Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2657.351ON26026013910.0
YLR201C (COQ9)7.351ON26026012561e-177
Suva_10.2967.351ON26026012301e-173
Smik_12.2607.351ON26026010631e-147
TDEL0C019707.351ON2602618291e-111
NCAS0E028707.351ON2612618241e-111
Kpol_530.307.351ON2602537861e-105
TBLA0E004507.351ON2792607841e-104
CAGL0A03949g7.351ON2682457821e-104
NDAI0E044707.351ON2642507801e-104
ZYRO0F11726g7.351ON2512467621e-102
KNAG0B026207.351ON2652567521e-100
TPHA0F029807.351ON2642487395e-98
KLLA0D12320g7.351ON2502487202e-95
KLTH0H01232g7.351ON2572477003e-92
SAKL0F11396g7.351ON2542556942e-91
Kwal_56.246447.351ON2582476733e-88
KAFR0L014807.351ON2642456701e-87
Ecym_47227.351ON2532586552e-85
ACL147W7.351ON2462506264e-81
TPHA0M006903.114ON21583664.4
ABR021W2.490ON108438675.5
NDAI0C036405.32ON403129658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.265
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   540   0.0  
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   488   e-177
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   478   e-173
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   414   e-147
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   323   e-111
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   322   e-111
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   307   e-105
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   306   e-104
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   305   e-104
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   305   e-104
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   298   e-102
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   294   e-100
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   289   5e-98
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   281   2e-95
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   274   3e-92
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   271   2e-91
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   263   3e-88
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   262   1e-87
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   256   2e-85
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   245   4e-81
TPHA0M00690 Chr13 complement(130921..131568) [648 bp, 215 aa] {O...    30   4.4  
ABR021W Chr2 (431186..434440) [3255 bp, 1084 aa] {ON} Syntenic h...    30   5.5  
NDAI0C03640 Chr3 (834228..835439) [1212 bp, 403 aa] {ON} Anc_5.3...    30   8.3  

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60
           MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60

Query: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120
           RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS
Sbjct: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120

Query: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180
           RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180

Query: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240
           EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE
Sbjct: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNLVKSQLARG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  488 bits (1256), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 229/260 (88%), Positives = 247/260 (95%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60
           M CRN AR GCKF RLYHSNPIEHVKP+HIKPLTYGK+SPQYKVLSLAL ++VP+HGFSE
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120
           RSIVESLN+LGYPSSM+SSIGA NSPSFFHSSTAVMEL+KFQLVDKRYRLTEGINPDVT 
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120

Query: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180
           +YKLPSLEHLLLKRLEMDK IGG L++LMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240
           +DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSH++KETF FAK+KLH+VMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNL+KSQL RG
Sbjct: 241 FAWYTLMSTVNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  478 bits (1230), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/260 (88%), Positives = 239/260 (91%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60
           MF RN  R      RLYHSNPIEHV PLHIKPL YGKQSPQYKVLSLAL EYVPKHGF+E
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60

Query: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120
           RSIVESLNKLGYPSSM+SSIGASNSPSF HSSTAVMEL+KFQLVDKRYRLTEGINPDVT 
Sbjct: 61  RSIVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120

Query: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180
            YKLPSLEHLLLKRLEMDK +G QL DLMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240
           +DHHDSAWYAKRLAVSSTYIGS+LFMAQDKSHDF ETFAFAK+KLH+VMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNLVKSQLARG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  414 bits (1063), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 223/260 (85%), Positives = 240/260 (92%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60
           M CRN+ R GC   RLYH NPIEHVK  HIKPLTYGK+SPQYKVLSLAL +YVPKHGFSE
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120
           RSIVESLN+LGYPSSM+SSI ASNSPSFFHSSTAVMEL+KFQLVDKRYRLTE INPDVT 
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTP 120

Query: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180
           +YKLPSLEHLLL+RLEMDK IGG L++LMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240
           +DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSH++K+TF FAK KL++VMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           FAWYTLMSTVNLVKSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLVRG 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  323 bits (829), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/261 (61%), Positives = 202/261 (77%), Gaps = 2/261 (0%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIK-PLTYGKQSPQYKVLSLALLEYVPKHGFS 59
           M  + +      F R Y     E++ P++ + PL YGK SPQYKVLS  L + VP +GF+
Sbjct: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60

Query: 60  ERSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVT 119
           ER+IV SLN+LGYPS+M+S IG+SN PSFFHSS A+MEL+KF LVDKR  LTE I+ + T
Sbjct: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-T 119

