Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.2637.353ON27427414350.0
Suva_10.2947.353ON27527512471e-175
Smik_12.2587.353ON27427411801e-165
YLR199C (PBA1)7.353ON27627411791e-164
NCAS0E028507.353ON2812826852e-89
KAFR0L015007.353ON2792816782e-88
Kpol_530.287.353ON2742786755e-88
TDEL0C019507.353ON2732766712e-87
TPHA0F030007.353ON2822836662e-86
ZYRO0F11770g7.353ON2722756233e-80
NDAI0E044507.353ON2212235577e-71
KNAG0B026007.353ON2792815541e-69
CAGL0A03993g7.353ON2722805495e-69
SAKL0F11440g7.353ON2722824592e-55
TBLA0E020707.353ON2522854311e-51
KLTH0H01188g7.353ON2672833817e-44
Kwal_56.246507.353ON2522603067e-33
KLLA0D12276g7.353ON2582782929e-31
Ecym_47207.353ON2612762282e-21
ACL145W7.353ON2342451885e-16
TPHA0D044601.135ON812197693.5
TDEL0B054101.468ON74045683.9
Suva_15.2001.355ON39043674.9
NDAI0K025804.150ON98531668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.263
         (274 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   557   0.0  
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   484   e-175
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   459   e-165
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   458   e-164
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   268   2e-89
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   265   2e-88
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   264   5e-88
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   263   2e-87
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   261   2e-86
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   244   3e-80
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   219   7e-71
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   218   1e-69
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   216   5e-69
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   181   2e-55
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   170   1e-51
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   151   7e-44
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   122   7e-33
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   117   9e-31
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    92   2e-21
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    77   5e-16
TPHA0D04460 Chr4 complement(964925..967363) [2439 bp, 812 aa] {O...    31   3.5  
TDEL0B05410 Chr2 (960929..963151) [2223 bp, 740 aa] {ON} Anc_1.4...    31   3.9  
Suva_15.200 Chr15 (347171..348343) [1173 bp, 390 aa] {ON} YHR017...    30   4.9  
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    30   8.4  

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/274 (100%), Positives = 274/274 (100%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
           KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120

Query: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180
           PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK
Sbjct: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180

Query: 181 SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC 240
           SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC
Sbjct: 181 SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC 240

Query: 241 SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  484 bits (1247), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 230/275 (83%), Positives = 253/275 (92%), Gaps = 1/275 (0%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWNDLPEPRHQLDFPEISKNLQSLE CP+P+VELPQDL+VSQYS V+ITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETS-KETQYNFS 119
           KNLL+L SIGE+K+SL VK  +P Q TDA+SWNYDENFPNE++P S + TS +ET YNFS
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120

Query: 120 FPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179
           FPIYSFG+TLLFSIEENFINISPIFGNMISRSI SQL+KTSPD+I+IG+SDRISNMK MT
Sbjct: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180

Query: 180 KSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDV 239
           + ECTLQPPEF+TGFIGSVLTQLI G NKGM FKCL+VPSEGPNGFEK SLSDMGSLIDV
Sbjct: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240

Query: 240 CSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           CSQW G DHSKYS+EC+RLWRCDSAAIGAQSGLYI
Sbjct: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  459 bits (1180), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 210/274 (76%), Positives = 248/274 (90%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWN++PEPRH LDFPEISKNL SLE CP+P+VELPQDL+VSQYSTV+ITTKIMNPLFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
           KNLLQL ++G+++++LTV NS   QST  +SWN+DENFPNEVDP+     S ET+Y+FSF
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120

Query: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180
           PIYSFG+TLLFSIEENF++ISPIFGNMISR IVS+L+++SP+IIVIG+SD+I+NMK MTK
Sbjct: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK 180

Query: 181 SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC 240
            EC+L+PPEFITGFIGSVLTQL+ G NKGM FKCL+VPSEGPNG+EK+SLSDMGSL+ +C
Sbjct: 181 DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC 240

