EGLKSLAALRY+LYP + +S ++    +R MRIFILGARAEAQLPGHVWKQLQFLFP+Q 
Sbjct: 213 EGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQT 272

Query: 272 FEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMD 331
           FEIHF+G ECL   +K +Y+KSA PVV+++DET++ I+H+D+F V+HEAQDF PYDPY+D
Sbjct: 273 FEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLD 332

Query: 332 VFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDI 391
           VFFTFHPG+A+PE+   WMG+TM+ALLETKCAIFTTGFNK+D+ +D+  VK++YGKEMD 
Sbjct: 333 VFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT 392

Query: 392 LMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           LMDP++N +GSTKWELNDMNPQE++QFNMY+AGFRGKRYHTIKR
Sbjct: 393 LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/417 (75%), Positives = 351/417 (84%), Gaps = 14/417 (3%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           ++R LMGFVRNALGL           +NRFHPWDQSP+VDLRERAA+I+TLA CPVT K 
Sbjct: 20  SKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKP 79

Query: 92  INYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           I YTCP+SGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFP+ QG
Sbjct: 80  IQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQG 139

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPIT 211
            D+ VNLTNWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH+FSPYSLNPKGPIT
Sbjct: 140 PDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 199

Query: 212 LEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           LEGLKSLAALRYTLYPL+NR+V  T KN+ MRIFILGARAEAQLPGHVWKQLQFLFP+QN
Sbjct: 200 LEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQN 259

Query: 272 FEIHFVGPECLYKRDKQEYVKSAT--------------PVVQRVDETLRFIHHTDFFDVF 317
           FEIHF+GPE LY R++ EY++SAT              PV +R+DET++F +HTD+F   
Sbjct: 260 FEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTL 319

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDD 377
           H AQDFFPYDPY DVFF FHPG ASPES  +WM +T++ LL+TKCAIFTTGFNKKD+ DD
Sbjct: 320 HTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADD 379

Query: 378 INAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           I  ++  YGKEMD+LM+PV+NVFGSTKWEL+D +P  VYQFNMYIAGFRGKRYH IK
Sbjct: 380 IQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIK 436

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/402 (76%), Positives = 346/402 (86%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH+MGFVRNALGL           ENRFHPWDQSPS DLRERAA IR LA CPVTG++I
Sbjct: 20  KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREI 79

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCP SGIPTHHSREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 80  NYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDF 139

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           D+ VNLTNWDLFFYTR F+SMDTEFQLAAVTKMLSYPITIGSVLH+FSPYSLNPKGPITL
Sbjct: 140 DRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITL 199

Query: 213 EGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP +NR V +  KN  +RIF+LGARAEAQLPGHVWKQLQF+FPE   
Sbjct: 200 EGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQM 259

Query: 273 EIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332
           EIHFVGPE  Y R+K+EYV SA P+++RVDETL F++HTD+F VFHEAQDFFPYDPY D+
Sbjct: 260 EIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTDI 319

Query: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392
           FF FHPG+A+PES  +WMG+TM ALLETKCAIFTTGFN+ DL  D++AV ++YGKE+DI+
Sbjct: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDII 379

Query: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           MDP +N FGSTKWELND+NPQEVYQFNM++AGFRGKRYH I+
Sbjct: 380 MDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIE 421

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/410 (75%), Positives = 349/410 (85%)

Query: 25  RLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAH 84
           R   ++  +RH+MGFVRNALGL           ENRFHPWDQSPS DLRERAA IR LA 
Sbjct: 12  RSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAK 71

Query: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144
           CPVTG++INYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEF
Sbjct: 72  CPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEF 131

Query: 145 DFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSL 204
           DFP  Q +D+ VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGSVLH+FSPYSL
Sbjct: 132 DFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSL 191

Query: 205 NPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQ 264
           NPKGP+TLEGLKSLAALRYTLYP +NR V + TKN  +RIFILGARAEAQLPGHVWKQLQ
Sbjct: 192 NPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQ 251