Query: 120 SRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSN 179
              +LPSLEHL++KRLEM+  +   L+ L+SQL++P   L + ++PELHRLSDDMIYFS 
Sbjct: 120 PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179

Query: 180 EEDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTE 239
           E+DH+D AWY+KRLAVS  Y+ S+LFMAQD+S D+KETF FA+EKLH+V  LGEYYNNTE
Sbjct: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239

Query: 240 EFAWYTLMSTVNLVKSQLARG 260
           EFAWYTL+ST+NLVKSQLARG
Sbjct: 240 EFAWYTLLSTINLVKSQLARG 260

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  322 bits (824), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/261 (61%), Positives = 204/261 (78%), Gaps = 1/261 (0%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60
           M  R++ + G   +R YH +  E+VKP  + PLTY K+S QYK+LS AL ++VPKHGF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHS-STAVMELVKFQLVDKRYRLTEGINPDVT 119
           ++I +SLN+LG+ SS++S IGASNSP+ F S S AVMEL+KFQLV KRY LTE + PD T
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 120 SRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSN 179
            + +LPSLE LLLKRLEMDK IG Q+  L ++LA PS  LF+ A+PELHRLSDDMIYFSN
Sbjct: 121 PKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180

Query: 180 EEDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTE 239
           E+DHHD AWY KRL VS  Y+ SKL+MAQD S DF++T +FAK+KLH++M+LGEYYNNTE
Sbjct: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240

Query: 240 EFAWYTLMSTVNLVKSQLARG 260
           E+AWY  M + NLV+++LAR 
Sbjct: 241 EYAWYMFMVSTNLVRARLARS 261

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 195/253 (77%), Gaps = 1/253 (0%)

Query: 8   RNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESL 67
           R      R YH NP E+V  L + PL YGK S QYK+LS +L   VP+ GF+ER+IV S+
Sbjct: 9   RTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSI 68

Query: 68  NKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSL 127
           N LGYPSS++S IG+SN+PSF HSSTA+MEL+KF LV KRY+L+E I  D T   +LPSL
Sbjct: 69  NLLGYPSSILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSL 127

Query: 128 EHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSA 187
           E LL+KRL+MD  IG  L+ L++QL++P   L +T++PELHRL+DDMIYFS+E+DH D A
Sbjct: 128 EDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFA 187

Query: 188 WYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLM 247
           WYAKR+ VS+ Y+ SKLFMAQD+S  + +TF FAK+KL ++M+LG+YYNN EE+AWY LM
Sbjct: 188 WYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLM 247

Query: 248 STVNLVKSQLARG 260
           +++N+ KS+ ARG
Sbjct: 248 NSINMAKSKAARG 260

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  306 bits (784), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/260 (56%), Positives = 198/260 (76%), Gaps = 6/260 (2%)

Query: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60
           +  +++  NG    R Y+S   +  K  H++PL YGK S QY++L  A+   VP  GF+E
Sbjct: 26  LLSKHIKNNGI---RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTE 82

Query: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120
           R+I+ S+NKLGY SSM+S +G+SN+ +  HSS AV+EL+KF LV KR +L+EGI+P+   
Sbjct: 83  RAIINSINKLGYNSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKD 142

Query: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180
              LPSLE+LLLKRL+MDK I  +L +++++L++P   L ET+IPEL RLSDDMIYFSNE
Sbjct: 143 ---LPSLEYLLLKRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNE 199

Query: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240
           +DHHD AWY+KRLAVS+TYI S++FMAQD S D  +T  FA++KL+KVM LGEYYNNTEE
Sbjct: 200 KDHHDMAWYSKRLAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEE 259

Query: 241 FAWYTLMSTVNLVKSQLARG 260
           F W+TLM++VN+VKSQLAR 
Sbjct: 260 FLWFTLMTSVNIVKSQLARS 279

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/245 (58%), Positives = 185/245 (75%), Gaps = 1/245 (0%)

Query: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74
           R YH    E+V P   +PLTY  +SP++K+LS  +   VP+HGF+E++IV SLN +  PS
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 134
            M+++IGASNS +F HSS AVMEL+KFQLV+KR+R+ EGI  ++    KLPSLE LLLKR
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEASKLPSLESLLLKR 142

Query: 135 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 194
           L+MD  I   L  + +QL VPS  +   ++PEL RL+DDMIY+SNE+DHHD AWY KR A
Sbjct: 143 LKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAA 202