Query: 241 SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
            QWLGFDHS Y +ECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  458 bits (1179), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 214/274 (78%), Positives = 250/274 (91%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWNDLPEP+H LD PEISKNLQSLE CP+P+VE PQDL+V QYST +ITTKIMNPLFP
Sbjct: 3   FKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFP 62

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
           KNLLQLTSIGE+K++LTVK+ S  QS+  +SWNYDENFPNEVDP  +++T+ ET Y FSF
Sbjct: 63  KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSF 122

Query: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180
           PIYSFG+TLLFS+EENFI+ISPIFGNMISRSI+SQL + SPDIIVIG+SD+I++MK MT+
Sbjct: 123 PIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTE 182

Query: 181 SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC 240
           +ECTLQPPEFITGFIGSVLTQLI+G +KG+ FKCL+ PSEGPNGFEK+SLSDMGSL+D+C
Sbjct: 183 NECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLC 242

Query: 241 SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
            QWLGF+ S+YS+ECYRLWRCDSAAIGAQSGLYI
Sbjct: 243 GQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  268 bits (685), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 195/282 (69%), Gaps = 11/282 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWN+  EPRHQLDFP +SKN +SL+  PIP+V  P  +    Y  +IITT++MNPLFP
Sbjct: 3   FKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPLFP 61

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
           + L++  ++G++++ LT+       + D +SWN++ENFPNE DP +E   +++  +NF F
Sbjct: 62  EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAFNFEF 121

Query: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180
           P+++ G+ ++ SI++NF+ ISPIF N+IS+ ++ QL +T   +I +GSSDRI+++K++  
Sbjct: 122 PVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLI-LGSSDRIASVKEIND 180

Query: 181 SECTLQPPEFITGFIGSVLTQLII-------GENKGMNFKCLIVPSEGPNGFEKISLSDM 233
             CTL PPEFITGFI S+LT+L I       GENK   F  ++VPSEGP GFEK++L+ +
Sbjct: 181 HTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNLTVI 239

Query: 234 GSLIDVCS-QWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
             LID+   +W   D   Y++E YR W+   + +GAQSGLYI
Sbjct: 240 QDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  265 bits (678), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 140/281 (49%), Positives = 194/281 (69%), Gaps = 11/281 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWN+L EPRHQLD P I KN +SL+  P+P+VE+P  +N S Y  +I+TTK+MNPLFP
Sbjct: 3   FKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFP 62

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQS-TDAYSWNYDENFPNEVDPISESETSKETQYNFS 119
           KNLL++  +G ++++L +  S  T    + YSW+++ENFPNE +P  ES T     ++F 
Sbjct: 63  KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGN-NNFSFK 121

Query: 120 FPIY--SFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRIS-NMK 176
           FPIY  S  +TLL SI+ENF+ +SPIF N+IS+ + S +      I+++G+SD+IS N+K
Sbjct: 122 FPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNIK 181

Query: 177 KMTKSECTLQPPEFITGFIGSVLTQLI-IGENKGMNFKCLIVPSEGPNGFEKISLSDMGS 235
            +T   C++ PPEFITGFIGS+L +L+ IG +   NF+C+IVPSEGP GFEK+SLS M  
Sbjct: 182 TVTNKNCSINPPEFITGFIGSLLYELLEIGTD---NFECIIVPSEGPIGFEKLSLSTMEE 238

Query: 236 LIDVCSQWLG--FDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           LI+     LG   D   Y  EC+R W+ + +A   QSGLYI
Sbjct: 239 LINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  264 bits (675), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 193/278 (69%), Gaps = 10/278 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWN+   PRH+LD P I++N  SL+   +P V +P+  ++S+Y  V++TTKIM+PLFP
Sbjct: 3   FKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPE-TDLSKYKNVVLTTKIMDPLFP 61

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
             LL    I ++ ++L +  S     ++ +SW+Y+ENFPNEV    + +++     +FS 
Sbjct: 62  SKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVG--FKRDSNNRRLLSFSS 119

Query: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQL-IKTSPDI--IVIGSSDRISNMKK 177
           PI++F +T++  IEENFI +S IF N+I+  +++ L I  +PD+  I IG+SDRI N+KK
Sbjct: 120 PIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRILNIKK 179