Query: 265 FLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFF 324
           F+FPE N E+HFVGPE  Y R+K+EYV S++P+V+RVDETL F++HTD+F VFHEAQDFF
Sbjct: 252 FMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFF 311

Query: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSK 384
           PYDPY D+FF FHPG+A+PES  +WMG+TM ALLETKCA+FTTGFN+ DL  D+  V  K
Sbjct: 312 PYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGK 371

Query: 385 YGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           +GKE+D+LM+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 372 HGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/402 (74%), Positives = 344/402 (85%), Gaps = 1/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR ++GFVRNALGL           ENRFH WDQSP+ DLRERAA+IR LA CPVTGK+I
Sbjct: 14  RRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKEI 73

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
           NYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEFDFPQ   +
Sbjct: 74  NYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEF 133

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI SVL++FSPYSLNPKGPITL
Sbjct: 134 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITL 193

Query: 213 EGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP EN++V A TK+R MR+FILGARAEA LPGHVWKQLQFLFPE  F
Sbjct: 194 EGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAF 252

Query: 273 EIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332
           E+HF+GPECL  ++K +YV S  PVV+R+DETL F++HTD+F V+H+AQDFFPYDPY+D 
Sbjct: 253 ELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDA 312

Query: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392
           FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L+ DINAV  K+ KE+DIL
Sbjct: 313 FFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDIL 372

Query: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+P +N++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 373 MEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/408 (72%), Positives = 347/408 (85%), Gaps = 1/408 (0%)

Query: 27  VVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCP 86
           V   Q RR +MGFVRNALGL           +NRFHPWDQSPS +LRERAA+I+ LA CP
Sbjct: 22  VCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCP 81

Query: 87  VTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDF 146
           VTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRPF EFDF
Sbjct: 82  VTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDF 141

Query: 147 PQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNP 206
           P+QQ YD+ VN+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNP
Sbjct: 142 PEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNP 201

Query: 207 KGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFL 266
           KGPITLEGLKSLAALRYTLYP +NR V  + +++ +R+FILGARAEAQLPGHVWKQLQ+L
Sbjct: 202 KGPITLEGLKSLAALRYTLYPEQNRRV-RSIQDKPLRVFILGARAEAQLPGHVWKQLQYL 260

Query: 267 FPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPY 326
           FPE   E+HFVGPE  Y R+K+EYV S+ PVV+R+D+T++  +HTD+F VFHEAQDFFPY
Sbjct: 261 FPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPY 320

Query: 327 DPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYG 386
           DPY D+FF FHPG+ SPE+  +WM  T++ALL+TKCAIFTTGFNKKDLMDD+ AVK KYG
Sbjct: 321 DPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYG 380

Query: 387 KEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            E+D+L+DP +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 381 DELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/411 (72%), Positives = 342/411 (83%), Gaps = 8/411 (1%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR LMGFVRNALGL           ENRFHPWDQSP   LRERAA+I+TLA CPVTG ++
Sbjct: 28  RRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNV 87

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
            YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLRSGRPFPEFDFPQ+QGY
Sbjct: 88  EYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGY 147

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           DK VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI S+L +FSPYSLNPKGPITL
Sbjct: 148 DKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITL 207

Query: 213 EGLKSLAALRYTLYPLE-NRSVLA-------TTKNRAMRIFILGARAEAQLPGHVWKQLQ 264
           EGLKSLAA+RYTLY    N S  A         KNR MR+F+LGARAEAQLPGHVWKQL 
Sbjct: 208 EGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLS 267

Query: 265 FLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFF 324
           +LFPEQ+FE+ F+GPE  Y R + +YV+S TPVV++VDETL+FIH+TD+F V HE+QDFF
Sbjct: 268 YLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDFF 327

Query: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSK 384
           PYDPY D FFTFHPG+ASPE+  +W+  T+ ALL+TKCAIFTTGF++ DLM+D+  +  K
Sbjct: 328 PYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEK 387

