Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1998.325ON42242222450.0
Smik_12.1938.325ON42242220240.0
YLR130C (ZRT2)8.325ON42242219900.0
Suva_10.2238.325ON42042219320.0
NDAI0G025708.325ON42943015130.0
KNAG0G024608.325ON40342414440.0
NCAS0C032508.325ON42943914420.0
Kpol_543.648.325ON42443614130.0
KAFR0H022508.325ON37941313470.0
TPHA0A015508.325ON41142812931e-177
SAKL0H15510g8.325ON39941612811e-175
SAKL0H14388gna 1ON38041512711e-174
TBLA0H012708.325ON40143412591e-172
KAFR0B057308.325ON37242212451e-170
CAGL0M04301g8.325ON38941312351e-169
CAGL0E01353g8.325ON43343512361e-168
NDAI0J010108.325ON38441812211e-167
NCAS0B035808.325ON34741412121e-166
KNAG0A051808.325ON39542611671e-158
KLLA0D16434g8.325ON41440911591e-157
TPHA0D00970na 2ON38341011371e-154
TBLA0F02390singletonON42745511131e-150
KLTH0F09064gna 1ON36141110271e-138
Kpol_1006.10na 2ON39142910241e-137
Ecym_4202na 1ON37541510001e-133
AGL143Cna 1ON3744179861e-131
SAKL0F16346gsingletonON3794179571e-127
YGL255W (ZRT1)na 3ON3764296109e-75
TDEL0D06550singletonON3814085664e-68
ZYRO0F02200gsingletonON3814085656e-68
KLTH0C00374gsingletonON3764135482e-65
KLTH0A07722gna 4ON3924135456e-65
ZYRO0D17732gsingletonON3994255292e-62
Suva_7.6na 3ON3722084364e-49
Smik_7.6na 3ON3721694322e-48
Skud_7.12na 3ON3722074312e-48
Kwal_23.6522na 4ON3891673824e-41
Kwal_14.824singletonON3741693509e-37
NDAI0G039803.50ON57091751.1
Kwal_27.121298.562ON2333114732.6
SAKL0A02420g6.297ON294146685.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.199
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {...   869   0.0  
Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {...   784   0.0  
YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON} ...   771   0.0  
Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {...   748   0.0  
NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325    587   0.0  
KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {O...   560   0.0  
NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325    560   0.0  
Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {O...   548   0.0  
KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.3...   523   0.0  
TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.3...   502   e-177
SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} simi...   498   e-175
SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} simi...   494   e-174
TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.3...   489   e-172
KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa] ...   484   e-170
CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa] ...   480   e-169
CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} simila...   480   e-168
NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8....   474   e-167
NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {O...   471   e-166
KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.3...   454   e-158
KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]...   451   e-157
TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {O...   442   e-154
TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON}              433   e-150
KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} simila...   400   e-138
Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {O...   399   e-137
Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar t...   389   e-133
AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON} N...   384   e-131
SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]...   373   e-127
YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}  ZRT1High-aff...   239   9e-75
TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON}            222   4e-68
ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} simila...   222   6e-68
KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON...   215   2e-65
KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} simila...   214   6e-65
ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]...   208   2e-62
Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)    172   4e-49
Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)    171   2e-48
Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)   170   2e-48
Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL25...   151   4e-41
Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON} ...   139   9e-37
NDAI0G03980 Chr7 complement(947806..949518) [1713 bp, 570 aa] {O...    33   1.1  
Kwal_27.12129 s27 complement(1099493..1106494) [7002 bp, 2333 aa...    33   2.6  
SAKL0A02420g Chr1 (222751..223635) [885 bp, 294 aa] {ON} similar...    31   5.6  

>Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/422 (100%), Positives = 422/422 (100%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC
Sbjct: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT 180
           THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT
Sbjct: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT 180

Query: 181 RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY 240
           RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY
Sbjct: 181 RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY 240

Query: 241 HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300
           HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF
Sbjct: 241 HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300

Query: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI 360
           HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI
Sbjct: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI 360

Query: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK 420
           ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK
Sbjct: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK 420

Query: 421 WA 422
           WA
Sbjct: 421 WA 422

>Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/422 (89%), Positives = 396/422 (93%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           MIDL+VRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC
Sbjct: 1   MIDLIVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT 180
           THY+VAKTLGHDHGD+    ++D D+ SS+ AV N    PAS NNEAVY IHNNK PYTT
Sbjct: 121 THYYVAKTLGHDHGDHGENTSIDVDVPSSDLAVSNIDSQPASFNNEAVYFIHNNKTPYTT 180

Query: 181 RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY 240
           RNEEI  TP+KEK+P+SN+ NYDLE GNTESIAN L PM+SHATN+ SVPGKDH+SHEN 
Sbjct: 181 RNEEIGATPIKEKEPSSNITNYDLEAGNTESIANELFPMSSHATNIPSVPGKDHFSHEND 240

Query: 241 HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300
           HQDAS+LG  IEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF
Sbjct: 241 HQDASQLGTRIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300

Query: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI 360
           HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVA+GIGVRHSW+PGSR+ALI
Sbjct: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRKALI 360

Query: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK 420
           ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP GLKKMLSAYFIMCCGAALMALLGK
Sbjct: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIMCCGAALMALLGK 420

Query: 421 WA 422
           WA
Sbjct: 421 WA 422

>YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON}
           ZRT2Low-affinity zinc transporter of the plasma
           membrane; transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 422

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/422 (87%), Positives = 388/422 (91%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           M+DL+ RDDS D+CQASN YNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC
Sbjct: 1   MVDLIARDDSVDTCQASNGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT 180
           THYFVAKTLGHDHGD+  V ++D D  SS   +RN   +P S NNEA YSIHN+K PYTT
Sbjct: 121 THYFVAKTLGHDHGDHGEVTSIDVDAPSSGFVIRNMDSDPVSFNNEAAYSIHNDKTPYTT 180

Query: 181 RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY 240
           RNEEIV TP+KEK+P SNV NYDLE G TES+AN L+P +SHATNL SVPGKDHYSHEN 
Sbjct: 181 RNEEIVATPIKEKEPGSNVTNYDLEPGKTESLANELVPTSSHATNLASVPGKDHYSHEND 240

Query: 241 HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300
           HQD S+L   IEEEDKEQYLNQ+LAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF
Sbjct: 241 HQDVSQLATRIEEEDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300

Query: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI 360
           HQMFEGLGLGTRVAETNWPESK+Y PWLMGLAFTLTSPIAVA+GIGVRHSW+PGSRRALI
Sbjct: 301 HQMFEGLGLGTRVAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALI 360

Query: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK 420
           ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAY IMCCGAALMALLGK
Sbjct: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGAALMALLGK 420

Query: 421 WA 422
           WA
Sbjct: 421 WA 422

>Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {ON}
           YLR130C (REAL)
          Length = 420

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/422 (85%), Positives = 390/422 (92%), Gaps = 2/422 (0%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           MIDL++RDDSTDSCQASNDYNGH+GLRILAVFIILISSGLGVYFPILSSRYSFIRLP+ C
Sbjct: 1   MIDLLIRDDSTDSCQASNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPDCC 60

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FFIAKFFGSGVIVATAF+HLLQPAAEALG+ECLGGTFAEYPWAFGICL+SLFLLFFTEII
Sbjct: 61  FFIAKFFGSGVIVATAFIHLLQPAAEALGNECLGGTFAEYPWAFGICLISLFLLFFTEII 120