Query: 178 MTKSECTLQPPEFITGFIGSVLTQLIIGENKGMN-FKCLIVPSEGPNGFEKISLSDMGSL 236
           +T+  C+L+PPEF+TGFIGS+LTQLI   +K +N F  ++ PSEGP GFEK++L  +  L
Sbjct: 180 LTQDHCSLEPPEFVTGFIGSILTQLI---SKEVNVFTGILAPSEGPIGFEKMTLDVIKEL 236

Query: 237 IDVCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           ID+C + L    ++YS +C R+WR D AAIGAQSGLYI
Sbjct: 237 IDICQELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  263 bits (671), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 132/276 (47%), Positives = 186/276 (67%), Gaps = 7/276 (2%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWN++ EPRHQLD P I  N  +L+   +P+V LP  +++  +S VI+T+ IMNPLFP
Sbjct: 3   FKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLP-PIDLQNFSRVILTSAIMNPLFP 61

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
           + LL+ T +G++K  L + +         +SWN+DENFPNEVDP    E   +T +    
Sbjct: 62  EKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSKT-FELCA 120

Query: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTS--PDIIVIGSSDRISNMKKM 178
           PI SFG TLL S++ENF+  SPIF N I++S+V +L + +   +++V+G+SD+I+ +K +
Sbjct: 121 PIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELKPV 180

Query: 179 TKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLID 238
           +  E TL PPEF+T F+G+V+TQLI    K + F+ LI PSEGP GFEK++L  M  LI 
Sbjct: 181 SDKETTLNPPEFVTSFVGAVITQLI---EKSLPFQGLIAPSEGPVGFEKLNLVTMEELIT 237

Query: 239 VCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           +C QW+  +   Y  ECYR WR D AA+GAQSGLYI
Sbjct: 238 LCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  261 bits (666), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 133/283 (46%), Positives = 188/283 (66%), Gaps = 12/283 (4%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQWNDL EPRHQL  P +S N++SL+   IP V +  +L    +  VI+TTK MN LFP
Sbjct: 3   FKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNALFP 61

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPIS----ESE--TSKET 114
              L LT +GE+ SSL +  +    + + YSW+Y ENFPNEVD  S    ESE  +++  
Sbjct: 62  NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESK 121

Query: 115 QYNFSFPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLI---KTSPDIIVIGSSDR 171
           +YNF  PI ++ +TLL SIEENFI +SPIF N+ +  I+  ++    ++  I+ +G+SDR
Sbjct: 122 KYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181

Query: 172 ISNMKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLS 231
           ++ ++K+T    TL  PEFITGF+GS ++QL+I E    N+K +IVPSEGP GFEK+S+ 
Sbjct: 182 VAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP--NYKAVIVPSEGPIGFEKLSIE 239

Query: 232 DMGSLIDVCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
            +  LID+C + L  +  KYS E +RLW+   +A+GAQ+GLYI
Sbjct: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  244 bits (623), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 118/275 (42%), Positives = 182/275 (66%), Gaps = 6/275 (2%)

Query: 1   FKQWNDLPEPRHQLDFP-EISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLF 59
           FKQWN++ EPRH LD P  +  + +SL+   +P VELP ++N +++  + +TT IM+PLF
Sbjct: 3   FKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELP-NINWNKFHKIFLTTGIMDPLF 61

Query: 60  PKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFS 119
           PK LL +  +G+++++LT+  +   ++ + YSWN++ENFPNEV+     +        F 
Sbjct: 62  PKELLGVMKLGDIRTTLTIDRNQQHENGE-YSWNFEENFPNEVNLNGGQDNDDGQSLTFV 120

Query: 120 FPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179
             + +FG+ LL  ++ENF+ +SPI  N I++ ++S    T  ++ V+G+SDRI+ +K ++
Sbjct: 121 TTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITELKSIS 180

Query: 180 KSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDV 239
                LQPPEF+TGFIGS+LTQL +   K + F+  I PSEG  GFEK+S++ M  LID+
Sbjct: 181 HLRSDLQPPEFVTGFIGSILTQLTV---KNIPFEGFIAPSEGAIGFEKMSMNTMPELIDI 237