Query: 385 YGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           +G EMDILM+P +NVFGSTKWELND+NP EVYQFNMYIAGFRGKRYHTIKR
Sbjct: 388 FGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIKR 438

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/411 (69%), Positives = 342/411 (83%)

Query: 24  NRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLA 83
           N   V H + R LMGFVRNALGL           ENRFHPWDQSP  DLRERAAKIRTLA
Sbjct: 32  NNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLA 91

Query: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPE 143
           HCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGRPFPE
Sbjct: 92  HCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPE 151

Query: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYS 203
           F FPQ Q +D+ +N+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSPYS
Sbjct: 152 FVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYS 211

Query: 204 LNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQL 263
           L PKGPITLEGLKS+AALRYTLYP  N+S +  TKNR MRIF+LGARAEAQLPGH+WKQL
Sbjct: 212 LQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQL 271

Query: 264 QFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDF 323
           Q+LFPEQ FE+ F+GPE  Y ++K++Y+K   P++Q +D+TL+    T++F   HE+QD 
Sbjct: 272 QYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDL 331

Query: 324 FPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKS 383
           FPYDPYMDVFF FHPG+++ E+   WM +TM++LLET+CAIF TGF++ D+++D+N +  
Sbjct: 332 FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE 391

Query: 384 KYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           KY  ++DILM PV+NVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 392 KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/402 (73%), Positives = 340/402 (84%), Gaps = 2/402 (0%)

Query: 34  RHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93
           R +MGFVRNALGL           ENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 94  YTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYD 153
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ Q YD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 154 KAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITLE 213
           + VN++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLH++SPYSLNPKGPITLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 214 GLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFE 273
           GLKSLAALRYTLYP E        ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ + E
Sbjct: 197 GLKSLAALRYTLYP-EQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 274 IHFVGPECLYKRDKQEYVKSATP-VVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332
           +HFVGPE  Y R+K+ YV+S+T  +V+R+DE ++  +HTDFF VFHEAQDFFPYDPY DV
Sbjct: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315

Query: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392
           FF FHPG+A+PE+   WMG+TM+AL++TKCA+FTTGF+K+DL+ DI+ V+ KYG E+D+L
Sbjct: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375

Query: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/434 (65%), Positives = 345/434 (79%), Gaps = 8/434 (1%)

Query: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           M A  +P+ A Q+  H +     +  +  H+T   L+GFV+NALG+            NR
Sbjct: 1   MFAFKSPA-ATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANR 56

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120
           F+PWD+SPS  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K
Sbjct: 57  FYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNK 116

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
            YE L+KVNIYEHDLRSGRPFPEFDFP +Q  D  VN+TNWDLFFYTR FYSMDTEFQLA
Sbjct: 117 IYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLA 176

Query: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240
            VTKMLSYPITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYTL      +  ATTK R
Sbjct: 177 TVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTR 232

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300
            MRIFILGARAE+QLP H+WKQLQFLFP Q FEI+F+GPEC        Y+ S + +V+R
Sbjct: 233 PMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKR 292

Query: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360
           VDE+L   ++ D+FD FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TM+ALL+T
Sbjct: 293 VDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDT 352

Query: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGF++ D+M DI +V+  YG+E+D+LM+P++NVFGSTKWELND+NPQ+VYQFNM
Sbjct: 353 KCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNM 412

Query: 421 YIAGFRGKRYHTIK 434
           YIAGFRGKRYHT+K
Sbjct: 413 YIAGFRGKRYHTVK 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/418 (64%), Positives = 332/418 (79%), Gaps = 12/418 (2%)

Query: 24  NRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLA 83
           N +   + ++R+LMGFVR+ LGL           ENRFHPW+ SP  DLRERAA+I+T+A
Sbjct: 15  NIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMA 74

Query: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPE 143
            CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNIYEHDLRSGRPFPE
Sbjct: 75  KCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPE 134

Query: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYS 203
           FDFP++Q YD  +NL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+TI SVLH+FSPYS
Sbjct: 135 FDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYS 194