Query: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT 180
           THYFVAKTLGHDHGD+  V  +D+ + SSE  + N   + AS N+EAVYSIHNNK  YT 
Sbjct: 121 THYFVAKTLGHDHGDHGEVAAIDSRVPSSEYTIGNLHSDTASFNDEAVYSIHNNKNSYTA 180

Query: 181 RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY 240
           +NEE+V T VKEK+  S+++ YDLE G TESIANG++P +SH +N  SVPGKDHYSHEN 
Sbjct: 181 KNEELVATSVKEKE--SDMLKYDLEVGKTESIANGIVPSSSHMSNFASVPGKDHYSHEND 238

Query: 241 HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300
           HQDAS+LG  IEEEDKEQY+NQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF
Sbjct: 239 HQDASQLGTQIEEEDKEQYINQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 298

Query: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI 360
           HQMFEGLGLGTRVAETNWP+SKRYTPWLMGLAFTLTSPIAVA+GIGVRHSW+PGSRRALI
Sbjct: 299 HQMFEGLGLGTRVAETNWPDSKRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALI 358

Query: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK 420
           ANG+FDSISSGILIYTGLVELMAHEFLYSNQFKGPDGL+KMLSAYFIMCCGAALMALLGK
Sbjct: 359 ANGIFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLRKMLSAYFIMCCGAALMALLGK 418

Query: 421 WA 422
           WA
Sbjct: 419 WA 420

>NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/430 (70%), Positives = 338/430 (78%), Gaps = 9/430 (2%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           M++L+ RDD+   C+ SNDYNGH+GLRILAVFIILISSGLGVYFPILSSRYSFIRLP+WC
Sbjct: 1   MLELLARDDAV-VCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWC 59

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FF+AKFFGSGVIV+TAF+HLL PAAEALG+ECLGGTF EYPWAFGICLMSLFLLFF EI+
Sbjct: 60  FFLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIV 119

Query: 121 THYFVAKTLG---HDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIP 177
           THYFVAK+ G   HDHG+N      D   +S ES       +P  L   +   I N    
Sbjct: 120 THYFVAKSFGDEHHDHGNNINSVHDDDADSSDESITSYTEDHPVILPRRSHNDIENQFQK 179

Query: 178 YTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIAN-----GLIPMNSHATNLTSVPGK 232
              +  +    P  + D      +   E    E++ +     G    N + T   S+PGK
Sbjct: 180 SNCKLAQSAQNPDDDDDDEEEEDDKLKEEKEREALQDRQNISGNNKNNDNMTRFNSIPGK 239

Query: 233 DHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFE 292
           DH+SH+  HQD ++LG  IEEEDKEQYLNQM AVFILEFGIIFHSVFVGLSLSV+GEEFE
Sbjct: 240 DHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHSVFVGLSLSVSGEEFE 299

Query: 293 TLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWV 352
           TLFIVLTFHQMFEGLGLGTRVAETNWP ++RYTPWLMGLAFT+TSPIAVAIGIGVRHSW+
Sbjct: 300 TLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAVAIGIGVRHSWI 359

Query: 353 PGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGA 412
           PGSR+ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDG KKML+AYFIMC GA
Sbjct: 360 PGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKMLAAYFIMCLGA 419

Query: 413 ALMALLGKWA 422
            LMALLGKWA
Sbjct: 420 GLMALLGKWA 429

>KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {ON}
           Anc_8.325 YLR130C
          Length = 403

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/424 (67%), Positives = 326/424 (76%), Gaps = 43/424 (10%)

Query: 8   DDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFF 67
           DD   +C  SN YNGH GLRILAVFIILISSG+GV+FPI++SRYSFIRLP+WCFFIAKFF
Sbjct: 14  DDDVVACAVSNSYNGHNGLRILAVFIILISSGVGVFFPIMASRYSFIRLPDWCFFIAKFF 73

Query: 68  GSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAK 127
           GSGVIVATAF+HLLQPA+EALGD CLGGTFAEYPWAFGICLMSLF+LFFTEI++H+F++K
Sbjct: 74  GSGVIVATAFIHLLQPASEALGDPCLGGTFAEYPWAFGICLMSLFMLFFTEIVSHHFISK 133

Query: 128 TLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVG 187
           +LG  H  + G  +V  D   SE +V                          ++  EIV 
Sbjct: 134 SLGDSHESHGGADSVYGDDDDSEFSV--------------------------SKQREIVD 167

Query: 188 TPVKE---KDPNSNVINYDLETGNTESIANGLIPMNSHATNLTS------VPGKDHYSHE 238
           +   E   KD     +  DL  G T       +P      NLTS      +PGKDH++H+
Sbjct: 168 SQKGELFIKDKFEQEV--DLSQGITT------VPSTRDYANLTSTELEPTIPGKDHFAHD 219

Query: 239 NYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVL 298
             HQD S+LG  ++E+DKEQYLNQ++AV ILE GIIFHSVFVGLSLSV+GEEFETLFIVL
Sbjct: 220 TEHQDPSQLGTPVQEQDKEQYLNQIVAVTILEAGIIFHSVFVGLSLSVSGEEFETLFIVL 279

Query: 299 TFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRA 358
           TFHQMFEGLGLGTRVAETNWPE+++ TPWLMGLAF LTSPIAVAIGIGVRHSWVPGSR++
Sbjct: 280 TFHQMFEGLGLGTRVAETNWPENRKNTPWLMGLAFMLTSPIAVAIGIGVRHSWVPGSRKS 339

Query: 359 LIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALL 418
           LIANGVFD+ISSGILIYTGLVELMAHEFL+SNQFKGP GLKKML AYFIMC GA LMALL
Sbjct: 340 LIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGGLKKMLYAYFIMCLGAGLMALL 399

Query: 419 GKWA 422
           GKWA
Sbjct: 400 GKWA 403

>NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/439 (66%), Positives = 338/439 (76%), Gaps = 27/439 (6%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           MID+++  D  D+C+ SN YNGHAGLRILA+FIILISSGLGV+FPI++SRYSFI LP WC
Sbjct: 1   MIDIILARD-VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWC 59

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FF+AKFFGSGVIVATAF+HLL PAAEALG+ CLGGTF EYPWAFGICLMSLF+LF  EI+
Sbjct: 60  FFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIV 119

Query: 121 THYFVAKTLG-HDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYT 179
           THY+VAK+ G HDH D       + DI S E+     G       N  V S  +N     
Sbjct: 120 THYYVAKSFGDHDH-DGGHSNHHEDDITSFEA----DGFTDLERQNGIVRSTDHNNNSNN 174

Query: 180 TRNEEIVGTPVKEKD---------------PNSNVINYDLETGNTESIANGLIPMNSHAT 224
                +    V EK                P SN    DL + +  +  + L+  N++ +
Sbjct: 175 NNVLPMKKNQVDEKSIDEDDDGDDEDKEQDPASN----DLASSSRINNNDNLVNTNTNIS 230

Query: 225 N-LTSVPGKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLS 283
             ++SVPGKDH+ H++ HQD+S++G  +EEE+KEQYLNQM+AVFILEFGIIFHSVFVGLS
Sbjct: 231 RFVSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHSVFVGLS 290

Query: 284 LSVAGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAI 343
           LSV+GEEFETLFIVL FHQMFEGLGLGTRVAETNWP+SKRYTPWLMGLAFT+TSPIAVAI
Sbjct: 291 LSVSGEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAI 350

Query: 344 GIGVRHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLS 403
           GIGVR SW+PGSR ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP GLKKML+
Sbjct: 351 GIGVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLT 410