Query: 240 CSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           C QW+  +  KY  ECYR WR DS A+G+ SGLY+
Sbjct: 238 CGQWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  219 bits (557), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 158/223 (70%), Gaps = 5/223 (2%)

Query: 55  MNPLFPKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKET 114
           MNPLFP++LL L S+  + ++LT+       +   +SWNY+ENFPNE DP  +   S E 
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEK 60

Query: 115 QYNFSFPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISN 174
            Y+F+FPI++   TL+ SI+ENF+ ISPIF N+IS+++V Q +  + +I+++G+SDR++ 
Sbjct: 61  SYDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLV-QALPLNKEILILGTSDRVAV 119

Query: 175 MKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMG 234
           M+K++    TL+PPEF+TGFIGS++T+L +  N   NF  +IVPSEGP GFEK++L+ M 
Sbjct: 120 MRKISNEIDTLEPPEFVTGFIGSLITELNL-HNAKYNFDAIIVPSEGPTGFEKLNLTIMQ 178

Query: 235 SLIDVC-SQW--LGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
            LID+  ++W  L  D   Y+++CYR W+   AAIGAQSGLYI
Sbjct: 179 DLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  218 bits (554), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 172/281 (61%), Gaps = 11/281 (3%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FK WN+  EPRH LD P +  N +SL+  P+P V +P   +  +        KIMNPLF 
Sbjct: 3   FKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFN 62

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYS--WNYDENFPNEVDPISESETSKETQYNF 118
            +     + GE+ +SL +  S  +Q+    S  W+Y ENFPNE DP S++    ++    
Sbjct: 63  TSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSIV-L 121

Query: 119 SFPIYSFG--ETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMK 176
             PI       TLL S++ENF+ +SPIF N+++R + + L+ T   I+++GSSD+I + K
Sbjct: 122 RLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRT-LLNTQTKILLVGSSDKIYSTK 180

Query: 177 KMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSL 236
            ++ +ECTLQPPEFITGF+G ++ +L+  +N+  NFK  IV SEGP GFEK+SL  M  L
Sbjct: 181 MVSLNECTLQPPEFITGFLGGMIDELV--KNRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238

Query: 237 ID-VCSQWLGF--DHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           ID +  +W  +  +   + + C++LW+ D AA+ AQSGLYI
Sbjct: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  216 bits (549), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 177/280 (63%), Gaps = 16/280 (5%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDL----NVSQYSTVIITTKIMN 56
           FKQWN+L EPR+ LD P +  N +SL+  P+P V +P +L    NV +   VI+TTK M+
Sbjct: 3   FKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKR---VILTTKTMD 59

Query: 57  PLFP-KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQ 115
             F     +++  + ++  SL +  +  T     ++W++ ENFPNEV+P+ + E   +  
Sbjct: 60  TFFLLDKTMKVKKLADITCSLEIPKNLQTHEA-THTWDFGENFPNEVEPLQDEE---QRT 115

Query: 116 YNFSFPIYSF-GETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISN 174
           ++  FPIY    +TL  SI+ENF+ +SPIF   IS  ++S+ +    +I+++G SDRI +
Sbjct: 116 FSLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQIS-DVISKKLNRGHEIVILGCSDRIED 174

Query: 175 MKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMG 234
            K  T + C+L PPEF+TGF+GS+++ L   +     F   I PSEGP GFEK+S + + 
Sbjct: 175 TKICTNNNCSLVPPEFVTGFLGSLMSDLT--KTNDQLFTAAIFPSEGPQGFEKLSSTTVD 232

Query: 235 SLIDVCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           S+ID CSQ +  D S+Y++ECY+ W+ ++++ GAQSGLY+
Sbjct: 233 SIIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  181 bits (459), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 170/282 (60%), Gaps = 20/282 (7%)

Query: 1   FKQWNDLPEPRHQLDFPEISK-NLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLF 59
           FK WN+  EPRHQLD P     N +SL+  P+P V L + +++SQ++ +++ TK++ PLF
Sbjct: 3   FKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRPLF 62

