Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2647.352ON1141145792e-78
Suva_10.2957.352ON1141145072e-67
Smik_12.2597.352ON1141144882e-64
YLR200W (YKE2)7.352ON1141144821e-63
KAFR0L014907.352ON1071064012e-51
NCAS0E028607.352ON1051033926e-50
TPHA0F029907.352ON1071063918e-50
TDEL0C019607.352ON1071063796e-48
ZYRO0F11748g7.352ON1091063734e-47
TBLA0E004407.352ON1151113674e-46
CAGL0A03971g7.352ON1061003649e-46
Kpol_530.297.352ON1071023613e-45
KLLA0D12298g7.352ON115983562e-44
KNAG0B026107.352ON1191033553e-44
SAKL0F11418g7.352ON1151113554e-44
NDAI0E044607.352ON1061023483e-43
ACL146C7.352ON1071013334e-41
Kwal_56.246487.352ON1131053292e-40
Ecym_47217.352ON1071013266e-40
KLTH0H01210g7.352ON1131043198e-39
TBLA0D046107.186ON117434730.13
TDEL0F041408.287ON158759710.23
Smik_15.93.5ON107758670.86
Suva_10.5737.518ON263398651.8
Suva_9.254na 1ON23439641.9
YDR127W (ARO1)8.287ON158859642.0
Smik_4.3738.287ON158859642.1
TPHA0D042503.492ON629109632.7
Skud_4.3888.287ON158859632.8
Kpol_1033.178.287ON919109633.0
TPHA0E031505.186ON14958623.2
Kpol_1044.137.101ON110367623.7
Suva_2.2908.287ON158861623.7
ZYRO0F14938g8.584ON65538623.9
KLTH0C05346g7.447ON10254604.4
ZYRO0G19404g8.156ON42946614.6
NCAS0B051708.287ON156959624.7
ABL041W2.472ON81822615.0
YOL145C (CTR9)3.5ON107754616.3
KAFR0A080502.5ON45055606.4
Kpol_1058.458.90ON38954607.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.264
         (114 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   227   2e-78
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   199   2e-67
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   192   2e-64
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   190   1e-63
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   159   2e-51
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   155   6e-50
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   155   8e-50
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   150   6e-48
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   148   4e-47
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   145   4e-46
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   144   9e-46
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   143   3e-45
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   141   2e-44
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   141   3e-44
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   141   4e-44
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   138   3e-43
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   132   4e-41
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   131   2e-40
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   130   6e-40
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   127   8e-39
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    33   0.13 
TDEL0F04140 Chr6 (760626..765389) [4764 bp, 1587 aa] {ON} Anc_8....    32   0.23 
Smik_15.9 Chr15 complement(17702..20935) [3234 bp, 1077 aa] {ON}...    30   0.86 
Suva_10.573 Chr10 (998844..1006745) [7902 bp, 2633 aa] {ON} YLR4...    30   1.8  
Suva_9.254 Chr9 complement(408977..409681) [705 bp, 234 aa] {ON}...    29   1.9  
YDR127W Chr4 (704484..709250) [4767 bp, 1588 aa] {ON}  ARO1Penta...    29   2.0  
Smik_4.373 Chr4 (665673..670439) [4767 bp, 1588 aa] {ON} YDR127W...    29   2.1  
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    29   2.7  
Skud_4.388 Chr4 (676254..681020) [4767 bp, 1588 aa] {ON} YDR127W...    29   2.8  
Kpol_1033.17 s1033 (36928..37737,37786..37794,37837..39150,39282...    29   3.0  
TPHA0E03150 Chr5 complement(666045..666494) [450 bp, 149 aa] {ON...    28   3.2  
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    28   3.7  
Suva_2.290 Chr2 (499650..504416) [4767 bp, 1588 aa] {ON} YDR127W...    28   3.7  
ZYRO0F14938g Chr6 complement(1226449..1228416) [1968 bp, 655 aa]...    28   3.9  
KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar...    28   4.4  
ZYRO0G19404g Chr7 complement(1612850..1614139) [1290 bp, 429 aa]...    28   4.6  
NCAS0B05170 Chr2 (959144..963853) [4710 bp, 1569 aa] {ON}              28   4.7  
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...    28   5.0  
YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}  ...    28   6.3  
KAFR0A08050 Chr1 complement(1612166..1613518) [1353 bp, 450 aa] ...    28   6.4  
Kpol_1058.45 s1058 (125362..126531) [1170 bp, 389 aa] {ON} (1253...    28   7.6  