Query: 195 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           +++TY+ SK FMAQDKSH+F ET  FA++KLHKVM LG+YYNN EEF W+TLMS VNL K
Sbjct: 203 LATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTK 262

Query: 255 SQLAR 259
           SQ+AR
Sbjct: 263 SQMAR 267

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  305 bits (780), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 147/250 (58%), Positives = 192/250 (76%), Gaps = 2/250 (0%)

Query: 13  FHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGY 72
            +R +HSN +E+ K   + PLTY K S QYK+LS AL ++VPK GF++ +I  SLN+L  
Sbjct: 15  INRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDL 74

Query: 73  PSSMVSSIGASNSPSFFHS-STAVMELVKFQLVDKRYRLTEGINPDV-TSRYKLPSLEHL 130
            SS+ S +G+SNSPS F S S AVMEL+KFQLV KRY+LTE I P + T++ KLPSLE L
Sbjct: 75  SSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETL 134

Query: 131 LLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYA 190
           L++RL+MD+ +  QL+ L +QL +PS LLF  A+PEL  LSDD+IYFSNE+DHHD AWYA
Sbjct: 135 LIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYA 194

Query: 191 KRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTV 250
           KRL VS  Y+ SKL+M ++   +F +T  FAK+KLH++M LGEYYNNTEE+AWYTLM ++
Sbjct: 195 KRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSM 254

Query: 251 NLVKSQLARG 260
           NLVK++LARG
Sbjct: 255 NLVKARLARG 264

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  298 bits (762), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 188/246 (76%), Gaps = 5/246 (2%)

Query: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74
           R YH +  EH+    + PL YG  SPQY VLS AL   VP  GF+ER+IV SLN+L YPS
Sbjct: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70

Query: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 134
           +M+S IGASNSPS  HSS AVMELVKF LV KR +L++    D++S  K PSLE L +KR
Sbjct: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK-PSLEDLFIKR 125

Query: 135 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 194
           LE++  I G L+ L+S ++VP     +TA+PELHRLSDD+IY+SNE+DHHD AWY+KRL 
Sbjct: 126 LELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRLG 185

Query: 195 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           +S  Y+ S+LFMAQDKSH+++ETF FA++KL + M+LGEYYNNTEE+ WYTL++++NL K
Sbjct: 186 ISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLAK 245

Query: 255 SQLARG 260
           SQ+ARG
Sbjct: 246 SQMARG 251

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  294 bits (752), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/256 (55%), Positives = 186/256 (72%), Gaps = 1/256 (0%)

Query: 5   NVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIV 64
           +V+R      RLYH NPIE+     + PLTY   SPQ ++L+  L   VP  GF+ER+++
Sbjct: 9   SVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALL 68

Query: 65  ESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINP-DVTSRYK 123
           +S+  +GY SSM+S +GASNSPS FHSS AVMELVKF LV KR+ LTE +    + S   
Sbjct: 69  KSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAA 128

Query: 124 LPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDH 183
           LPSLEHLL+KRL+MD  +  QL DL +QLA+PS+ +   A+PEL RLSDDMIYFSNE+DH
Sbjct: 129 LPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDH 188

Query: 184 HDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAW 243
            D+AWY+KRL VS  Y  SKLFMAQD S + ++T  FA++KLH++M LGEYYNN EE+AW
Sbjct: 189 FDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAW 248

Query: 244 YTLMSTVNLVKSQLAR 259
           Y++M+TVN  K+  +R
Sbjct: 249 YSIMTTVNRAKAGFSR 264

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  289 bits (739), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 148/248 (59%), Positives = 191/248 (77%), Gaps = 2/248 (0%)

Query: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLN--KLGY 72
           R +H    E+V P  + P TY K SPQ+K+LS A+   V K GFSER+I+E++   K+  
Sbjct: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76

Query: 73  PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 132
            S+M+S+IG+SNSPSF HSS +VMEL+KF LV KRYR+ EG++P    + +LPSLE LLL
Sbjct: 77  QSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSLESLLL 136

Query: 133 KRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKR 192
           KRLEMD  IG  ++  MSQL +P   L ++A+PELHRL+DDMIYFSNE+DHHD AWY+KR
Sbjct: 137 KRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKR 196

Query: 193 LAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNL 252
           L VSS YI SKLFMAQD S ++KET  FAK+KL KVMRLG+YYNNTEE+AWY L+++VN+
Sbjct: 197 LGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNM 256