Query: 204 LNPKGPITLEGLKSLAALRYTLY----------PLENRSVLATTKNRAMRIFILGARAEA 253
           L PKGP+TLEGLKSLAALRYTL             ++ ++ AT+KNR MRIFILGARAEA
Sbjct: 195 LTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEA 254

Query: 254 QLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDF 313
           QLP HVWKQLQ+LFP  NFEIHF+GPE L  +DK  YV S TP+ +R+D+++  ++HTD+
Sbjct: 255 QLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDY 314

Query: 314 FDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKD 373
           F V+H+AQDF+PYDPY D+FF FHPG A+ +   +W+ ETM+ LL++KC IF TGF++KD
Sbjct: 315 FHVYHKAQDFYPYDPYFDIFFMFHPGLAATKE--TWLNETMQGLLDSKCPIFMTGFHEKD 372

Query: 374 LMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 431
           +  DI+ +   + K+MDILM PV+NVFGSTKWELND NPQEVYQFNMYIAG+RGKRYH
Sbjct: 373 ITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYH 430

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/402 (71%), Positives = 331/402 (82%), Gaps = 2/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR +MGFVRNALGL           ENRFH W+QSPS DLRERAA+IR LA CPVTGKDI
Sbjct: 28  RRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDI 87

Query: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152
            Y+C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ+QG 
Sbjct: 88  RYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGR 147

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212
           D+ VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGS+LH+FSPY+L P+GPITL
Sbjct: 148 DRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITL 207

Query: 213 EGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP E+ S  A  +++ MRIFILGARAEAQLPGHVWKQLQ+LFP  N 
Sbjct: 208 EGLKSLAALRYTLYP-ESESARA-VRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNM 265

Query: 273 EIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332
           EIHF+GPE LY R ++EYV S+TPV +RVD TL+ +HHTD+  VFHEAQDFFPYDPY DV
Sbjct: 266 EIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDV 325

Query: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392
           FF FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D  A+++ +  EMD+L
Sbjct: 326 FFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVL 385

Query: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M P +N+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 386 MHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/417 (65%), Positives = 325/417 (77%), Gaps = 18/417 (4%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           + RH +GFV+NALG+           ENRFHPWDQSPS DLRERAA+IR LA CPVTGK+
Sbjct: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKE 96

Query: 92  INYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQG 151
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ Q 
Sbjct: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPIT 211
           +D AV++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216

Query: 212 LEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           LEGLKS+AAL+Y+L      +   TTK R MRIFILGARAE+QLP H+WKQ  +LFP QN
Sbjct: 217 LEGLKSIAALKYSL----RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272

Query: 272 FEIHFVGPEC----LYKRDKQEYVKSATP----------VVQRVDETLRFIHHTDFFDVF 317
           FEI+F+GPEC           E   + T           +V+R+DE L  ++HTDFF   
Sbjct: 273 FEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDD 377
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETM+ALL+TKCAIFTTGFNK+DL+ D
Sbjct: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392

Query: 378 INAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           I+ V+  YGKE+D+LM P +NVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/433 (64%), Positives = 333/433 (76%), Gaps = 17/433 (3%)

Query: 8   SGAAQMYS-----HLLRRSPYNRLVVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFH 62
           SGA  +Y+     HL RR             R L+GFVRNALGL            NRF+
Sbjct: 4   SGAPHVYARGRLQHLQRRV----------LSRTLVGFVRNALGLEPPPTPDEPRVSNRFY 53

Query: 63  PWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKY 122
           PWDQSPS +LRERAAKI+ +A CP+TGK+INYTCP+SGIPTHHSREAWE D+ YH +K  
Sbjct: 54  PWDQSPSPELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIP 113

Query: 123 EILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAV 182
           +ILKKVNIYEHDLRSGR FPEFDFP  Q +D+AVNL NWDL+FYTRSFYSMDTEFQLA V
Sbjct: 114 DILKKVNIYEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATV 173

Query: 183 TKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLAT-TKNRA 241
           TKMLSYPITI SVLH++SPYSL P GPITLEGLKS+AALRY+LYP +++S  +   K R 
Sbjct: 174 TKMLSYPITIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRP 233