Query: 60  PKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNY-DENFPNEVDPISESETSKETQYNF 118
           P  +  +T+I E + ++  +   PT    A+  +Y DE++  E  P  + E     +   
Sbjct: 63  PSTICPMTTISEFQVTIPPQ---PTAIKKAHGSSYGDEDYEQESLPDKKPE-----EIIV 114

Query: 119 SFPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDI--IVIGSSDRISNMK 176
           SF +  F + L   IEENF+++SPI  N++S+ I+ +L K+   +  IV+G+SDRI+ +K
Sbjct: 115 SFQVEKFNDILFICIEENFLHVSPIAWNLLSQQII-RLCKSKNTLQTIVLGTSDRITTLK 173

Query: 177 KM--TKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMG 234
            +  T     L+PPEF+T    S++T LI+ +   + FK LI PSEGP+GFEK+SL  M 
Sbjct: 174 SVGSTLGLPDLEPPEFVTNCTASLITTLILHD---LPFKSLIAPSEGPSGFEKLSLVSMD 230

Query: 235 SLIDVCSQWLG--FDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
            L + C + +    + S Y +EC+R WR    A+GAQ+GLYI
Sbjct: 231 QLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  170 bits (431), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 150/285 (52%), Gaps = 46/285 (16%)

Query: 1   FKQWNDLPEPRHQLD----FPEISKNLQSLEFCPIPRVELPQDL-NVSQYSTVIITTKIM 55
           FKQW++  EPRH +D     P   +N  SL+  P+P V++P  L +++ Y  +I+ T+++
Sbjct: 3   FKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVL 62

Query: 56  NPLFPKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQ 115
            PLFPK +L  TS+G ++  L V                                S+ T 
Sbjct: 63  MPLFPKEILNFTSLGNIEVKLNV--------------------------------SEATA 90

Query: 116 YNFSFPIYSFGE-TLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISN 174
           +    PIY   E TL+  ++EN + + PIF N+IS++I + +       ++ G+SDRIS 
Sbjct: 91  HLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICT-MFGNQLKFLIFGTSDRISK 149

Query: 175 MKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMG 234
           +K +    CTL PPEFITGFIGS+++ L +  N    F   +VPSEGP GFEK++L  M 
Sbjct: 150 IKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLETME 207

Query: 235 SLIDVCSQWL-----GFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
            LI    + +       +   Y +ECYR WR     IG QSGLYI
Sbjct: 208 FLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  151 bits (381), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 148/283 (52%), Gaps = 27/283 (9%)

Query: 1   FKQWNDLPEPRHQLDFP-EISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLF 59
           FKQWN+  EPRH LD P E + +L SL+  P+P V L + ++ + +    I T I   LF
Sbjct: 3   FKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLF 62

Query: 60  PKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFS 119
              L +   I    SS  V   +  +    Y     E++  + D  S  ET +       
Sbjct: 63  EDRLARAEQI----SSFVVVWQTKGREQHLYR----EDYQTQEDSRSTDETKR-----LE 109

Query: 120 FPIYSFGE-TLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMK-- 176
           FP++   + TL   + E+F+++ PI  N++SR I    +    ++++ GSSDR+  +K  
Sbjct: 110 FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGGLEVLLFGSSDRVERVKYV 167

Query: 177 ----KMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSD 232
                + K    L PPE IT F  S++TQL+   NK + F   + PSEGP+G+EK+S+  
Sbjct: 168 GFPGNVGKGLPLLTPPELITNFTASIMTQLL--SNK-VRFDGYVAPSEGPSGYEKLSMET 224

Query: 233 MGSLIDVCSQWLGF-DHSKYSQECYRLWRCDSAAIGAQSGLYI 274
           M  LID+C   + F +   Y + C+R WR +   +GAQ+GLY+
Sbjct: 225 MDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  122 bits (306), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 133/260 (51%), Gaps = 30/260 (11%)

Query: 25  SLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFPKNLLQLTSIGEVKSSLTVKNSSPT 84
           SL+  P+P V L + L  + +  V I T+I   LF   L     I    S+  VK     
Sbjct: 13  SLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQI----STFEVK----W 64