Query: 404 AYFIMCCGAALMALLGKWA 422
           AYFIMC GA LMALLGKWA
Sbjct: 411 AYFIMCMGAGLMALLGKWA 429

>Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {ON}
           complement(147560..148834) [1275 nt, 425 aa]
          Length = 424

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/436 (62%), Positives = 336/436 (77%), Gaps = 28/436 (6%)

Query: 1   MIDLVVRDDS--TDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPN 58
           ++ L+VRD     D+C+A+ND++G   LR+L++F+I+ISSGLGV+FP+L+SRYSFIRLP 
Sbjct: 3   VLRLLVRDTEGVVDTCEATNDFDGRINLRVLSIFMIMISSGLGVFFPLLASRYSFIRLPE 62

Query: 59  WCFFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTE 118
           WCFFIAKFFGSGVIV+TAF+HLL PAAEALG++CLGGTF EYPWAFGICLMSLFLLFFTE
Sbjct: 63  WCFFIAKFFGSGVIVSTAFIHLLVPAAEALGNDCLGGTFVEYPWAFGICLMSLFLLFFTE 122

Query: 119 IITHYFVAKTLGHDHGD----NEGVGTVDADI------ASSESAVRNGGPNPASLNNEAV 168
           IITHYF++K+L +DHGD    +   G  + DI      +S E  V N       ++ E  
Sbjct: 123 IITHYFMSKSLDNDHGDSGHSHSHFGNQNKDIEINSHFSSDEDEVDN-----KDISEERT 177

Query: 169 YSIHNNKIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIP--MNSHATNL 226
           Y +  +    T +  E       +  P  +V +Y  + G T S  N ++P   N     L
Sbjct: 178 YQMKYDFELDTKKVNE-------QTSPLYSVSSY-AQVG-TSSSKNSILPKETNIKLKQL 228

Query: 227 TSVPGKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSV 286
            S+PGK+HYSH+  HQD S+LG  +EE DKEQYL Q++ V ILE G+IFHS+FVGLSL+V
Sbjct: 229 ESIPGKNHYSHDKNHQDPSQLGTPVEEIDKEQYLGQIVGVTILEIGVIFHSIFVGLSLAV 288

Query: 287 AGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIG 346
           +GEEF TLFIVL FHQMFEGLGLGTR+AE NWP SKRYTPWLM L FTLT+PIA+AIGIG
Sbjct: 289 SGEEFITLFIVLVFHQMFEGLGLGTRLAEANWPHSKRYTPWLMALGFTLTTPIAIAIGIG 348

Query: 347 VRHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYF 406
           VR+SW+PGSR++LIANGVFD+ISSGILIYTGLVELMAHEFL+SNQFKGP G K+MLSAYF
Sbjct: 349 VRYSWIPGSRKSLIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAYF 408

Query: 407 IMCCGAALMALLGKWA 422
           +MCCGAALMA+LG+WA
Sbjct: 409 VMCCGAALMAVLGRWA 424

>KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.325
           YLR130C
          Length = 379

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/413 (63%), Positives = 309/413 (74%), Gaps = 44/413 (10%)

Query: 10  STDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGS 69
           + D+C  SNDY+G+  LRIL+VFI+LIS+ +GV+FPIL+SRYSFI LP WCFFIAKFFGS
Sbjct: 11  AIDTCSTSNDYDGNNNLRILSVFILLISASIGVFFPILASRYSFINLPGWCFFIAKFFGS 70

Query: 70  GVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTL 129
           GVIVATAF+HLL+PA+E LGD+CLGGTFAEYPWAFGICLMSLF LF  EII+HYFV K  
Sbjct: 71  GVIVATAFIHLLEPASEELGDDCLGGTFAEYPWAFGICLMSLFFLFLVEIISHYFVNKNF 130

Query: 130 GHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTP 189
           GHDHG +E  GT+                            +H+         E+ +   
Sbjct: 131 GHDHGHDE-TGTI----------------------------VHHIPREEDEEEEDSLDED 161

Query: 190 VKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGK 249
            K+ D  S   + D+ T   + +A              S+ GKDH+SH++ HQD S+LG 
Sbjct: 162 FKKGDIESQT-SPDIRTHKLDRLA--------------SILGKDHFSHDSTHQDPSQLGT 206

Query: 250 GIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGL 309
             EE  KEQYLNQ++A+FILE GIIFHS+F+GLSL+V G EF+TLFIVLTFHQMFEGLGL
Sbjct: 207 STEEFQKEQYLNQIVALFILESGIIFHSIFIGLSLAVTGAEFKTLFIVLTFHQMFEGLGL 266

Query: 310 GTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSIS 369
           GTR++E NWP+SK+Y PWLMGLAF LT+ IAVAIGIGVRHSWVPGSR ALIA+G+FDSIS
Sbjct: 267 GTRISEANWPQSKKYIPWLMGLAFALTTAIAVAIGIGVRHSWVPGSRNALIASGIFDSIS 326

Query: 370 SGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           +GILIYTGLVELMAHEFLYSNQFKGPDG K+ML AYFIMCCGAALMALLGKWA
Sbjct: 327 AGILIYTGLVELMAHEFLYSNQFKGPDGFKRMLFAYFIMCCGAALMALLGKWA 379

>TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.325
           YLR130C
          Length = 411

 Score =  502 bits (1293), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/428 (58%), Positives = 309/428 (72%), Gaps = 29/428 (6%)

Query: 2   IDLVVRD-DSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           I+LV+RD DSTD+C   + YNG   +R+LA+FIILISSGLG +FPIL+S YSFIRLP+ C
Sbjct: 6   IELVLRDGDSTDTCDTQSSYNGSTNMRVLALFIILISSGLGSFFPILASTYSFIRLPDCC 65

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FF+AKFFGSGVIVATAF+HLL PA EAL + CLGGTF EYPWAFGICLMSLFLLF  EI+
Sbjct: 66  FFVAKFFGSGVIVATAFIHLLDPAVEALSNTCLGGTFTEYPWAFGICLMSLFLLFLIEIM 125

Query: 121 THYFVAKTL----GHDHGDNEG--VGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNN 174
           TH+ +        GH HGD+      ++D   A S  A      N  S +  ++ +   N
Sbjct: 126 THHMLTHDEHGDGGHSHGDDTSYTASSIDDKEADSIDADVRKDANDDSYDINSILNFDKN 185

Query: 175 KIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDH 234
           K                + D  +N     +E  N   + N  I      +   S PG+DH
Sbjct: 186 K----------------DYDIEANHYEVSMEDRNNTKMDNYKI------SQTKSTPGQDH 223

Query: 235 YSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETL 294
           +SH++ HQD  +LG  +E+ DKE+Y+ Q+++V ILEFG+IFHS+F GLSL+V+G+EFETL
Sbjct: 224 FSHDSEHQDLVQLGTPVEQLDKEKYMGQIVSVIILEFGVIFHSIFTGLSLAVSGDEFETL 283

Query: 295 FIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPG 354
           FIVL FHQMFEGLGLGTR+AETNWP+SK+ TPWL+ L FT+++PIA+ IGIGVR++++PG
Sbjct: 284 FIVLVFHQMFEGLGLGTRIAETNWPKSKKNTPWLLALGFTISTPIAIGIGIGVRYTFIPG 343

Query: 355 SRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAAL 414
           SR ALI NG+FDSISSGILIYTGLVELMAHEFL+S QF G DG KKM+ AY IMCCGAAL
Sbjct: 344 SRTALITNGIFDSISSGILIYTGLVELMAHEFLFSKQFSGRDGFKKMIFAYVIMCCGAAL 403