Query: 253 VKSQLARG 260
           VKS+++R 
Sbjct: 257 VKSRMSRA 264

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  281 bits (720), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 190/248 (76%), Gaps = 2/248 (0%)

Query: 13  FHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGY 72
           F RLYH N +EH  P  IKPLTYG  S Q+KVLS AL ++VP++GF+ER+IV+SLN+LG 
Sbjct: 5   FTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGM 64

Query: 73  PSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLL 132
            SS +S +G+SNSPSFF+ S +V+ELVKF LV KR +L   +  D  S   LP L+ L L
Sbjct: 65  GSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLD--SDKPLPDLKTLFL 122

Query: 133 KRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKR 192
           +RL++++ +   L+ L+S ++VP   L  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR
Sbjct: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182

Query: 193 LAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNL 252
           +A+S+ Y+ S+LFMAQDKSH+F+ET  FA+ KL+KV +LG  YNNTEE+ W+TL+S++NL
Sbjct: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242

Query: 253 VKSQLARG 260
            KSQ+ RG
Sbjct: 243 AKSQITRG 250

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  274 bits (700), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 180/247 (72%), Gaps = 1/247 (0%)

Query: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74
           RLYH + +EH       PLTYG  S Q+KVL  AL ++VP +GF+ER++V SLN L    
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSR-YKLPSLEHLLLK 133
           S++S IGASNSPSF ++S AV+EL+KF LV KRY LT+ ++P  TS   + P+LE L  +
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 134 RLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRL 193
           RLE++K I   L  L+S L++P   L +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 194 AVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLV 253
           A+S  ++ S+LFMAQD+S ++ +TF FA EKLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 254 KSQLARG 260
           KSQL R 
Sbjct: 251 KSQLTRS 257

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  271 bits (694), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 145/255 (56%), Positives = 187/255 (73%), Gaps = 9/255 (3%)

Query: 6   VARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVE 65
           +AR G      YH N +EH     + PL Y K SPQ+K+L+ AL E VPK+GF+ER++  
Sbjct: 9   IARRG------YHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTS 62

Query: 66  SLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLP 125
           S + LGY SS +S +GASNSPSFF+SS AV+EL+KF LV KRY LT+G+        + P
Sbjct: 63  SCSDLGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV---ADGTLESP 119

Query: 126 SLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHD 185
           SLE+L LKRLEM+K I   L+ L+S LA+P   L E AIPELHRLSDDM+YFSNE DH+D
Sbjct: 120 SLENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHND 179

Query: 186 SAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYT 245
            AWY+KRLA+S+ Y+ S+LFMAQDKS D+++T  FAKEKL  + +LGE YNN EE+AWYT
Sbjct: 180 FAWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYT 239

Query: 246 LMSTVNLVKSQLARG 260
           L+S+++L KSQ+ R 
Sbjct: 240 LLSSISLAKSQMTRS 254

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  263 bits (673), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 173/247 (70%), Gaps = 1/247 (0%)

Query: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74
           R Y  NP+E+     + PL YG QS Q+KVL  AL  +VP +GF+ER++V SLN LG  S
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGIN-PDVTSRYKLPSLEHLLLK 133
            ++SSIGA NSP   +SS AV+ELVKF LV KRY LT+ ++     S  + P+LE L  K
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131

Query: 134 RLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRL 193
           RLE++  I   +  L++ LA+P   L ++A+PELHRLSDDMIYFS E D +D AWY+KR 
Sbjct: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191

Query: 194 AVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLV 253
           A+S  ++ S+LFMAQDKS ++ +TF FA +KLH V +LG+YY NTEE+ WYTL+ +VNL 
Sbjct: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251

Query: 254 KSQLARG 260
           KSQ+ R 
Sbjct: 252 KSQITRS 258

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  262 bits (670), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 181/245 (73%), Gaps = 5/245 (2%)

Query: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74
           RLYH    E+V P  I PLTY   S Q K+LS +L EYVP  GF+E+SI++S+N LGY S
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 134
           SM+S IGASNSPSF HSS AV+EL+K+ LV KR  LT+      T+     +L+ LLLKR
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTK-----DTNDNTTTTLKELLLKR 138

Query: 135 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 194
           LEMD  I  QL  L +QLA P + +F+ ++PEL +L+DDMI+FSNE+DHHD AWY+KRLA
Sbjct: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198

Query: 195 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           VS  Y+ SK+FM QD S++F+ T  FA +K+ +VM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258