Query: 85  QSTDAYSWNYDENFPNEVDPISESETSKETQYNFSFPIYSFGE-TLLFSIEENFINISPI 143
           Q+       Y E+F  + D   E+E+        S P+    E T L  + E+F+++ PI
Sbjct: 65  QTKGREQHLYREDFQVQEDCTKENESC-----GLSIPVLKIDEDTFLLCVAEDFLHVPPI 119

Query: 144 FGNMISRSIVSQLIKTSPD--IIVIGSSDRISNMKKMTKSECT------LQPPEFITGFI 195
            GN++S+    ++ K   D  ++VIG+SDRI  +K +  ++        L PPE IT F 
Sbjct: 120 VGNLLSQ----EMAKLCRDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSFT 175

Query: 196 GSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC-SQWLGFDHSKYSQE 254
            S+ TQL++ +   + F   + PSEGP+G+EK+S+  M  LID+C S+    +  +Y +E
Sbjct: 176 ASITTQLLLCK---VPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRDEYVKE 232

Query: 255 CYRLWRCDSAAIGAQSGLYI 274
            +R WR    + G Q+GLY+
Sbjct: 233 THRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  117 bits (292), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 141/278 (50%), Gaps = 27/278 (9%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVEL-PQDLNVSQYSTVIITTKIMNPLF 59
           FKQW +   PRHQ+D P +  +  SL     P V + P+ L++S Y+  I+    +  L 
Sbjct: 4   FKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLL 62

Query: 60  PKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFS 119
           PK+++ L  IG +  +L+  N           W   +  P   D   E   +   Q+   
Sbjct: 63  PKSIINLVHIGIISGTLSNMNE----------WESMKPVPGMYD-TEEHMINSTEQFVIH 111

Query: 120 FPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179
           + ++   +TL+  I+EN +    I  N ++R++ +QL++   DI ++ +SD+I+ +K+++
Sbjct: 112 YNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQLS 170

Query: 180 KSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDV 239
                L PPEFITG I + +  L   E      K ++VPSEGP GFEK +   + +L+D 
Sbjct: 171 Y----LVPPEFITGSITNFILALPRKE-----LKVIVVPSEGPIGFEKYNFPTVDALVDE 221

Query: 240 CSQWLGFDHSK---YSQECYRLWRCDSAAIGAQSGLYI 274
            S+ L    S+   Y  EC +LW+ D      Q GLYI
Sbjct: 222 MSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 92.4 bits (228), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 133/276 (48%), Gaps = 19/276 (6%)

Query: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60
           FKQW     PRHQ+     S +  SL   P P + L  D+N   Y   I     +  L P
Sbjct: 3   FKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWLLP 60

Query: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120
            +L+    I  + + L  K SS     +    N    +  +V P     ++KE +   S+
Sbjct: 61  ADLIHFKQISCLTAVL--KQSSNPDPVEIEDVNTSGFYEVDVKP-----STKEVRA--SY 111

Query: 121 PIYSFGE-TLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMT 179
           PIY   + TL+  I+E+ +   PI  N ++ ++   L      + ++ +SD+I   K ++
Sbjct: 112 PIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKSLS 171

Query: 180 KSECTLQPPEFITGFIGSVLTQL-IIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLID 238
           +    LQPPEFI G + +++T L     +K    + ++V SEGP G+E  +++ +  L++
Sbjct: 172 E----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVE 227

Query: 239 VCSQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274
                LG+   +Y    YR W+ +SA+   QSGLY+
Sbjct: 228 YMKSTLGYS-EEYVTSAYRRWKSNSAS-QFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 115/245 (46%), Gaps = 24/245 (9%)

Query: 32  PRVELPQDLNVSQYSTVIITTKIMNPLFPKNLLQLTSIGEVKSSLTVKNSSPTQST-DAY 90
           P+VE    L   +YS  ++    ++ L P  ++QLT + ++  +LT        +   A 
Sbjct: 12  PQVEFSGKLG-ERYSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGGECATRLVAA 70