Query: 415 MALLGKWA 422
           MALLGKWA
Sbjct: 404 MALLGKWA 411

>SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 399

 Score =  498 bits (1281), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 252/416 (60%), Positives = 299/416 (71%), Gaps = 22/416 (5%)

Query: 7   RDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKF 66
           RDD  D C   N+Y+G   LRILAVF+ILISSGLG +FPILSSRYS IRLP WCFFIAKF
Sbjct: 6   RDDEVDVCDNDNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKF 65

Query: 67  FGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVA 126
           FGSGVIVAT F+HLL+PA + LG+ CLGGTFA+YPWAFGICLMSLF LFF+EIITH+F  
Sbjct: 66  FGSGVIVATGFIHLLKPATDNLGNTCLGGTFADYPWAFGICLMSLFALFFSEIITHHFFI 125

Query: 127 KTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIV 186
           K  G            ++D  +S S    G PN  +       S   +            
Sbjct: 126 KANG------------NSDHTNSHSHF--GEPNHTTHQQFPDESEKKDDEEEADVECAAE 171

Query: 187 GTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASE 246
             P+K        + Y  +       A+  +   S      SVPGKDH+SHE  HQD S+
Sbjct: 172 YIPLK--------VGYFKDDEELRCSASQGVSRKSDRKPSVSVPGKDHFSHEQDHQDLSQ 223

Query: 247 LGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEG 306
           LG  + ++++EQYL+Q+ AVFILEFG++FHSVFVGLSL+VAG+EF TLFIVL FHQMFEG
Sbjct: 224 LGTLVRQKEREQYLSQVFAVFILEFGVVFHSVFVGLSLAVAGDEFNTLFIVLVFHQMFEG 283

Query: 307 LGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFD 366
           LGLGTR+AET WP SKRYTPWL+GL +TL++PIA+AIGIGVRHS+ PGS++ALI NGVFD
Sbjct: 284 LGLGTRIAETTWPASKRYTPWLLGLGYTLSTPIAIAIGIGVRHSFAPGSKKALITNGVFD 343

Query: 367 SISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           SIS+GILIYTGLVELMAHEFLYS QFKG  G K+M+ AYFIMC GA LMALLG+WA
Sbjct: 344 SISAGILIYTGLVELMAHEFLYSQQFKGEGGCKRMIGAYFIMCLGAGLMALLGRWA 399

>SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 380

 Score =  494 bits (1271), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 297/415 (71%), Gaps = 60/415 (14%)

Query: 8   DDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFF 67
           D+   +C   NDY+G   LRILAVF+ILISS LG +FPILSSRYSFIRLP+WCFFIAK+F
Sbjct: 26  DEEPVACPIDNDYDGRDNLRILAVFMILISSALGTFFPILSSRYSFIRLPDWCFFIAKYF 85

Query: 68  GSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAK 127
           GSGVIVAT F+HLL+PA++ALG+ECLGGTFA+YPWAFGICLMSLF LFF EIITHYF AK
Sbjct: 86  GSGVIVATGFIHLLEPASDALGEECLGGTFADYPWAFGICLMSLFALFFVEIITHYFAAK 145

Query: 128 TLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVG 187
             G+           D+   S E +V++                                
Sbjct: 146 AAGN-----------DSSNYSDEKSVKD-------------------------------- 162

Query: 188 TPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASEL 247
                            E  +++   + +I ++    N+ SVPG DHY H+  HQD ++ 
Sbjct: 163 -----------------EEADSQLAYSAVIKVDQQQENVNSVPGADHYGHDEVHQDPAQA 205

Query: 248 GKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGL 307
              + ++DKE+YLNQ++AVFILEFG++FHSVFVGLSL+VAG+EF TLFIVL FHQMFEGL
Sbjct: 206 QNLVSQKDKEKYLNQIVAVFILEFGVVFHSVFVGLSLAVAGDEFNTLFIVLVFHQMFEGL 265

Query: 308 GLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDS 367
           GLGTR+AET WPES+R+TPWL+ L +T+ +PIA+AIGIGVRHS+ PGSR+ALI+NG FD+
Sbjct: 266 GLGTRIAETPWPESERFTPWLLALGYTIATPIAIAIGIGVRHSFAPGSRKALISNGCFDA 325

Query: 368 ISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           IS+GILIYTGLVELMAHEFLY+N FKGP+G K M+ A+FIMC GA LMALLGKWA
Sbjct: 326 ISAGILIYTGLVELMAHEFLYANSFKGPNGFKWMMLAFFIMCLGAGLMALLGKWA 380

>TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.325
           YLR130C
          Length = 401

 Score =  489 bits (1259), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 254/434 (58%), Positives = 312/434 (71%), Gaps = 51/434 (11%)

Query: 1   MIDLVVR----DDSTD---SCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSF 53
           ++D++V+    DD +D   +C+ SNDY+G   LRIL+VFI+LISSG+GV FPIL+S+YSF
Sbjct: 7   LLDVIVKRHGADDDSDHVPACETSNDYDGRMNLRILSVFILLISSGIGVNFPILASQYSF 66

Query: 54  IRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFL 113
           IRLP WCFFIAKFFGSGVI+ATAFVHLL+PAA+ALG+ CLGGTFAEYPWAFGICLMSLF 
Sbjct: 67  IRLPKWCFFIAKFFGSGVIIATAFVHLLEPAADALGNACLGGTFAEYPWAFGICLMSLFF 126

Query: 114 LFFTEIITHYFVAKTLGHDHG---DNEGVGTVDAD-IASSESAVRNGGPNPASLNNEAVY 169
           LFFTEII+H+ + + L  +HG   D E       D I   E    +  PNP  +  E   
Sbjct: 127 LFFTEIISHHIIDQRLAKEHGHGHDEEHAAIERVDTIECCEENSCDEEPNPMVIQEE--- 183

Query: 170 SIHNNKIPYT-TRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTS 228
              N+   Y  ++N++       EK      IN  L+  + E                 +
Sbjct: 184 ---NSATTYIDSKNKD-------EKKAADVQINEHLQYDSQEK----------------T 217

Query: 229 VPGKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG 288
           V  ++  SH +          G+   ++EQYLNQ++AV +LE G+I HSVF+GLSL+V G
Sbjct: 218 VDLENSISHHD----------GMTRAEREQYLNQLVAVMVLEAGVIVHSVFIGLSLAVTG 267

Query: 289 EEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVR 348
           + F TLFIVLTFHQMFEGLGLGTRVAET WP+SKR TPWLM LAFTLT+P+AVAIG+GVR
Sbjct: 268 DNFVTLFIVLTFHQMFEGLGLGTRVAETPWPKSKRMTPWLMALAFTLTTPVAVAIGLGVR 327

Query: 349 HSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIM 408
           +SWVPGSR +LIANG+FD+IS+GILIYTGLVELMAHEFLYS QFKG +GLK+MLSAYF+M
Sbjct: 328 NSWVPGSRTSLIANGIFDAISAGILIYTGLVELMAHEFLYSGQFKGENGLKQMLSAYFVM 387

Query: 409 CCGAALMALLGKWA 422
           CCGAALMALLGKWA
Sbjct: 388 CCGAALMALLGKWA 401

>KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa]
           {ON} Anc_8.325 YLR130C
          Length = 372

 Score =  484 bits (1245), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 245/422 (58%), Positives = 304/422 (72%), Gaps = 50/422 (11%)

