Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2657.351ON26026013480.0
YLR201C (COQ9)7.351ON26026012231e-171
Suva_10.2967.351ON26026011911e-167
Smik_12.2607.351ON26026011701e-163
NCAS0E028707.351ON2612608531e-115
TDEL0C019707.351ON2602498121e-109
Kpol_530.307.351ON2602467641e-102
TPHA0F029807.351ON2642477611e-101
NDAI0E044707.351ON2642497601e-101
CAGL0A03949g7.351ON2682457551e-100
TBLA0E004507.351ON2792597531e-100
ZYRO0F11726g7.351ON2512467501e-100
SAKL0F11396g7.351ON2542457361e-97
KNAG0B026207.351ON2652567265e-96
KAFR0L014807.351ON2642457222e-95
KLLA0D12320g7.351ON2502487108e-94
KLTH0H01232g7.351ON2572466882e-90
Kwal_56.246447.351ON2582466543e-85
Ecym_47227.351ON2532586282e-81
ACL147W7.351ON2462466003e-77
YLR202CsingletonOFF10831780.058
TBLA0C024603.408ON1076203731.1
NDAI0C036405.32ON403158721.3
TPHA0M006903.114ON21565701.6
YOR208W (PTP2)8.623ON750101702.5
ABR021W2.490ON108438702.6
NCAS0C010108.736ON148228702.7
Sklu_YGOB_BUD51.134ON1528220702.7
CAGL0M09449g7.436ON107873693.5
KLTH0G06402g5.301ON107284684.6
ZYRO0A06952gsingletonON31974674.8
ZYRO0B07832g4.203ON33069674.9
CAGL0K11814g3.258ON1008114676.1
NCAS0I023703.114ON21565657.0
TBLA0A025005.490ON63965667.5
SAKL0F03168g3.479ON706113667.7
ZYRO0C01694g8.260ON300669668.5
Kpol_1036.233.114ON21565649.4
NCAS0H014806.107ON47282659.5
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_12.265
         (783 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   523   0.0  
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   475   e-171
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   463   e-167
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   455   e-163
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   333   e-115
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   317   e-109
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   298   e-102
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   297   e-101
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   297   e-101
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   295   e-100
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   294   e-100
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   293   e-100
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   288   1e-97
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   284   5e-96
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   282   2e-95
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   278   8e-94
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   269   2e-90
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   256   3e-85
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   246   2e-81
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   235   3e-77
YLR202C Chr12 complement(550194..550458,550575..550636) [327 bp,...    35   0.058
TBLA0C02460 Chr3 complement(578682..581912) [3231 bp, 1076 aa] {...    33   1.1  
NDAI0C03640 Chr3 (834228..835439) [1212 bp, 403 aa] {ON} Anc_5.3...    32   1.3  
TPHA0M00690 Chr13 complement(130921..131568) [648 bp, 215 aa] {O...    32   1.6  
YOR208W Chr15 (733925..736177) [2253 bp, 750 aa] {ON}  PTP2Phosp...    32   2.5  
ABR021W Chr2 (431186..434440) [3255 bp, 1084 aa] {ON} Syntenic h...    32   2.6  
NCAS0C01010 Chr3 complement(183823..188271) [4449 bp, 1482 aa] {...    32   2.7  
Sklu_YGOB_BUD5 Chr3 (395220..398233,398235..398277,398279..39980...    32   2.7  
CAGL0M09449g Chr13 complement(938424..941660) [3237 bp, 1078 aa]...    31   3.5  
KLTH0G06402g Chr7 complement(507209..510427) [3219 bp, 1072 aa] ...    31   4.6  
ZYRO0A06952g Chr1 (565557..566516) [960 bp, 319 aa] {ON} no simi...    30   4.8  
ZYRO0B07832g Chr2 complement(612634..613626) [993 bp, 330 aa] {O...    30   4.9  
CAGL0K11814g Chr11 complement(1138550..1141576) [3027 bp, 1008 a...    30   6.1  
NCAS0I02370 Chr9 (446731..447378) [648 bp, 215 aa] {ON} Anc_3.11...    30   7.0  
TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {O...    30   7.5  
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    30   7.7  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...    30   8.5  
Kpol_1036.23 s1036 (58518..59165) [648 bp, 215 aa] {ON} (58518.....    29   9.4  
NCAS0H01480 Chr8 complement(284477..285895) [1419 bp, 472 aa] {O...    30   9.5  

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  523 bits (1348), Expect = 0.0
 Identities = 260/260 (100%), Positives = 260/260 (100%)
 Frame = +1

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 180
           MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60

Query: 181 RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 360
           RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS
Sbjct: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120

Query: 361 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 540
           RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180

Query: 541 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 720
           EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE
Sbjct: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240

Query: 721 FAWYTLMSTVNLVKSQLARG 780
           FAWYTLMSTVNLVKSQLARG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  475 bits (1223), Expect = e-171
 Identities = 229/260 (88%), Positives = 247/260 (95%)
 Frame = +1