Query: 91  SWNYDENFPNEVDPISESETSKETQYNFSFPIYSFGE-TLLFSIEENFINISPIFGNMIS 149
              Y+ + P             E     ++ +Y  G   L+  +EEN +   PI  N ++
Sbjct: 71  DQFYEADVPQ-----------AERHVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRLA 119

Query: 150 RSIVSQLIKTSPDIIVIGSSDRISNMKKMTKSECTLQPPEFITGFIGSVLTQLIIGENKG 209
           + +  +L     +  V+ +SD+ + +K + +    L PPEFITG + +++  L      G
Sbjct: 120 QQLAEKLRAVGAETTVLVNSDKSTGVKDLEE----LVPPEFITGALAALVCALA---PSG 172

Query: 210 MNFKCLIVPSEGPNGFEKISLSDMGSLIDVCSQWLGFDHSKYSQECYRLWRCDSAAIGAQ 269
              + L+V SEGP+GFEK +L+ + +L++   Q L     +Y   C R W+  + +   Q
Sbjct: 173 AG-RVLVVQSEGPHGFEKHNLTVVDALVERVRQILD-QPPEYVAACTRHWKLQAGS-QFQ 229

Query: 270 SGLYI 274
            GLY+
Sbjct: 230 GGLYL 234

>TPHA0D04460 Chr4 complement(964925..967363) [2439 bp, 812 aa] {ON}
           Anc_1.135 YJL200C
          Length = 812

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 84/197 (42%), Gaps = 23/197 (11%)

Query: 78  VKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSFPIYSFGETLLFSIEENF 137
           V  SS  + + A S N D+ FP   D I++ + +K   YN   P Y+     LF++++ F
Sbjct: 13  VIKSSEVRRSLATSQNLDQLFPTTYDNINDKDANK---YNNQIPPYAKLIRNLFALKK-F 68

Query: 138 INISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMK-----KMTKSECTLQPPE--- 189
            N  P+   +  + + + L      I  I S + I +++     K++     +Q      
Sbjct: 69  ANDKPL--TLTEKILYTHLTDIKETIGTISSYNSIYDIRGDEYLKLSPDRVAMQDASAQM 126

Query: 190 FITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVCSQWLGFDHS 249
            +  FI + L Q+ +  +  ++   LIV   G NG EK    D+   I    +   F H+
Sbjct: 127 ALLQFINTGLQQIAVPAS--IHCDHLIV---GKNGEEK----DLARSIATNKEIFDFLHN 177

Query: 250 KYSQECYRLWRCDSAAI 266
             ++   + W   S  I
Sbjct: 178 CATKYGIQFWGPGSGII 194

>TDEL0B05410 Chr2 (960929..963151) [2223 bp, 740 aa] {ON} Anc_1.468
           YJR042W
          Length = 740

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 117 NFSFPIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSP 161
           NF+F + S+G+  L+SI    I+ SPI      R+ +++L+   P
Sbjct: 467 NFAFELCSYGDKKLWSIAIGLISFSPIGNPSAKRTAIAELLPHFP 511

>Suva_15.200 Chr15 (347171..348343) [1173 bp, 390 aa] {ON} YHR017W
           (REAL)
          Length = 390

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 17  PEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLF 59
           P + K  Q + F P     L  +LN++ +ST IIT+ I+N LF
Sbjct: 220 PHLKKKTQLILFDP----SLTSELNLTHHSTEIITSGIINSLF 258

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
           Anc_4.150
          Length = 985

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 83  PTQSTDAYSWNYDENFPNEVDPISESETSKE 113
           P QST+ ++ + + NF +++ PI  S+T+KE
Sbjct: 467 PEQSTNTFTQSINSNFVSQIQPIGSSQTTKE 497

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,421,058
Number of extensions: 1344421
Number of successful extensions: 4545
Number of sequences better than 10.0: 62
Number of HSP's gapped: 4649
Number of HSP's successfully gapped: 63
Length of query: 274
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 166
Effective length of database: 41,097,471
Effective search space: 6822180186
Effective search space used: 6822180186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)