Query: 255 SQLAR 259
           SQ +R
Sbjct: 259 SQFSR 263

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  256 bits (655), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 177/258 (68%), Gaps = 9/258 (3%)

Query: 3   CRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERS 62
           C  +   G  F R YH N  E+     ++PL YG+ SPQYKVL+ AL +YVP  GF + +
Sbjct: 5   CHRIMLGG--FRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSA 62

Query: 63  IVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRY 122
           IV++ N+LGY S+++++IGA+NSP+ F+ ST+V ELVKF LV KRY L E        + 
Sbjct: 63  IVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQE 115

Query: 123 KLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEED 182
              +LE L LKRLE +K +G  L +++S LA+P   L  T +PEL +L+DDMIY+S E+D
Sbjct: 116 GTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKD 175

Query: 183 HHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFA 242
            +D AWY+KRLAVS  YI ++LFMA+D S +F+ T  FAK +++++  +G  YNN EEFA
Sbjct: 176 FNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFA 235

Query: 243 WYTLMSTVNLVKSQLARG 260
           W+ L++TVNL +SQL RG
Sbjct: 236 WFQLLTTVNLARSQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  245 bits (626), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 168/250 (67%), Gaps = 8/250 (3%)

Query: 11  CKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKL 70
           C+  RLYH N +EH     ++PL Y + SPQYKVL  AL  +VP  GF+ER+IV +   L
Sbjct: 5   CR--RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDL 62

Query: 71  GYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHL 130
           GY S+++S++ A NSP+  +  +AV+ELVKF LV KR  L      D  ++  + S+E L
Sbjct: 63  GYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALA-----DAAAQGNV-SMEQL 116

Query: 131 LLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYA 190
            L+R+E D+ + GQL  L+S L++P   L  TA+PEL RLSDD+IY+S E+DH D AWY+
Sbjct: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176

Query: 191 KRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTV 250
           KR AV+  Y+ + LFMA+D+S   +ET  FA+ +L +V  LG  YNN EEFAWY L+  +
Sbjct: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236

Query: 251 NLVKSQLARG 260
           NLVKSQL RG
Sbjct: 237 NLVKSQLTRG 246

>TPHA0M00690 Chr13 complement(130921..131568) [648 bp, 215 aa] {ON}
           Anc_3.114 YBR154C
          Length = 215

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 15/83 (18%)

Query: 73  PSSM--VSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKL------ 124
           PS+M  V SI  +   +F H ++ V+ +   +LV K  RL+E    D+  RY+L      
Sbjct: 118 PSAMKLVPSIPPATIETF-HEASLVVNITHHELVPKHIRLSEEEKKDLLKRYRLKESQLP 176

Query: 125 ------PSLEHLLLKRLEMDKLI 141
                 P   +L LKR E+ K+I
Sbjct: 177 RIQRADPVALYLGLKRGEVVKII 199

>ABR021W Chr2 (431186..434440) [3255 bp, 1084 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL092C (BUD2)
          Length = 1084

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 103 LVDKRYRLTEGINPDVTSRYKLPSLEHLLLKRLEMDKL 140
           L+++  R TE +N  VT R+K+ SL  L LK + MD++
Sbjct: 845 LIERYLRETELVNAFVTYRHKISSLNRLDLKPVTMDQI 882

>NDAI0C03640 Chr3 (834228..835439) [1212 bp, 403 aa] {ON} Anc_5.32
           YMR294W
          Length = 403

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 41  QYKVLSLALLEYVPKHGFSE--RSIVESLNKLGYPSSMV------SSIGASNSPSFFHSS 92
           Q K+      E +P++G     RS  ++L    YPS+ +      S+I   N+P      
Sbjct: 25  QPKIFESEGTELLPENGLQNEYRSTNDTLE--LYPSNDIDHQGEKSTIIYENTPDMM--- 79

Query: 93  TAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQL 152
             V E ++ QL  K+Y  T+    D+  + ++   E   LK+ E+DK+   +L D+  + 
Sbjct: 80  -KVAEQLESQL--KKYNATKSTKEDL-RKMQIDKPEISTLKK-ELDKISLQELDDMKRES 134

Query: 153 AVPSRLLFE 161
            +  +LLFE
Sbjct: 135 TMEDKLLFE 143

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,328,393
Number of extensions: 1136296
Number of successful extensions: 3332
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3403
Number of HSP's successfully gapped: 38
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)