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 180
           M CRN AR GCKF RLYHSNPIEHVKP+HIKPLTYGK+SPQYKVLSLAL ++VP+HGFSE
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 181 RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 360
           RSIVESLN+LGYPSSM+SSIGA NSPSFFHSSTAVMEL+KFQLVDKRYRLTEGINPDVT 
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120

Query: 361 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 540
           +YKLPSLEHLLLKRLEMDK IGG L++LMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180

Query: 541 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 720
           +DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSH++KETF FAK+KLH+VMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240

Query: 721 FAWYTLMSTVNLVKSQLARG 780
           FAWYTLMSTVNL+KSQL RG
Sbjct: 241 FAWYTLMSTVNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  463 bits (1191), Expect = e-167
 Identities = 230/260 (88%), Positives = 239/260 (91%)
 Frame = +1

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 180
           MF RN  R      RLYHSNPIEHV PLHIKPL YGKQSPQYKVLSLAL EYVPKHGF+E
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60

Query: 181 RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 360
           RSIVESLNKLGYPSSM+SSIGASNSPSF HSSTAVMEL+KFQLVDKRYRLTEGINPDVT 
Sbjct: 61  RSIVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120

Query: 361 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 540
            YKLPSLEHLLLKRLEMDK +G QL DLMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 541 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 720
           +DHHDSAWYAKRLAVSSTYIGS+LFMAQDKSHDF ETFAFAK+KLH+VMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240

Query: 721 FAWYTLMSTVNLVKSQLARG 780
           FAWYTLMSTVNLVKSQLARG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  455 bits (1170), Expect = e-163
 Identities = 223/260 (85%), Positives = 240/260 (92%)
 Frame = +1

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 180
           M CRN+ R GC   RLYH NPIEHVK  HIKPLTYGK+SPQYKVLSLAL +YVPKHGFSE
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 181 RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 360
           RSIVESLN+LGYPSSM+SSI ASNSPSFFHSSTAVMEL+KFQLVDKRYRLTE INPDVT 
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTP 120

Query: 361 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 540
           +YKLPSLEHLLL+RLEMDK IGG L++LMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 541 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 720
           +DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSH++K+TF FAK KL++VMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240

Query: 721 FAWYTLMSTVNLVKSQLARG 780
           FAWYTLMSTVNLVKSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLVRG 260

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  333 bits (853), Expect = e-115
 Identities = 161/260 (61%), Positives = 204/260 (78%), Gaps = 1/260 (0%)
 Frame = +1

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 180
           M  R++ + G   +R YH +  E+VKP  + PLTY K+S QYK+LS AL ++VPKHGF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 181 RSIVESLNKLGYPSSMVSSIGASNSPSFFHS-STAVMELVKFQLVDKRYRLTEGINPDVT 357
           ++I +SLN+LG+ SS++S IGASNSP+ F S S AVMEL+KFQLV KRY LTE + PD T
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 358 SRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSN 537
            + +LPSLE LLLKRLEMDK IG Q+  L ++LA PS  LF+ A+PELHRLSDDMIYFSN
Sbjct: 121 PKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180

Query: 538 EEDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTE 717
           E+DHHD AWY KRL VS  Y+ SKL+MAQD S DF++T +FAK+KLH++M+LGEYYNNTE
Sbjct: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240

Query: 718 EFAWYTLMSTVNLVKSQLAR 777
           E+AWY  M + NLV+++LAR
Sbjct: 241 EYAWYMFMVSTNLVRARLAR 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  317 bits (812), Expect = e-109
 Identities = 159/249 (63%), Positives = 199/249 (79%), Gaps = 1/249 (0%)
 Frame = +1

Query: 37  FHRLYHSNPIEHVKPLHIK-PLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLG 213
           F R Y     E++ P++ + PL YGK SPQYKVLS  L + VP +GF+ER+IV SLN+LG
Sbjct: 13  FARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELG 72

Query: 214 YPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLL 393
           YPS+M+S IG+SN PSFFHSS A+MEL+KF LVDKR  LTE I+ + T   +LPSLEHL+
Sbjct: 73  YPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-TPVDQLPSLEHLV 131

Query: 394 LKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAK 573
           +KRLEM+  +   L+ L+SQL++P   L + ++PELHRLSDDMIYFS E+DH+D AWY+K
Sbjct: 132 IKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSK 191

Query: 574 RLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVN 753
           RLAVS  Y+ S+LFMAQD+S D+KETF FA+EKLH+V  LGEYYNNTEEFAWYTL+ST+N
Sbjct: 192 RLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTIN 251

Query: 754 LVKSQLARG 780
           LVKSQLARG
Sbjct: 252 LVKSQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  298 bits (764), Expect = e-102
 Identities = 147/246 (59%), Positives = 194/246 (78%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           R YH NP E+V  L + PL YGK S QYK+LS +L   VP+ GF+ER+IV S+N LGYPS
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 402
           S++S IG+SN+PSF HSSTA+MEL+KF LV KRY+L+E I  D T   +LPSLE LL+KR
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSLEDLLIKR 134