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  227 bits (579), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114
           QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  199 bits (507), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 107/114 (93%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MSELGA+YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQ+ +DTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114
           QSEARGNV+KRLEFIETEIKRCE+NIR KQ+ELE+VRNEL+KLNNA    G +R
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  192 bits (488), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 93/114 (81%), Positives = 105/114 (92%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MSELG +YQHLQ ELEEFIVARQKLETQLQENKIVNEEFDQ+ ++TPVYKLTGNVLLPV+
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114
           QSEARGNVDKRLEFIE EI RCE+NI++KQ++LEKVRN+LIKLNNA A  G +R
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  190 bits (482), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 104/114 (91%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MSELGA+YQ LQ+ELEEFIVARQKLETQLQENKIVNEEFDQ+ +DTPVYKLTGNVLLPVE
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114
           QSEAR NVDKRLEFIETEI RCE+NIR+KQ+ELEK+R+ELIKLNN  A  G  R
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  159 bits (401), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 79/106 (74%), Positives = 90/106 (84%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MSEL A+YQ LQSELEE IVARQKLETQLQENKIVN+EF  + ++T VYKLTGNVLLP+E
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106
           Q EARGNVDKRLEFIE EI RCE NI+ KQ E+E +RNEL+KL + 
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSG 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  155 bits (392), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 93/103 (90%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           M++L A+YQ LQSELE FI+ARQKLETQLQENKIV +EF+Q+ D+T VYKLTGNVLLPVE
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           Q EAR NV+KRLEFI++EI +CE+NI++KQ+ELEKVR E+IK+
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKM 103

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  155 bits (391), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 92/106 (86%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MS++ A+YQ +Q ELEE I+ARQKLETQLQENKIVN+EF+ + +DTP+YKLTGNV+LP+E
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106
           Q EA+ NV+KRLEFIE EIKRCE NI+ KQDEL+K+R EL+K+  A
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  150 bits (379), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 76/106 (71%), Positives = 87/106 (82%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MS+L A YQ LQSELE  ++ARQKLETQLQENKIV+EEF ++ +DT VYKLTGNVLLPVE
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106
           QSEA  NV KRLEFI+TEI RCE N++ KQ E EK+R ELIKL  A
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  148 bits (373), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 88/106 (83%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MSEL A+YQ LQ ELE FIVARQKLETQLQENKIV++EF+ +  D+ VYKLTGNVLLPVE
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106
           Q +AR NV KRLEFI+TEI RCE NI+ KQ+E E+V+ ELIKL + 
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  145 bits (367), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%)

Query: 2   SELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQ 61
           +EL  +YQ  Q+ELE FIV RQKLETQLQENKIVN+EF+++ ++T V+KLTGNVLLP+EQ
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  SEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGA 112
            EAR N+DKRLEFI+TEI RCE+NI+ KQ E+EK+R+EL+    A     A
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPAPTPASA 114

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  144 bits (364), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%)

Query: 2   SELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQ 61
           +ELGA+YQ LQ+ELEE + ARQKLETQLQENKIVNEEF  + +DT VYKLTGNVLLPVE 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  SEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELI 101
            +A+ NVDKRLEFI  EIKRCE NIR KQ ELE +R +LI
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  143 bits (361), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 87/102 (85%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MS+L  +YQ +Q ELEE IVAR++LETQLQENKIVNEEF+ + +DT VYKLTGNVLLPVE
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIK 102
           Q EAR NV+KRLEFIE EIK+CE NI+ KQ EL K+R+EL+K
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  141 bits (356), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 80/98 (81%)

Query: 8   YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEARGN 67
           Y  LQ ELEE IVARQKLETQLQENKIV++EF  + DD  VYKLTG VLLPVEQ EA+GN
Sbjct: 10  YTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKGN 69

Query: 68  VDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNN 105
           V+KRLEFIE EIKRCE NI+ KQ ELE  R+EL+KL +
Sbjct: 70  VEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  141 bits (355), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 84/103 (81%)

Query: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60
           MS   A+YQ  QS LEE IVARQKLETQLQENKIV EEFD + +D+ VYKLTG+VLLPV+
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           Q EAR NVDKRLEFI  EI RCE NI+EKQ+ LE +R+EL+KL
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  141 bits (355), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 5/111 (4%)

Query: 1   MSELGAE-----YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNV 55
           M+EL A+     Y  +QSELE+ ++ARQKLETQLQENKIV +EFD + D++ VYKLTG V
Sbjct: 1   MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60

Query: 56  LLPVEQSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106
           LLPVEQ EA+GNV+KRL+FI+ EI RCE NI+EKQ +LE++RNEL++L  A
Sbjct: 61  LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  138 bits (348), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 85/102 (83%)