Query: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           M +L+ RD    +CQ SNDYNG   LRILAVF+ILISS LG +FP+LSS+YSFI+LPNWC
Sbjct: 1   MSELIPRD----TCQTSNDYNGSDNLRILAVFMILISSALGAFFPLLSSKYSFIKLPNWC 56

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FFIAKFFGSGVIVATAF+HLL+PA++AL ++CLGGTFA+YPWAFGICLMSLF LFF+EI 
Sbjct: 57  FFIAKFFGSGVIVATAFIHLLEPASDALTNDCLGGTFADYPWAFGICLMSLFFLFFSEIC 116

Query: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTT 180
           +HYF+ +  G++   +   G  D+ ++  +S            N E   S H        
Sbjct: 117 SHYFILRAYGNEDHSHFPSGNDDSKLSDVDS----------DKNTETRISNH-------- 158

Query: 181 RNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENY 240
           R+ E  G+ +++  P S         GN+                   +PG+DHYSH+  
Sbjct: 159 RDIE-SGSFIRDAGPTS---------GNS------------------FIPGRDHYSHDAV 190

Query: 241 HQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTF 300
           HQD S+LG   E  DKE Y NQ+ AV ILEFGI+FHSVF+GLSL+VAGEEF+TLF+VL F
Sbjct: 191 HQDPSQLGTPAESSDKENYANQIFAVSILEFGIVFHSVFIGLSLAVAGEEFKTLFVVLIF 250

Query: 301 HQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALI 360
           HQMFEGLGLGTR+AETNWP+SK+ TPW+M L +++T+PI+ AIGIGVRHS++P SR+ALI
Sbjct: 251 HQMFEGLGLGTRLAETNWPKSKKLTPWIMALGYSITTPISTAIGIGVRHSFLPESRKALI 310

Query: 361 ANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGK 420
            NGVFD+ S+GILIYTGLVELMAHEFLYS+ FK  DGLK+ML AY  M  GA +MALLGK
Sbjct: 311 VNGVFDAFSAGILIYTGLVELMAHEFLYSSTFKQKDGLKRMLLAYLCMATGAGIMALLGK 370

Query: 421 WA 422
           WA
Sbjct: 371 WA 372

>CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
           YGL255w ZRT1
          Length = 389

 Score =  480 bits (1235), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 238/413 (57%), Positives = 290/413 (70%), Gaps = 32/413 (7%)

Query: 10  STDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGS 69
           S D+C   NDYNG   LRILAVFI++ISSGLG YFPILSS+YSFIRLPNWCFF+AKFFGS
Sbjct: 9   SVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGS 68

Query: 70  GVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTL 129
           GVI+ATAF+HLLQPAAEAL D+CLGGTF +YPWAFGICLMSLF+LF  EI+ H+FV K  
Sbjct: 69  GVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF 128

Query: 130 GHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTP 189
            H H + +    +  DI   +  +     +   LN       H + +  + + E  V T 
Sbjct: 129 NHSHAETDNANAL-PDIILKDIQISTDDLSEGMLNCAG----HQDSLQDSKKIETGVSTN 183

Query: 190 VKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGK 249
           +K  D +     Y+ +  +T+                           E +  + +    
Sbjct: 184 LKRVDDSGFEGQYEYKRESTD---------------------------ETWIDENTLTTG 216

Query: 250 GIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGL 309
             E +    Y++++  + +LEFGIIFHSVFVGLSL+VAG EF+ LFIV+TFHQMFEGLGL
Sbjct: 217 NSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGL 276

Query: 310 GTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSIS 369
           GTR+AET WP SK YTPW+M  AFT+TSPIA+AIGIGVRHSWVPGSR+ALIANGVFDSIS
Sbjct: 277 GTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSIS 336

Query: 370 SGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           SGILIYTGL+ELMAHEF++SNQFKG   L+ ML+AYFIMCCGAALMALLG+WA
Sbjct: 337 SGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA 389

>CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130c ZRT2
           or uniprot|P32804 Saccharomyces cerevisiae YGL255w ZRT1
          Length = 433

 Score =  480 bits (1236), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/435 (52%), Positives = 315/435 (72%), Gaps = 17/435 (3%)

Query: 1   MIDLVVRDDSTD----SCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRL 56
           ++ L+ + D  D    +C   ND+NGH  LRIL+VF++LISS +GVYFP+L+SRYSFI L
Sbjct: 3   IVQLLFKRDDDDGPPPACAVDNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINL 62

Query: 57  PNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFF 116
           P+W FFIAKFFGSGVIVATAF+HLL+PA+++LG+ CLGGTFA YPWAFGICLM+LF LF 
Sbjct: 63  PSWVFFIAKFFGSGVIVATAFIHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFL 122

Query: 117 TEIITHYFVAKTLGHDHGDNEGVGT---------VDADIASSESAVRNGGPNPASLNNEA 167
            EI++H++V KT+G  H  +  + T         V+ D+   + +      +  +++++ 
Sbjct: 123 IEIVSHHYVGKTMGGGHNHSHNMPTTFGQTHMHGVEDDMVDEDGSSSTHSHSHVAMDDKY 182

Query: 168 VYSIHNNKIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLT 227
              + NN   Y   +++I      +K P  NV    +   + E+ +      N+    L 
Sbjct: 183 GDVVKNNNYNYDDGSDDIE----SQKRPAFNVAQQKVRNDSNENDSLVGHVHNTTVDPLE 238

Query: 228 SVPGKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVA 287
            +PG +H+SH+  HQD +++G    ++ KEQYLNQ+ ++FILEFGI+FHSVFVGLSLSV+
Sbjct: 239 HMPGHNHFSHDEVHQDITQIGSKANDQQKEQYLNQLTSLFILEFGILFHSVFVGLSLSVS 298

Query: 288 GEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGV 347
           G+EF+TLF+V+ FHQMFEG+GLG R+ E  WP SKR+ P+L+G  +T+T+PIA+AIGIGV
Sbjct: 299 GDEFKTLFVVIVFHQMFEGMGLGARITECYWPHSKRWLPYLLGFGYTITTPIAIAIGIGV 358

Query: 348 RHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFI 407
           RHS+VPGSRR+LI NGVFD+IS+GIL+Y GLVELMAHEFL++NQFKG  GL+ ML+AYF+
Sbjct: 359 RHSFVPGSRRSLIVNGVFDAISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFV 418

Query: 408 MCCGAALMALLGKWA 422
           M  GA LMALLG+WA
Sbjct: 419 MALGAGLMALLGRWA 433

>NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8.325
          Length = 384

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 238/418 (56%), Positives = 299/418 (71%), Gaps = 41/418 (9%)

Query: 11  TDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSG 70
           TD+C  +ND+NG   +RIL++F+IL+SS +G +FP+LS+RYS+IRLP WCFF+AKFFGSG
Sbjct: 2   TDTCLNTNDFNGRTNIRILSIFMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSG 61

Query: 71  VIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG 130
           VIVATAF+HLL+PA++ALGD CLGGTFA+YPWAFGICLMSLF LFFTEI++H++V K   
Sbjct: 62  VIVATAFIHLLEPASDALGDPCLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKAF- 120

Query: 131 HDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPV 190
                              E+   +   N  S +NE      ++K     +N+       
Sbjct: 121 -------------------ETVSHSASGNIHSHSNEDDDDHDHDKDSVDIKNKH------ 155

Query: 191 KEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVP------GKDHYSHENYHQDA 244
                     N DLE+   +S + G+I + +   +  +V       G +HY H   HQD 
Sbjct: 156 -------TTTNNDLES--LQSTSPGIIGLATFTRSHDNVNKQMGTIGSNHYDHALVHQDP 206