Query: 403 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 582
           L+MD  IG  L+ L++QL++P   L +T++PELHRL+DDMIYFS+E+DH D AWYAKR+ 
Sbjct: 135 LKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMG 194

Query: 583 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 762
           VS+ Y+ SKLFMAQD+S  + +TF FAK+KL ++M+LG+YYNN EE+AWY LM+++N+ K
Sbjct: 195 VSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAK 254

Query: 763 SQLARG 780
           S+ ARG
Sbjct: 255 SKAARG 260

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  297 bits (761), Expect = e-101
 Identities = 148/247 (59%), Positives = 191/247 (77%), Gaps = 2/247 (0%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLN--KLGY 216
           R +H    E+V P  + P TY K SPQ+K+LS A+   V K GFSER+I+E++   K+  
Sbjct: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76

Query: 217 PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 396
            S+M+S+IG+SNSPSF HSS +VMEL+KF LV KRYR+ EG++P    + +LPSLE LLL
Sbjct: 77  QSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSLESLLL 136

Query: 397 KRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKR 576
           KRLEMD  IG  ++  MSQL +P   L ++A+PELHRL+DDMIYFSNE+DHHD AWY+KR
Sbjct: 137 KRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196

Query: 577 LAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNL 756
           L VSS YI SKLFMAQD S ++KET  FAK+KL KVMRLG+YYNNTEE+AWY L+++VN+
Sbjct: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256

Query: 757 VKSQLAR 777
           VKS+++R
Sbjct: 257 VKSRMSR 263

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  297 bits (760), Expect = e-101
 Identities = 147/249 (59%), Positives = 192/249 (77%), Gaps = 2/249 (0%)
 Frame = +1

Query: 40  HRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYP 219
           +R +HSN +E+ K   + PLTY K S QYK+LS AL ++VPK GF++ +I  SLN+L   
Sbjct: 16  NRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLS 75

Query: 220 SSMVSSIGASNSPSFFHS-STAVMELVKFQLVDKRYRLTEGINPDV-TSRYKLPSLEHLL 393
           SS+ S +G+SNSPS F S S AVMEL+KFQLV KRY+LTE I P + T++ KLPSLE LL
Sbjct: 76  SSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLL 135

Query: 394 LKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAK 573
           ++RL+MD+ +  QL+ L +QL +PS LLF  A+PEL  LSDD+IYFSNE+DHHD AWYAK
Sbjct: 136 IERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAK 195

Query: 574 RLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVN 753
           RL VS  Y+ SKL+M ++   +F +T  FAK+KLH++M LGEYYNNTEE+AWYTLM ++N
Sbjct: 196 RLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMN 255

Query: 754 LVKSQLARG 780
           LVK++LARG
Sbjct: 256 LVKARLARG 264

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  295 bits (755), Expect = e-100
 Identities = 144/245 (58%), Positives = 185/245 (75%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           R YH    E+V P   +PLTY  +SP++K+LS  +   VP+HGF+E++IV SLN +  PS
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 402
            M+++IGASNS +F HSS AVMEL+KFQLV+KR+R+ EGI  ++    KLPSLE LLLKR
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEASKLPSLESLLLKR 142

Query: 403 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 582
           L+MD  I   L  + +QL VPS  +   ++PEL RL+DDMIY+SNE+DHHD AWY KR A
Sbjct: 143 LKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAA 202

Query: 583 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 762
           +++TY+ SK FMAQDKSH+F ET  FA++KLHKVM LG+YYNN EEF W+TLMS VNL K
Sbjct: 203 LATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTK 262

Query: 763 SQLAR 777
           SQ+AR
Sbjct: 263 SQMAR 267

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  294 bits (753), Expect = e-100
 Identities = 148/259 (57%), Positives = 198/259 (76%)
 Frame = +1

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 180
           +  +++  NG    R Y+S   +  K  H++PL YGK S QY++L  A+   VP  GF+E
Sbjct: 26  LLSKHIKNNGI---RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTE 82

Query: 181 RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 360
           R+I+ S+NKLGY SSM+S +G+SN+ +  HSS AV+EL+KF LV KR +L+EGI+P+   
Sbjct: 83  RAIINSINKLGYNSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKD 142

Query: 361 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 540
              LPSLE+LLLKRL+MDK I  +L +++++L++P   L ET+IPEL RLSDDMIYFSNE
Sbjct: 143 ---LPSLEYLLLKRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNE 199

Query: 541 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 720
           +DHHD AWY+KRLAVS+TYI S++FMAQD S D  +T  FA++KL+KVM LGEYYNNTEE
Sbjct: 200 KDHHDMAWYSKRLAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEE 259

Query: 721 FAWYTLMSTVNLVKSQLAR 777
           F W+TLM++VN+VKSQLAR
Sbjct: 260 FLWFTLMTSVNIVKSQLAR 278

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  293 bits (750), Expect = e-100
 Identities = 146/246 (59%), Positives = 188/246 (76%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           R YH +  EH+    + PL YG  SPQY VLS AL   VP  GF+ER+IV SLN+L YPS
Sbjct: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 402
           +M+S IGASNSPS  HSS AVMELVKF LV KR +L++    D++S  K PSLE L +KR
Sbjct: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK-PSLEDLFIKR 125