Query: 2   SELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQ 61
           S L ++YQ LQ ELE+ I+ARQKLETQLQENKIV EEF+Q+  ++ VYKLTGNVLLPV+Q
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  SEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
            EA  NVDKRLEFI+TEI RCE NI+ KQ EL+ VR+E++K+
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  132 bits (333), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%)

Query: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62
           ++  +Y  LQ ELEE +V RQKLETQLQENKIVNEE   +  +T VYKLTG VLLPVEQ 
Sbjct: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64

Query: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           EA GNV KRLEFIE EI+RCE+NI++KQ+E+E  R  L+KL
Sbjct: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKL 105

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  131 bits (329), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 79/105 (75%)

Query: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD + ++T VYKLTG VLLPVEQ 
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNAT 107
           EA+ NV KRLEFI TEIKRCE NI+ KQ  LEK+R EL++   A+
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  130 bits (326), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%)

Query: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62
           ++ A+Y  LQ ELE+ IV RQKLETQLQENKIVNEE   + +D  VYKLTG VLLPVE  
Sbjct: 5   QVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHE 64

Query: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           EA  NV KRLEFI+ EI RCE NI+ KQ ELE+ R+ELIKL
Sbjct: 65  EANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKL 105

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  127 bits (319), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 78/104 (75%)

Query: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62
           +L   Y   Q ELEE ++ARQKLETQLQENKIV +EFD + ++T VYKLTGNVLLPVEQ 
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106
           EA+ NV KRLEFI  EI RCE NI+ KQ  LEK+R EL++   A
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 25/34 (73%)

Query: 70  KRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           KR E I  EIK CE +I ++Q++LE ++N +I++
Sbjct: 749 KRNEAISLEIKSCENSITQEQNKLESIQNSIIQI 782

>TDEL0F04140 Chr6 (760626..765389) [4764 bp, 1587 aa] {ON} Anc_8.287
           YDR127W
          Length = 1587

 Score = 32.0 bits (71), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEAR 65
           E ++ +  +++F+      E + QE+KI NE  ++ GDD  V+   G +   VE S+AR
Sbjct: 923 EKRYGKGSVKDFVAEHGWDEFRAQESKIFNEVIEKHGDDGYVFSTGGGI---VESSDAR 978

>Smik_15.9 Chr15 complement(17702..20935) [3234 bp, 1077 aa] {ON}
           YOL145C (REAL)
          Length = 1077

 Score = 30.4 bits (67), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 19  IVARQKLETQLQENKIVNEEF---DQIGDDTPVYKLTGNVLLPVEQSEARGNVDKRLE 73
           +  RQ L  + +E+++   E    D IG D P +   GN+L  VE    RG+ DK LE
Sbjct: 105 LAKRQSLSVETKEHELTQAELNLKDAIGFD-PTW--IGNMLATVELYYQRGHYDKALE 159

>Suva_10.573 Chr10 (998844..1006745) [7902 bp, 2633 aa] {ON} YLR454W
            (REAL)
          Length = 2633

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 11   LQSELEEFIVARQKLETQLQENKI---VNEEFDQIGDDTPVYKLTGNVLLPVEQSEARGN 67
            L++   + I+   K+ T L   KI          I DD    +L  N +  +   E R  
Sbjct: 1030 LKTSKNDLIIFPHKIGTPLSMPKIKLKSKRWLFSIADDPLEAEL--NTIFQIGLQEQRER 1087

Query: 68   VDKRLEF---IETEIKRCERNIREKQDELEKVRNELIK 102
            + K  EF   I   + + ++N++E +D+ E V NE++K
Sbjct: 1088 LTKLREFNKRISENLIKSQKNVKEVKDDFEAVDNEILK 1125

>Suva_9.254 Chr9 complement(408977..409681) [705 bp, 234 aa] {ON}
           YIR038C (REAL)
          Length = 234

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 43  GDDTPVYKLTGNVLLPVEQSEARGNVDKRLEFIETEIKR 81
           G   P+  L G V   + Q+ + G +  +L+F+E EIK+
Sbjct: 131 GMPFPISYLAGKVADKISQAYSSGEMKNQLDFLEAEIKK 169

>YDR127W Chr4 (704484..709250) [4767 bp, 1588 aa] {ON}
           ARO1Pentafunctional arom protein, catalyzes steps 2
           through 6 in the biosynthesis of chorismate, which is a
           precursor to aromatic amino acids
          Length = 1588