Query: 242 MRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRV 301
           MRIFILGARAE+QLPGHVWKQ Q+LFP Q FEI F+GPEC   R+    V  A  +V+R+
Sbjct: 234 MRIFILGARAESQLPGHVWKQFQYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRI 292

Query: 302 DETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETK 361
           D+T+  ++H   F   H+AQDFFPYDPY DVFF FHPG+ASPE+   WM +T++ALL+TK
Sbjct: 293 DDTISLVYHPKLFHDIHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTK 352

Query: 362 CAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMY 421
           CA+F TGF+KKDL +D+  +   YG ++D LM PV+N+FGSTKWELND+NPQEVYQFNMY
Sbjct: 353 CAVFHTGFSKKDLSNDVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMY 412

Query: 422 IAGFRGKRYHTIK 434
           I+ FRGKRYH I+
Sbjct: 413 ISAFRGKRYHPIE 425

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/421 (63%), Positives = 323/421 (76%), Gaps = 9/421 (2%)

Query: 17  LLRRSPYNRL---VVYHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLR 73
           L + +PY      +V +   R +MG+VRNA GL            NRFHPW++SP  DLR
Sbjct: 9   LGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLR 68

Query: 74  ERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEH 133
           +RAA+I+TLA CPVTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKKVNIYEH
Sbjct: 69  DRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEH 128

Query: 134 DLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIG 193
           DLRSGR FPEFDFP +QG D+AVNL NWDLF YTR FYSMDTEF LA VTKMLSYPITI 
Sbjct: 129 DLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIA 188

Query: 194 SVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEA 253
           SVLH+FSPY L P+GP+TLEGLKS+AALRYTLYP   ++ L+   N  MRIFI+G RAE+
Sbjct: 189 SVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLSN--NSPMRIFIVGTRAES 246

Query: 254 QLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDF 313
           QLPGHVWKQLQ+LF E+ FEIHF+GPEC  K  K     ++TP++++VD+TL  I+H  +
Sbjct: 247 QLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSLIYHPQY 302

Query: 314 FDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKD 373
           F   H++ D FPY+PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF TGFN+ D
Sbjct: 303 FHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGD 362

Query: 374 LMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTI 433
           + +D+  +   Y  E+D+LM P++NVFGS KWELND+NPQEVYQFNMYIAGFRGKRYH I
Sbjct: 363 ITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPI 422

Query: 434 K 434
           K
Sbjct: 423 K 423

>TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON}
           Anc_2.406 YMR129W
          Length = 1498

 Score = 32.7 bits (73), Expect = 2.5,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 326 YDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKY 385
           ++P+ D F  F+P +A+PE    ++   +R  + +  +I     N KDL  + N     +
Sbjct: 371 FNPFHDSFCQFNPTFATPE----FINVPIR--INSTSSIKFIQLNYKDLSKNSNEQLLNF 424

Query: 386 -GKEMDILMDPVRNVFGSTKWELNDMN 411
             K+  ++ DP + +   TK +L  +N
Sbjct: 425 TNKDFKLIKDPTKLLSKKTKQQLQQIN 451

>Suva_13.142 Chr13 (227330..229084) [1755 bp, 584 aa] {ON} YML017W
           (REAL)
          Length = 584

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 76  AAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDL 135
            +KI  L   P+TG++   T P    P  +S EA E       SKK   L K+     DL
Sbjct: 284 GSKITILKKQPLTGEESTSTTPTP-KPLSYS-EAVERSVVNETSKKSTPLSKIGTPSSDL 341

Query: 136 RSGRPFPEFDFPQQQGYDKAVN 157
           +S      F+   +QG +K  N
Sbjct: 342 QSTDKSDNFEGEDRQGSEKYEN 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,895,583
Number of extensions: 2024718
Number of successful extensions: 4164
Number of sequences better than 10.0: 28
Number of HSP's gapped: 4253
Number of HSP's successfully gapped: 28
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)