Query: 403 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 582
           LE++  I G L+ L+S ++VP     +TA+PELHRLSDD+IY+SNE+DHHD AWY+KRL 
Sbjct: 126 LELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLG 185

Query: 583 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 762
           +S  Y+ S+LFMAQDKSH+++ETF FA++KL + M+LGEYYNNTEE+ WYTL++++NL K
Sbjct: 186 ISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAK 245

Query: 763 SQLARG 780
           SQ+ARG
Sbjct: 246 SQMARG 251

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  288 bits (736), Expect = 1e-97
 Identities = 143/245 (58%), Positives = 184/245 (75%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           R YH N +EH     + PL Y K SPQ+K+L+ AL E VPK+GF+ER++  S + LGY S
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 402
           S +S +GASNSPSFF+SS AV+EL+KF LV KRY LT+G+        + PSLE+L LKR
Sbjct: 72  SFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV---ADGTLESPSLENLFLKR 128

Query: 403 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 582
           LEM+K I   L+ L+S LA+P   L E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188

Query: 583 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 762
           +S+ Y+ S+LFMAQDKS D+++T  FAKEKL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248

Query: 763 SQLAR 777
           SQ+ R
Sbjct: 249 SQMTR 253

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  284 bits (726), Expect = 5e-96
 Identities = 143/256 (55%), Positives = 186/256 (72%), Gaps = 1/256 (0%)
 Frame = +1

Query: 13  NVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIV 192
           +V+R      RLYH NPIE+     + PLTY   SPQ ++L+  L   VP  GF+ER+++
Sbjct: 9   SVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALL 68

Query: 193 ESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINP-DVTSRYK 369
           +S+  +GY SSM+S +GASNSPS FHSS AVMELVKF LV KR+ LTE +    + S   
Sbjct: 69  KSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAA 128

Query: 370 LPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDH 549
           LPSLEHLL+KRL+MD  +  QL DL +QLA+PS+ +   A+PEL RLSDDMIYFSNE+DH
Sbjct: 129 LPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDH 188

Query: 550 HDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAW 729
            D+AWY+KRL VS  Y  SKLFMAQD S + ++T  FA++KLH++M LGEYYNN EE+AW
Sbjct: 189 FDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAW 248

Query: 730 YTLMSTVNLVKSQLAR 777
           Y++M+TVN  K+  +R
Sbjct: 249 YSIMTTVNRAKAGFSR 264

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  282 bits (722), Expect = 2e-95
 Identities = 141/245 (57%), Positives = 183/245 (74%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           RLYH    E+V P  I PLTY   S Q K+LS +L EYVP  GF+E+SI++S+N LGY S
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 402
           SM+S IGASNSPSF HSS AV+EL+K+ LV KR  LT+  N + T+     +L+ LLLKR
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTT-----TLKELLLKR 138

Query: 403 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 582
           LEMD  I  QL  L +QLA P + +F+ ++PEL +L+DDMI+FSNE+DHHD AWY+KRLA
Sbjct: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198

Query: 583 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 762
           VS  Y+ SK+FM QD S++F+ T  FA +K+ +VM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258

Query: 763 SQLAR 777
           SQ +R
Sbjct: 259 SQFSR 263

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  278 bits (710), Expect = 8e-94
 Identities = 137/248 (55%), Positives = 190/248 (76%)
 Frame = +1

Query: 37  FHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGY 216
           F RLYH N +EH  P  IKPLTYG  S Q+KVLS AL ++VP++GF+ER+IV+SLN+LG 
Sbjct: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGM 64

Query: 217 PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 396
            SS +S +G+SNSPSFF+ S +V+ELVKF LV KR +L   +  D  S   LP L+ L L
Sbjct: 65  GSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLD--SDKPLPDLKTLFL 122

Query: 397 KRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKR 576
           +RL++++ +   L+ L+S ++VP   L  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR
Sbjct: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182

Query: 577 LAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNL 756
           +A+S+ Y+ S+LFMAQDKSH+F+ET  FA+ KL+KV +LG  YNNTEE+ W+TL+S++NL
Sbjct: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242

Query: 757 VKSQLARG 780
            KSQ+ RG
Sbjct: 243 AKSQITRG 250

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  269 bits (688), Expect = 2e-90
 Identities = 135/246 (54%), Positives = 180/246 (73%), Gaps = 1/246 (0%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           RLYH + +EH       PLTYG  S Q+KVL  AL ++VP +GF+ER++V SLN L    
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSR-YKLPSLEHLLLK 399
           S++S IGASNSPSF ++S AV+EL+KF LV KRY LT+ ++P  TS   + P+LE L  +
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 400 RLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRL 579
           RLE++K I   L  L+S L++P   L +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 580 AVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLV 759
           A+S  ++ S+LFMAQD+S ++ +TF FA EKLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 760 KSQLAR 777
           KSQL R
Sbjct: 251 KSQLTR 256