 Score = 29.3 bits (64), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEAR 65
           E QH    +++F+V     + + +E +I  E     GDD  V+   G +   VE +E+R
Sbjct: 924 EQQHNNQSVKQFVVENGWEKFREEETRIFKEVIQNYGDDGYVFSTGGGI---VESAESR 979

>Smik_4.373 Chr4 (665673..670439) [4767 bp, 1588 aa] {ON} YDR127W
           (REAL)
          Length = 1588

 Score = 29.3 bits (64), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEAR 65
           E QH    +++F+V     + + +E +I  E     GDD  V+   G +   VE +E+R
Sbjct: 924 EQQHDNQSVKQFVVQNGWEKFREEETRIFKEVIQNYGDDGYVFSTGGGI---VESAESR 979

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 8/109 (7%)

Query: 8   YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEARGN 67
           Y   + E E+ +V  QK    ++E K ++    Q   +   Y+L  NVL      +++ N
Sbjct: 363 YNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVL----DVQSKYN 418

Query: 68  VDKRLEFIETEIKRCERNIREKQDELEK---VRNELIKLNNATAVVGAE 113
           VDK     ETE+ + ++ I  K+D L K   V+NE+ KLNN    +  E
Sbjct: 419 VDKGKVIKETELMKLQK-INAKEDLLAKQLDVKNEIEKLNNEKEAITNE 466

>Skud_4.388 Chr4 (676254..681020) [4767 bp, 1588 aa] {ON} YDR127W
           (REAL)
          Length = 1588

 Score = 28.9 bits (63), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEAR 65
           E QH    +++F+V     + + +E +I  E  +  GDD  V+   G +   VE  E+R
Sbjct: 924 EQQHDNKSVKQFVVENGWEKFREEETRIFKEVVENYGDDGYVFSTGGGI---VESPESR 979

>Kpol_1033.17 s1033
           (36928..37737,37786..37794,37837..39150,39282..39908)
           [2760 bp, 919 aa] {ON}
           (36928..37737,37786..37794,37837..39150,39282..39908)
           [2760 nt, 920 aa]
          Length = 919

 Score = 28.9 bits (63), Expect = 3.0,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 16/109 (14%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEA-- 64
           E +H    ++EF+      E + QE ++  E  D+ GD   V+   G ++   +  EA  
Sbjct: 297 EERHNNQTVKEFVSENSWEEFRKQETELFKEMIDKYGDSGYVFSTGGGIVEGTQSREALK 356

Query: 65  ------------RGNVDKRLEFIETEIKRCE--RNIREKQDELEKVRNE 99
                         ++D+ + F+E++  R      IR   +  EK  NE
Sbjct: 357 GFAAAGGVVLHLHRDIDETIIFLESDPTRPAYVEEIRSVWNRREKWYNE 405

>TPHA0E03150 Chr5 complement(666045..666494) [450 bp, 149 aa] {ON}
           Anc_5.186 YGR174C
          Length = 149

 Score = 28.5 bits (62), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 38/58 (65%), Gaps = 8/58 (13%)

Query: 47  PVYKLTGNVLLPVEQS-EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           P++K TG+++ P E++ E + + ++R  F   ++K  E     ++DEL+K+R+EL +L
Sbjct: 76  PIWK-TGSIVSPWERADEGKNDPNQRYAF--QKLKSSEV----QKDELKKIRDELQQL 126

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 13/67 (19%)

Query: 44  DDTPVYKLTGNVLLPVEQSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103
           DDT  YK   +VL P  + +           IE EI    R+I++++DE++ + NE  KL
Sbjct: 649 DDTIYYK--ASVLTPENKKK-----------IEDEIAGLGRDIQKEKDEIKNIENENTKL 695

Query: 104 NNATAVV 110
           N+   V+
Sbjct: 696 NDEIVVI 702

>Suva_2.290 Chr2 (499650..504416) [4767 bp, 1588 aa] {ON} YDR127W
           (REAL)
          Length = 1588

 Score = 28.5 bits (62), Expect = 3.7,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 28/61 (45%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEARG 66
           E QH    +++F+V     + + +E +I  E     GDD  V+   G ++   E  +A  
Sbjct: 924 EQQHGNQSVKQFVVENGWEKFREEETRIFEEVIKNYGDDGYVFSTGGGIVESPESRKALN 983

Query: 67  N 67
           N
Sbjct: 984 N 984

>ZYRO0F14938g Chr6 complement(1226449..1228416) [1968 bp, 655 aa]
           {ON} similar to uniprot|P15179 Saccharomyces cerevisiae
           YPL104W Mitochondrial aspartyl-tRNA synthetase, required
           for acylation of aspartyl-tRNA; yeast and bacterial
           aspartyl-, asparaginyl-, and lysyl-tRNA synthetases
           contain regions with high sequence similarity,
           suggesting a common ancestral gene
          Length = 655