Query: 245 SELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMF 304
            ++G  + +  KEQY NQ+LAV ILEFGI+FHSVF+GLSL+V+GEEF TLFIVL FHQMF
Sbjct: 207 GQMGTSLNDSAKEQYANQLLAVTILEFGIVFHSVFIGLSLAVSGEEFTTLFIVLIFHQMF 266

Query: 305 EGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGV 364
           EGLGLGTR+AE  W +SKR+TPWLM L F+LT+PIA+AIG+GVRHS+VP SRRALI+NG 
Sbjct: 267 EGLGLGTRLAEVPWDKSKRFTPWLMALGFSLTTPIAIAIGLGVRHSFVPTSRRALISNGC 326

Query: 365 FDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           FD+IS+GILIYTGLVELMAHEFLYSNQFKG +G KKM+SAY  MC GA LMALLGKWA
Sbjct: 327 FDAISAGILIYTGLVELMAHEFLYSNQFKGENGFKKMISAYICMCFGAGLMALLGKWA 384

>NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {ON}
           Anc_8.325
          Length = 347

 Score =  471 bits (1212), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 244/414 (58%), Positives = 292/414 (70%), Gaps = 70/414 (16%)

Query: 11  TDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSG 70
           TD+CQA NDYNG   +RIL+VF+I+ISSGLGV+FP+L+S+YSFIRLP+WCFF+AKFFGSG
Sbjct: 2   TDTCQAQNDYNGETNIRILSVFMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSG 61

Query: 71  VIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG 130
           VIVATAFVHLLQPA+EAL D CLGGTFA+YPWAFGICLMSLF LFFTEI +HY+++K   
Sbjct: 62  VIVATAFVHLLQPASEALSDPCLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAFS 121

Query: 131 HDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPV 190
            D  D+       +D  S +S+                         Y +  E     PV
Sbjct: 122 -DEKDS-------SDTISKDSS-------------------------YDSDLEANQVIPV 148

Query: 191 KEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKG 250
            +  P     ++  E  + ++I  G  P N  A        K+ Y+++            
Sbjct: 149 NDSRPGKQ--HFSHEEDHQDAIQIG-TPANDKA--------KEQYTNQ------------ 185

Query: 251 IEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLG 310
                       + AVFILEFGI+FHS+F+GLSL+V+G+EF TLFIVL FHQMFEGLGLG
Sbjct: 186 ------------VFAVFILEFGILFHSIFIGLSLAVSGDEFHTLFIVLIFHQMFEGLGLG 233

Query: 311 TRVAETNWPES--KRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSI 368
           TRVAETNWP+S  K++TPWLMGLAFT  +P+A+AIG+GVRHSWVPGSRRALIANGVFDS+
Sbjct: 234 TRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIGLGVRHSWVPGSRRALIANGVFDSL 293

Query: 369 SSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           SSGILIYTGLVELMAHEFLYSNQFKGP G KKML AYF MCCGA +MALLGKWA
Sbjct: 294 SSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYAYFFMCCGAGIMALLGKWA 347

>KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.325
           YLR130C
          Length = 395

 Score =  454 bits (1167), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 251/426 (58%), Positives = 315/426 (73%), Gaps = 45/426 (10%)

Query: 4   LVVRDDST---DSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60
           L  RDD +    +C  +N+Y+G + LRIL++FIILISS +G +FPILSS+YSFIRLP+WC
Sbjct: 8   LFKRDDDSGPAPACADTNEYDGRSNLRILSIFIILISSAMGSFFPILSSKYSFIRLPDWC 67

Query: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120
           FF+AKFFGSGVIVATAFVHLLQPA EAL DECL GTF  YPWAFGICLMSLFLLF  E++
Sbjct: 68  FFLAKFFGSGVIVATAFVHLLQPANEALTDECLTGTFQSYPWAFGICLMSLFLLFLMELV 127

Query: 121 THYFVAKTLGH---DHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAV-YSIHNNKI 176
           +HY +AKT GH   DH D       D+     ES       +  SL+  ++ + +++N  
Sbjct: 128 SHYLIAKTFGHAAHDHSDFGNFVRKDSKELIDES-------DSESLHKGSLRFEVNSNSA 180

Query: 177 PYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYS 236
           P     E+I      E++P++ +       GN++ +A              S+PGK HY 
Sbjct: 181 P----EEDI------EENPHTIL-------GNSDKMA--------------SMPGKGHYD 209

Query: 237 HENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFI 296
           H  +HQD ++LG  +EE +KE+Y NQ++AV  LEFGI+FHSVF+GLSL+VAG+EF+TLFI
Sbjct: 210 HAVFHQDPAQLGSPLEEPNKEKYANQIMAVLFLEFGILFHSVFIGLSLAVAGDEFKTLFI 269

Query: 297 VLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSR 356
           VL FHQMFEGLGLGTR+AET WPE++R TPW++ L FTLT+P+A+AIG+GVRHS++PGSR
Sbjct: 270 VLVFHQMFEGLGLGTRIAETKWPENRRLTPWMLALGFTLTTPVAIAIGLGVRHSFIPGSR 329

Query: 357 RALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMA 416
           +AL++NGVFDSISSGILIYTGLVELMAHEFLYSNQF G DG KKM+ AY IMC G  LMA
Sbjct: 330 KALVSNGVFDSISSGILIYTGLVELMAHEFLYSNQFNGADGFKKMILAYVIMCFGVGLMA 389

Query: 417 LLGKWA 422
           LLGKWA
Sbjct: 390 LLGKWA 395

>KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 414

 Score =  451 bits (1159), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 231/409 (56%), Positives = 287/409 (70%), Gaps = 41/409 (10%)

Query: 16  ASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVAT 75
           + NDY+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP+WCFFIAKFFGSGVIVAT
Sbjct: 45  SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT 104

Query: 76  AFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDHGD 135
            F+HLL+PAA+ALG+ECLGGTFA+YPWAFGICLMSLF LF +E +  Y+  K+ G     
Sbjct: 105 GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYG----- 159

Query: 136 NEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKEKDP 195
                                        N+ V+S      P +   + +     ++ D 
Sbjct: 160 ---------------------------FQNDHVHS----HFPSSKDQKSLEDEDDEDSDK 188

Query: 196 NSNVINYDLETGNTESIANGLIPMNSHATN-LTSVPGKDHYSHENYHQDASELGKGIEEE 254
            + V++   E   + ++AN        ATN   S+PG +H+SH+  HQD + +G   +  
Sbjct: 189 YNQVVD---EENVSLTVANNNNGAEITATNPHPSMPGSNHFSHDKSHQDLATIGTPAQMT 245

Query: 255 DKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGLGLGTRV 313
            KE+Y NQ+L+VFILEFGIIFHSVF+GL+L+V G +EF TLFIVL FHQMFEG+GLG R+
Sbjct: 246 SKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARI 305

Query: 314 AETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGIL 373
           AE +W +  R+TPWL+   FTLT+PIA+AIGIGVRHS+ PGSR ALIANG FD+IS+GIL
Sbjct: 306 AEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGIL 365

Query: 374 IYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           IYTGLVELMAHEFLYS+ FKG +GLKKML A+F MC GA LMALLGKWA
Sbjct: 366 IYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414

>TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  442 bits (1137), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 222/410 (54%), Positives = 283/410 (69%), Gaps = 50/410 (12%)