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  256 bits (654), Expect = 3e-85
 Identities = 130/246 (52%), Positives = 173/246 (70%), Gaps = 1/246 (0%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           R Y  NP+E+     + PL YG QS Q+KVL  AL  +VP +GF+ER++V SLN LG  S
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGIN-PDVTSRYKLPSLEHLLLK 399
            ++SSIGA NSP   +SS AV+ELVKF LV KRY LT+ ++     S  + P+LE L  K
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131

Query: 400 RLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRL 579
           RLE++  I   +  L++ LA+P   L ++A+PELHRLSDDMIYFS E D +D AWY+KR 
Sbjct: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191

Query: 580 AVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLV 759
           A+S  ++ S+LFMAQDKS ++ +TF FA +KLH V +LG+YY NTEE+ WYTL+ +VNL 
Sbjct: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251

Query: 760 KSQLAR 777
           KSQ+ R
Sbjct: 252 KSQITR 257

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  246 bits (628), Expect = 2e-81
 Identities = 127/258 (49%), Positives = 176/258 (68%)
 Frame = +1

Query: 7   CRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERS 186
           C  +   G  F R YH N  E+     ++PL YG+ SPQYKVL+ AL +YVP  GF + +
Sbjct: 5   CHRIMLGG--FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSA 62

Query: 187 IVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRY 366
           IV++ N+LGY S+++++IGA+NSP+ F+ ST+V ELVKF LV KRY L E      T   
Sbjct: 63  IVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKT--- 119

Query: 367 KLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEED 546
               LE L LKRLE +K +G  L +++S LA+P   L  T +PEL +L+DDMIY+S E+D
Sbjct: 120 ----LEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKD 175

Query: 547 HHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFA 726
            +D AWY+KRLAVS  YI ++LFMA+D S +F+ T  FAK +++++  +G  YNN EEFA
Sbjct: 176 FNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFA 235

Query: 727 WYTLMSTVNLVKSQLARG 780
           W+ L++TVNL +SQL RG
Sbjct: 236 WFQLLTTVNLARSQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  235 bits (600), Expect = 3e-77
 Identities = 122/246 (49%), Positives = 166/246 (67%)
 Frame = +1

Query: 43  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 222
           RLYH N +EH     ++PL Y + SPQYKVL  AL  +VP  GF+ER+IV +   LGY S
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 223 SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 402
           +++S++ A NSP+  +  +AV+ELVKF LV KR  L      D  ++  + S+E L L+R
Sbjct: 67  AVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALA-----DAAAQGNV-SMEQLFLQR 120

Query: 403 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 582
           +E D+ + GQL  L+S L++P   L  TA+PEL RLSDD+IY+S E+DH D AWY+KR A
Sbjct: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180

Query: 583 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 762
           V+  Y+ + LFMA+D+S   +ET  FA+ +L +V  LG  YNN EEFAWY L+  +NLVK
Sbjct: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240

Query: 763 SQLARG 780
           SQL RG
Sbjct: 241 SQLTRG 246

>YLR202C Chr12 complement(550194..550458,550575..550636) [327 bp,
           108 aa] {OFF} Dubious open reading frame unlikely to
           encode a protein, based on available experimental and
           comparative sequence data; partially overlaps the
           verified ORF YLR201C; ORF contains a putative intron
          Length = 108

 Score = 34.7 bits (78), Expect = 0.058
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = +2

Query: 2   CSAAMLPEMAANSIVYITQTPSNTSNHSILS 94
           C  A+LPE A NS VYI +T SN  N  IL+
Sbjct: 77  CFVAILPERAVNSFVYIIRTLSNMLNQFILN 107

>TBLA0C02460 Chr3 complement(578682..581912) [3231 bp, 1076 aa] {ON}
            Anc_3.408 YPR097W
          Length = 1076

 Score = 32.7 bits (73), Expect = 1.1
 Identities = 45/203 (22%), Positives = 77/203 (37%), Gaps = 6/203 (2%)
 Frame = +1

Query: 130  VLSLALLEYVPKHGFSERSIVESL------NKLGYPSSMVSSIGASNSPSFFHSSTAVME 291
            V+  +L++      F   S+++S+        L + S ++  +         HSS  +  
Sbjct: 611  VIMKSLIDLFLVSPFGNYSLLQSMFSTILNEDLKHQSKIIKKLEMKIIQENKHSSKLIKP 670

Query: 292  LVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSR 471
            L  F + D+RY   +  N    S   LP    +L + L++ KLI  +L + +      S 
Sbjct: 671  LKHFIIKDERYNKIDFTNETNDSSNSLPVCFTVLNEMLKL-KLITKELVNELKY----SY 725

Query: 472  LLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKET 651
             L+     E   L DD       +D +DS         +S    SKL  +   S     T
Sbjct: 726  NLWNAENIENETLEDDF------DDDYDSTDITMMKTQNSKKSSSKLTKSSSSSTLNSST 779