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 3/38 (7%)

Query: 6   AEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIG 43
            EY++LQ  L +F   +Q L+T+ Q +K + ++FD++G
Sbjct: 161 PEYRYLQLRLPKF---QQFLQTRYQLSKALRQKFDELG 195

>KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar
          to uniprot|P47128 Saccharomyces cerevisiae YJR082C EAF6
          Esa1p-associated factor subunit of the NuA4
          acetyltransferase complex
          Length = 102

 Score = 27.7 bits (60), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 1  MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGN 54
          M E    YQ L+ EL+E +V R+ LE Q   ++I  E FD+       Y LTGN
Sbjct: 1  MDEAHQHYQKLKQELQEALVDRETLEKQW--DQIQQEIFDK----ESAY-LTGN 47

>ZYRO0G19404g Chr7 complement(1612850..1614139) [1290 bp, 429 aa]
          {ON} similar to uniprot|P53095 Saccharomyces cerevisiae
          YGL196W Hypothetical ORF
          Length = 429

 Score = 28.1 bits (61), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 24 KLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEARGNVD 69
          +    ++ +K     F Q+G D P  K T N +L     EA G +D
Sbjct: 51 RFRAHVKTHKTAQGTFKQLGFDLPASKTTSNAILISTIREAHGLLD 96

>NCAS0B05170 Chr2 (959144..963853) [4710 bp, 1569 aa] {ON} 
          Length = 1569

 Score = 28.5 bits (62), Expect = 4.7,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 7   EYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQSEAR 65
           E Q+ +  +++F+      + + +E +I  E  D  GDD  V+   G +   VE  EAR
Sbjct: 905 EEQYKKGTIKDFVAEHGWDKFRQEETRIFKEVIDHYGDDGYVFSTGGGL---VETPEAR 960

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%)

Query: 81  RCERNIREKQDELEKVRNELIK 102
           RCE+ +REK +ELEKV   L+K
Sbjct: 735 RCEKLLREKSEELEKVAQLLMK 756

>YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}
           CTR9Component of the Paf1p complex involved in
           transcription elongation; binds to and modulates the
           activity of RNA polymerases I and II; required for
           expression of a subset of genes, including cyclin genes;
           involved in SER3 repression by helping to maintain SRG1
           transcription-dependent nucleosome occupancy; contains
           TPR repeats
          Length = 1077

 Score = 28.1 bits (61), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 23  QKLETQLQENKIVNEEF---DQIGDDTPVYKLTGNVLLPVEQSEARGNVDKRLE 73
           Q L  + +E+++   E    D IG D P +   GN+L  VE    RG+ DK LE
Sbjct: 109 QSLSVETKEHELTQAELNLKDAIGFD-PTW--IGNMLATVELYYQRGHYDKALE 159

>KAFR0A08050 Chr1 complement(1612166..1613518) [1353 bp, 450 aa]
          {ON} Anc_2.5 YNL239W
          Length = 450

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 30 QENKIVNEEFDQIGDDTPVY--KLTGNVLLPVEQSEARGNVDKRLEFIETEIKRC 82
          Q+N++ N   D   D TPV   + +G   L    ++ RGNV K L   E EI + 
Sbjct: 46 QDNRVFNISLDD--DTTPVTNQRASGRCWLFAATNQLRGNVIKNLNLKEFEISQA 98

>Kpol_1058.45 s1058 (125362..126531) [1170 bp, 389 aa] {ON}
           (125362..126531) [1170 nt, 390 aa]
          Length = 389

 Score = 27.7 bits (60), Expect = 7.6,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 54  NVLLPVEQSEARGNVDKRLEFIETEIKR----CERNIREKQDELEKVRNELIKL 103
           + L+ +E+SE    +DK +E +E + KR    C+   R+   + EK RN+ +KL
Sbjct: 336 DALIEMEESERNDALDKSVESLEEDYKRILSLCKFGKRDPSFDDEKHRNKKVKL 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.131    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,828,158
Number of extensions: 495199
Number of successful extensions: 3262
Number of sequences better than 10.0: 284
Number of HSP's gapped: 3234
Number of HSP's successfully gapped: 320
Length of query: 114
Length of database: 53,481,399
Length adjustment: 84
Effective length of query: 30
Effective length of database: 43,849,455
Effective search space: 1315483650
Effective search space used: 1315483650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)