Query: 14  CQASNDYNGHA-GLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVI 72
           C   +DY+G +  LRILAVF++LISSGLG +FPILSS+YS IRLPNWCFFIAKFFGSGVI
Sbjct: 23  CDIESDYDGQSDNLRILAVFMVLISSGLGSFFPILSSKYSVIRLPNWCFFIAKFFGSGVI 82

Query: 73  VATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHD 132
            ATAF+HLL+PA + LG++CLGGTFAEYPWAFGICLMSLF LF  EI+TH+ + K     
Sbjct: 83  TATAFIHLLEPATDELGNDCLGGTFAEYPWAFGICLMSLFTLFLVEIVTHHLMEK----- 137

Query: 133 HGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKE 192
                                     N A +    V  +H+ +I  +    +      K 
Sbjct: 138 --------------------------NVAGVTPNKVVHMHD-EISSSDEGFD------KV 164

Query: 193 KDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIE 252
            D N      +LE  NT+     L   +    +   + G +HYSH  +HQD  ++   +E
Sbjct: 165 DDVN------ELEVTNTQ-----LTTASEDRIDFNPIIGANHYSHAEHHQDIEQMNSALE 213

Query: 253 EEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTR 312
           E  KE Y +Q++++ ILEFG+IFHS+FVGLSL+V+G+EF+TLF+V+ FHQMFEGLGLG+R
Sbjct: 214 ETGKESYSSQIVSLLILEFGVIFHSIFVGLSLAVSGDEFKTLFVVIIFHQMFEGLGLGSR 273

Query: 313 VAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGI 372
           +AE NW     YTPWL+ L FT+ +PIA+AIGIGVR+S+ PGSR ALI++G+FDS+S+GI
Sbjct: 274 IAEQNWGVRNTYTPWLLALGFTVATPIAIAIGIGVRYSYFPGSRNALISSGIFDSLSAGI 333

Query: 373 LIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           LIYTGLVELMAHEFL+S QF+G +G KKML AY  MCCG ALMAL+GKWA
Sbjct: 334 LIYTGLVELMAHEFLFSKQFQGENGFKKMLLAYVCMCCGCALMALIGKWA 383

>TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score =  433 bits (1113), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 233/455 (51%), Positives = 292/455 (64%), Gaps = 71/455 (15%)

Query: 4   LVVRDDSTDS--CQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCF 61
           L  RDDST +  C   NDY+G   LRILAVF++LISS +GV+FPIL+SRYSFIR+P   F
Sbjct: 8   LYRRDDSTPTPACPTQNDYDGRDNLRILAVFMLLISSSIGVFFPILASRYSFIRIPPIFF 67

Query: 62  FIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIIT 121
           FIAKFFGSGVIVATAF+HLLQPA + L D CLGG + EYPWAFGICLM+LFL+FF+E++ 
Sbjct: 68  FIAKFFGSGVIVATAFIHLLQPAYDELNDPCLGGVWQEYPWAFGICLMALFLIFFSELMA 127

Query: 122 HYFVAKT---------------------LGHDHG-DNEG---------VGTVDADIASSE 150
           HYF+ +                       GH HG DNE          VG+   D+ S E
Sbjct: 128 HYFIERNERKNGGKVPDPHASHFRNPEFRGHKHGADNESGEMMEKEDQVGSPSDDLESQE 187

Query: 151 S---AVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKEKDPNSNVINYDLETG 207
           +     R+ G +         Y  +N +      + E V +    K+ N     +++E  
Sbjct: 188 NDSIVERDAGASDE-------YRFYNEEEDVKRGDRENVHSVADGKNENLVFSEHNVEVS 240

Query: 208 NTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVF 267
                ++GL                  ++ E   +D S            +Y+ ++++V 
Sbjct: 241 EDSEDSDGL------------------FAAERKPEDVS----------NSEYVRELVSVM 272

Query: 268 ILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPW 327
           ILE GII HS+F+GLSLSVAG+EF+TLF+VL FHQMFEGLGLGTRVAE  WP SKRYTPW
Sbjct: 273 ILESGIIAHSIFIGLSLSVAGKEFDTLFVVLIFHQMFEGLGLGTRVAEVEWPYSKRYTPW 332

Query: 328 LMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFL 387
           ++G  F +T+PI+ AIGIGVRHSWVPGSR ALI NG+FDSIS+GILIYTGLVELMAHEFL
Sbjct: 333 ILGACFGVTTPISAAIGIGVRHSWVPGSRSALIVNGIFDSISAGILIYTGLVELMAHEFL 392

Query: 388 YSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           Y+N F+G + LKK+L AYF+MCCG  LMALLGKWA
Sbjct: 393 YANNFEGKNSLKKLLLAYFVMCCGCGLMALLGKWA 427

>KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low- zinc conditions by
           the Zap1p transcription factor
          Length = 361

 Score =  400 bits (1027), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 205/411 (49%), Positives = 267/411 (64%), Gaps = 63/411 (15%)

Query: 12  DSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGV 71
           + C  SN+++G  GLR+ A+F+I+ SS LG +FPI++S YS + LP+WCFF+AKFFGSGV
Sbjct: 14  EQCSTSNEFDGREGLRVGALFVIMASSALGAFFPIMASNYSAVSLPDWCFFVAKFFGSGV 73

Query: 72  IVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGH 131
           I+AT FVHLLQPA EAL D CL GTF +YPWAFGICLMSL+ +F  EI+TH+ +++    
Sbjct: 74  IIATGFVHLLQPANEALTDPCLTGTFQDYPWAFGICLMSLYAIFLVEIVTHHMLSRV--- 130

Query: 132 DHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVK 191
                       A   S+  A  + G +   +++E              R  E+      
Sbjct: 131 ------------APAYSATEARAHSGSDATCMDDE-------------LRLSEL------ 159

Query: 192 EKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGI 251
                      DL +   E                 S PG D    +  +Q+A  +    
Sbjct: 160 ----------QDLRSKPQE----------------MSKPGSDG---DAVYQEAHRVLSAS 190

Query: 252 EEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGT 311
                E +L+Q++ VFILEFG+IFHSVF+GLSL+V+G EF TLFIVL FHQMFEGLGLGT
Sbjct: 191 SSTVTEGFLSQVVTVFILEFGVIFHSVFIGLSLAVSGSEFITLFIVLIFHQMFEGLGLGT 250

Query: 312 RVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSG 371
           R+AE +WP +KRYTPW++ L F++++PIA+AIG+GVRHS    SR  LIANG FD+ISSG
Sbjct: 251 RIAEISWPANKRYTPWILALGFSISTPIAIAIGLGVRHSLSTNSRSGLIANGCFDAISSG 310

Query: 372 ILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           ILIYTGLVELMAHEF++S+QFKGP GLKKML A+ +MC G+ LMALLG+WA
Sbjct: 311 ILIYTGLVELMAHEFIFSSQFKGPGGLKKMLFAFTMMCAGSGLMALLGRWA 361

>Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {ON}
           complement(43032..44207) [1176 nt, 392 aa]
          Length = 391

 Score =  399 bits (1024), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 205/429 (47%), Positives = 276/429 (64%), Gaps = 46/429 (10%)

Query: 1   MIDLVVR-------DDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSF 53
           +IDL+VR       D     C A+N+YNG   LRIL+VF+ILISS +G + P++ S    
Sbjct: 2   VIDLLVRAVEESTNDPQVPVCAANNEYNGDLNLRILSVFMILISSAIGSFAPLILSNTKM 61