Query: 652  FAFAKEKLHKVMRLGEYYNNTEE 720
                K    K++    YY + +E
Sbjct: 780  STIKKSTTKKIIIKSSYYQSFQE 802

>NDAI0C03640 Chr3 (834228..835439) [1212 bp, 403 aa] {ON} Anc_5.32
           YMR294W
          Length = 403

 Score = 32.3 bits (72), Expect = 1.3
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 12/158 (7%)
 Frame = +1

Query: 121 QYKVLSLALLEYVPKHGFSE--RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMEL 294
           Q K+      E +P++G     RS  ++L    YPS+ +   G  ++    + +T  M  
Sbjct: 25  QPKIFESEGTELLPENGLQNEYRSTNDTLEL--YPSNDIDHQGEKST--IIYENTPDMMK 80

Query: 295 VKFQLVD--KRYRLTEGINPDVTSRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPS 468
           V  QL    K+Y  T+    D+  + ++   E   LK+ E+DK+   +L D+  +  +  
Sbjct: 81  VAEQLESQLKKYNATKSTKEDLR-KMQIDKPEISTLKK-ELDKISLQELDDMKRESTMED 138

Query: 469 RLLFETAIPE--------LHRLSDDMIYFSNEEDHHDS 558
           +LLFE             L  L D +    +EE +HD+
Sbjct: 139 KLLFEKIQKSMQSDEKTLLKGLHDKLSEHVSEESNHDN 176

>TPHA0M00690 Chr13 complement(130921..131568) [648 bp, 215 aa] {ON}
           Anc_3.114 YBR154C
          Length = 215

 Score = 31.6 bits (70), Expect = 1.6
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 12/65 (18%)
 Frame = +1

Query: 265 FHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKL------------PSLEHLLLKRLE 408
           FH ++ V+ +   +LV K  RL+E    D+  RY+L            P   +L LKR E
Sbjct: 135 FHEASLVVNITHHELVPKHIRLSEEEKKDLLKRYRLKESQLPRIQRADPVALYLGLKRGE 194

Query: 409 MDKLI 423
           + K+I
Sbjct: 195 VVKII 199

>YOR208W Chr15 (733925..736177) [2253 bp, 750 aa] {ON}
           PTP2Phosphotyrosine-specific protein phosphatase
           involved in the inactivation of mitogen-activated
           protein kinase (MAPK) during osmolarity sensing;
           dephosporylates Hog1p MAPK and regulates its
           localization; localized to the nucleus
          Length = 750

 Score = 31.6 bits (70), Expect = 2.5
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = +1

Query: 76  KPLHIKPLTYGKQSPQ----YKVLSLALLEYVPKHGFSERSIVESLNKLGYPSSMVSSIG 243
           KPLH K L+  ++ PQ     K+ SL  L+   ++  S +S ++   KL     ++    
Sbjct: 325 KPLHQKQLSQKQRGPQSTDDSKLYSLTSLQ--RQYKSSLKSNIQKNQKL---KLIIPKNN 379

Query: 244 ASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRY 366
            S+SPS   S   +M  +        Y LTEGI     +RY
Sbjct: 380 TSSSPSPLSSDDTIMSPI------NDYELTEGIQSFTKNRY 414

>ABR021W Chr2 (431186..434440) [3255 bp, 1084 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL092C (BUD2)
          Length = 1084

 Score = 31.6 bits (70), Expect = 2.6
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = +1

Query: 307 LVDKRYRLTEGINPDVTSRYKLPSLEHLLLKRLEMDKL 420
           L+++  R TE +N  VT R+K+ SL  L LK + MD++
Sbjct: 845 LIERYLRETELVNAFVTYRHKISSLNRLDLKPVTMDQI 882

>NCAS0C01010 Chr3 complement(183823..188271) [4449 bp, 1482 aa] {ON}
           Anc_8.736 YMR219W
          Length = 1482

 Score = 31.6 bits (70), Expect = 2.7
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = -2

Query: 302 NFTSSMTAVEEWKNEGELEAPIEETMEE 219
           N T  + ++EE KNE E++ P++E M E
Sbjct: 904 NHTQPLQSIEEGKNENEMDVPVKEEMYE 931

>Sklu_YGOB_BUD5 Chr3 (395220..398233,398235..398277,398279..399808)
            [4587 bp, 1528 aa] {ON} ANNOTATED BY YGOB - 2 frameshifts
            corrected by reverting to original 2003 Cliften et al S.
            kluyveri BUD5 data.
          Length = 1528

 Score = 31.6 bits (70), Expect = 2.7
 Identities = 59/220 (26%), Positives = 98/220 (44%), Gaps = 19/220 (8%)
 Frame = +1

Query: 148  LEYVPKH--GFSERSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKR 321
            L+ VP++  G +  S+V + + L   SS VSS  AS+     HS+  V E    Q++++ 
Sbjct: 1092 LQLVPRNIIGPNILSVVSTRSSLSSVSSSVSSSRASSR----HSTITVDE----QMIEE- 1142

Query: 322  YRLTEGINPDVTSRYKLP------SLEHLLLKRL--EMDKLIGGQLADLMSQLAVPSRLL 477
            Y LT+ +  + TS   LP          LL KR   +M++L+ G  + ++   A     +
Sbjct: 1143 YELTK-MPTNTTSSISLPLPLLSLGTSSLLTKRNINDMERLVAGYRS-MVGLAANTGGFV 1200

Query: 478  FETAIPELHRLSDDMIYFSNEED------HHD-SAWYAKRLAVSS--TYIGSKLFMAQDK 630
             ET +  L +    +I  +  +       H+D +      L VS   + I SKLF++   
Sbjct: 1201 PETNLGVLLQAWSGLIAAAGTQAPPRNLVHNDLNLAELNPLEVSKQLSLIESKLFLSITA 1260

Query: 631  SHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTV 750
            S    E F   K  LH+   +G   + T   + Y + S V
Sbjct: 1261 SELLHENFMPKKAHLHQASNVGAILSFTNLLSRYVVESIV 1300

>CAGL0M09449g Chr13 complement(938424..941660) [3237 bp, 1078 aa]
           {ON} similar to uniprot|P38167 Saccharomyces cerevisiae
           YBL101c involved in cell wall biogenesis and
           architecture
          Length = 1078

 Score = 31.2 bits (69), Expect = 3.5
 Identities = 21/73 (28%), Positives = 36/73 (49%)
 Frame = +1

Query: 82  LHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPSSMVSSIGASNSPS 261
           +++ P+ +    P+   L  A + Y  K G   R+I  S+ + G   S +S IG  N P 
Sbjct: 402 VYLLPVIFSNHIPESTYLPSARISYKLKIG--TRAIGSSIKRAGSTGSSLS-IGQQNQPI 458

Query: 262 FFHSSTAVMELVK 300
             HSST+ +  ++
Sbjct: 459 SSHSSTSSLSSLR 471

>KLTH0G06402g Chr7 complement(507209..510427) [3219 bp, 1072 aa]
           {ON} highly similar to uniprot|Q05549 Saccharomyces
           cerevisiae YDR291W Hypothetical ORF
          Length = 1072

 Score = 30.8 bits (68), Expect = 4.6
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 6/84 (7%)
 Frame = +1

Query: 391 LLKRLEMDKLIGGQLADLMSQLAVPSR------LLFETAIPELHRLSDDMIYFSNEEDHH 552
           LLK+LEM +L   Q   ++S + +P R      L FE A PE     +   ++S++ D  
Sbjct: 238 LLKKLEMSELYNNQ---IVSHMIIPERSAHYGELNFELA-PEAMAAFEHDSFYSHQADAI 293

Query: 553 DSAWYAKRLAVSSTYIGSKLFMAQ 624
           +S    K + V+++    K F+ Q
Sbjct: 294 NSIHEGKNVIVTTSTSSGKSFIYQ 317

>ZYRO0A06952g Chr1 (565557..566516) [960 bp, 319 aa] {ON} no
           similarity
          Length = 319

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 18/74 (24%)
 Frame = -3

Query: 280 LWKSGKTRVSWRHLLK---RP---------WKRDSQVYSRTQL*IF------QKSHVWEH 155
           +WK    R   RH LK   RP          KRDS++ + T++  F       KSH    
Sbjct: 66  IWKRRNLRFQQRHQLKPLIRPNRRQDRTPHLKRDSKLSTETKMSNFGEYIKDMKSHGHTQ 125

Query: 154 ILVELRIILYIGVT 113
           IL+  R+I  +G+T
Sbjct: 126 ILMRTRVITELGIT 139

>ZYRO0B07832g Chr2 complement(612634..613626) [993 bp, 330 aa] {ON}
           some similarities with uniprot|P53238 Saccharomyces
           cerevisiae YGR058W Hypothetical ORF
          Length = 330

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 10/69 (14%)
 Frame = +1

Query: 61  PIEHVKPLHIKPLTYGKQSPQYKVLSLALLE----------YVPKHGFSERSIVESLNKL 210
           P+  V P    P++YG Q+P    + L   +          Y+P HG S R+   +LN++
Sbjct: 52  PVAVVPP----PVSYGSQNPSTSSIPLPSSQSQIPLRNQYSYIPSHGDSPRAHPPTLNRV 107

Query: 211 GYPSSMVSS 237
             P  + SS
Sbjct: 108 KPPPMVASS 116

>CAGL0K11814g Chr11 complement(1138550..1141576) [3027 bp, 1008 aa]
            {ON} similar to uniprot|Q00816 Saccharomyces cerevisiae
            YDR028c REG1
          Length = 1008

 Score = 30.4 bits (67), Expect = 6.1
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 7/114 (6%)
 Frame = +1

Query: 73   VKPLHIKPLTYGKQSPQYKVLS-----LALLEYVPKHGFSER--SIVESLNKLGYPSSMV 231
            + P ++ P++  + S  +K+ S     +A  +   K  FS R  S+   +NK G  S   
Sbjct: 877  IPPSNVGPISSIEVSKNFKIPSNTAPDVASSDVAIKGSFSPRYNSVKSVINKEGILSDK- 935

Query: 232  SSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLL 393
                 SNSPS   SST +M    F         ++  NPD        SL+ ++
Sbjct: 936  -----SNSPSPQQSSTNIMSKNNFSHSGTGQSFSDNENPDTNKDLSNESLQKMM 984

>NCAS0I02370 Chr9 (446731..447378) [648 bp, 215 aa] {ON} Anc_3.114
           YBR154C
          Length = 215

 Score = 29.6 bits (65), Expect = 7.0
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 12/65 (18%)
 Frame = +1

Query: 265 FHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKL------------PSLEHLLLKRLE 408
           FH ++ V+ +   +LV K  RL+E    ++  RY+L            P   +L LKR E
Sbjct: 135 FHEASLVVNITHHELVPKHIRLSEEEKRELLKRYRLKESQLPRIQRADPVALYLGLKRGE 194

Query: 409 MDKLI 423
           + K+I
Sbjct: 195 VVKII 199

>TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {ON}
           Anc_5.490 YDR398W
          Length = 639

 Score = 30.0 bits (66), Expect = 7.5
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -2

Query: 410 ISNLFKSKCSNEGSLYRDVTSGLIPSVKRYLLSTN*NFTSSMTAVEEWKNEGELEAPIEE 231
           +S L  +K SN+     DV+S +  + +   +++  NF     A++EW+ EG+ E   E+
Sbjct: 330 VSLLISNKSSNKLLYTNDVSSAINYAERSVKVTSGDNFKHVTDAIKEWELEGDEE---EK 386

Query: 230 TMEEG 216
             E+G
Sbjct: 387 KGEDG 391

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 30.0 bits (66), Expect = 7.7
 Identities = 27/113 (23%), Positives = 55/113 (48%)
 Frame = +1

Query: 94  PLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPSSMVSSIGASNSPSFFHS 273
           P   G  SP+Y+  S++     P+   +E+  + +  K  Y  +M S+  +S+  SF+  
Sbjct: 26  PSPSGTNSPKYRKRSIS----PPQMTTTEQLDLLAHTKSHYGKAMPSTSSSSHMTSFYRE 81

Query: 274 STAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKRLEMDKLIGGQ 432
           +   +  ++ ++  K+ RL E  +     + +  SLE L L+ L+ +K +  Q
Sbjct: 82  NIKELNQLQERMFHKKARLDELKDEMADYKERFNSLE-LKLEALKEEKHVKSQ 133

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar
           to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
           Protein required for fermentation at low temperature
          Length = 3006

 Score = 30.0 bits (66), Expect = 8.5
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = -2

Query: 425 PINLSISNLFKSKCSNEGSLYRDVTSGLIPSVKRYLLSTN*NFTSSMTAVEEWKNEGELE 246
           P NL    LF+ +CSN  S+Y       I S +R+ L     FT S+  V    ++G ++
Sbjct: 238 PNNLENDELFEQQCSNRKSMYMRFLPIQI-STRRFSLVLGNRFTPSILVVSAKNSKGIID 296

Query: 245 -APIEETME 222
             P +E ++
Sbjct: 297 LCPPKEKLD 305

>Kpol_1036.23 s1036 (58518..59165) [648 bp, 215 aa] {ON}
           (58518..59165) [648 nt, 216 aa]
          Length = 215

 Score = 29.3 bits (64), Expect = 9.4
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 12/65 (18%)
 Frame = +1

Query: 265 FHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKL------------PSLEHLLLKRLE 408
           FH ++ ++ +   +LV K  RL+E    ++  +Y+L            P   +L LKR E
Sbjct: 135 FHEASLIVNITHHELVPKHIRLSENEKKELLKKYRLKESQLPRIQRADPVALYLGLKRGE 194

Query: 409 MDKLI 423
           + K+I
Sbjct: 195 VVKII 199

>NCAS0H01480 Chr8 complement(284477..285895) [1419 bp, 472 aa] {ON}
           Anc_6.107 YBR214W
          Length = 472

 Score = 29.6 bits (65), Expect = 9.5
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = +1

Query: 217 PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 396
           PS+  +S+ +SNS S  +S+T V        VD         +P  T+  K+PS  +L  
Sbjct: 378 PSNSSASMNSSNSNSHSNSTTNVNYSPLMTSVD---------DPLSTTPSKIPSQPNLFE 428

Query: 397 KRLEMDKLIG-GQLADLMSQLA 459
           K     KLIG   L D++S  A
Sbjct: 429 KEYRTGKLIGVVSLTDIISLFA 450

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,303,727
Number of extensions: 1709055
Number of successful extensions: 4793
Number of sequences better than 10.0: 39
Number of HSP's gapped: 4773
Number of HSP's successfully gapped: 39
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)