Query: 54  IRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFL 113
             +P+W FFIAKFFGSGVI+AT+F+HLL PA +AL ++CLG  F +YPW+F I L+SLF+
Sbjct: 62  FNVPSWFFFIAKFFGSGVIIATSFIHLLSPATDALSNDCLGPGFTDYPWSFAIALISLFV 121

Query: 114 LFFTEIITHYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHN 173
           LFF E+I +++++K                AD       V               Y  H+
Sbjct: 122 LFFVELIVYHYMSK----------------ADRLLQSPDVH--------------YHKHS 151

Query: 174 NKIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKD 233
           +   +   +++       +K  N   +N D+E+ N     + +       TN   + GKD
Sbjct: 152 SMNSHGCTDDQ--SDLASKKSKNIEKVNEDIESCNINDNQDEI------NTNFNPMLGKD 203

Query: 234 HYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFET 293
           H+SH++ HQD +     +   D E + NQ++AV   E GI+FHSVF+GLSL+VAG EF+T
Sbjct: 204 HFSHKDTHQDRNPSNPPLNNTD-EGFYNQLVAVLFFESGIVFHSVFIGLSLAVAGSEFKT 262

Query: 294 LFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVP 353
           LF+VL FHQMFE LGLG R+ E  W + KR+ PWL+ L F+L +PIA+AIGIGVR+SW P
Sbjct: 263 LFVVLVFHQMFEALGLGARLVEVEWKKDKRWMPWLLALGFSLCTPIAIAIGIGVRNSWTP 322

Query: 354 GSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAA 413
            S+ ALI NG+FDSIS+GILIYTGLVEL+AHEFL+SNQFK P+G K+M+ AYF+MC GA 
Sbjct: 323 ESKGALITNGIFDSISAGILIYTGLVELIAHEFLFSNQFKNPNGFKQMMLAYFVMCIGAG 382

Query: 414 LMALLGKWA 422
           LMALLGKWA
Sbjct: 383 LMALLGKWA 391

>Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii AGL143C
          Length = 375

 Score =  389 bits (1000), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/415 (46%), Positives = 265/415 (63%), Gaps = 67/415 (16%)

Query: 9   DSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFG 68
           +    C+  N Y+G   LR++A+F+ILI+S +G  FP+LS+ YS IRLP++CFF AK+FG
Sbjct: 27  EEVPQCEVGNSYDGQDHLRVVAIFVILITSAIGTIFPLLSTNYSRIRLPSYCFFFAKYFG 86

Query: 69  SGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKT 128
           SGVIVAT F+HLLQPA E L +ECLGG FA+YPWAF IC+M+LF LFF EI TH+FV K+
Sbjct: 87  SGVIVATGFIHLLQPANENLSNECLGGVFAQYPWAFAICMMALFSLFFVEINTHHFVHKS 146

Query: 129 LGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGT 188
                                                        N++     N  + G 
Sbjct: 147 ---------------------------------------------NRL---AENGNVSGK 158

Query: 189 PVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELG 248
            +K++D         L++   ++  + L P           PG  H+SH+ YHQD  +  
Sbjct: 159 SLKDEDS-------QLDSKAADAPTSVLGP-----------PGNKHFSHDEYHQDIEQAN 200

Query: 249 KGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSV-AGEEFETLFIVLTFHQMFEGL 307
                 +KEQY NQ++++FILEFG++FHS+ +GL+L+V + EEF TLF+VL FHQMFEGL
Sbjct: 201 GLATNPNKEQYSNQLISLFILEFGVVFHSILIGLALAVSSSEEFVTLFVVLIFHQMFEGL 260

Query: 308 GLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDS 367
           GLGTR+AE +W   K  TPWL+   ++L +P+A+A+G+G++HS+ P SR++LI NG+FD+
Sbjct: 261 GLGTRIAEASWGSGKSLTPWLLAFGYSLATPLAIAVGLGIKHSFAPESRQSLIVNGIFDA 320

Query: 368 ISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           IS+G+LIYTGL+ELMAHEFL+SN FKG +G  KM+  + IMC GA  M+LLG+WA
Sbjct: 321 ISAGVLIYTGLIELMAHEFLFSNSFKGENGYTKMMYGFIIMCFGAGSMSLLGRWA 375

>AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR130C
           (ZRT2) and YGL255W (ZRT1)
          Length = 374

 Score =  384 bits (986), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 263/417 (63%), Gaps = 64/417 (15%)

Query: 7   RDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKF 66
             +  + C   N+Y+G  G+RIL+VFIIL++S +G +FP+L SR+S +RLP W FF AK+
Sbjct: 21  HSEEPEECPTENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKY 80

Query: 67  FGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVA 126
           FGSGVIVAT F+HLL    E+L + CLGG  +EYPWAF IC+MSLF LFF EI +H+FV 
Sbjct: 81  FGSGVIVATGFIHLLLHGHESLSNPCLGGVLSEYPWAFAICMMSLFTLFFVEINSHHFV- 139

Query: 127 KTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIV 186
                    N+   +    +A  E +++                           +E   
Sbjct: 140 ---------NKAARSTAVAVAGDEKSIK--------------------------EDESTE 164

Query: 187 GTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASE 246
            TP K   PN+ V      +G   ++ +                   H++H+  HQD  +
Sbjct: 165 DTPPK---PNTAV------SGANSAVVS------------------QHFAHDECHQDLEQ 197

Query: 247 LGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEE-FETLFIVLTFHQMFE 305
                 + ++EQYLNQ++++FILEFG++FHSV +GLSL+V  E+ F TLF+VL FHQMFE
Sbjct: 198 AKSLAADPNREQYLNQLISLFILEFGVVFHSVLIGLSLAVTAEDHFTTLFVVLIFHQMFE 257

Query: 306 GLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVF 365
           G+GLG R+AET W   +++TPWL+GL + L++PIA+AIG+GVRHS+ P SR +LI NGVF
Sbjct: 258 GMGLGARIAETEWGVHRKWTPWLLGLGYCLSTPIAIAIGLGVRHSFAPESRPSLIVNGVF 317

Query: 366 DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           DS+S+GI++YTGL+ELMAHEFL+SN FKG  G  KM+  +  MC GA LMALLGKWA
Sbjct: 318 DSLSAGIMLYTGLIELMAHEFLFSNSFKGEGGFNKMMQGFVYMCLGAGLMALLGKWA 374

>SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 379

 Score =  373 bits (957), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/417 (47%), Positives = 263/417 (63%), Gaps = 69/417 (16%)

Query: 8   DDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFF 67
           D  + +C   + YNG+ G+RILAVFI+LISS +G + P+L S+YSFIRLP+W FFIAK+F
Sbjct: 30  DGDSSACPGGSGYNGNDGIRILAVFILLISSAIGSFSPLLGSKYSFIRLPDWFFFIAKYF 89

Query: 68  GSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAK 127
           GSGVI+AT F+HLL  ++ +LG+ECLG  F  YPWA+ ICL S+F +FF E++ H    K
Sbjct: 90  GSGVIIATGFIHLLFHSSHSLGEECLGDGFTSYPWAYLICLASIFTVFFVELLAHRLFIK 149

Query: 128 TLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVG 187
                              ASS+SA           + E   S + ++  Y   +  +V 
Sbjct: 150 -------------------ASSDSAS----------DLEFAESNNTSEENYPKNSAVMVS 180

Query: 188 TPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSH--ENYHQDAS 245
               ++D  S+V++            NGL             P KD  S   ENY  + S
Sbjct: 181 KSETQQDDTSSVLD------------NGL-------------PLKDEQSESSENYKNNGS 215

Query: 246 ELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFE 305
                        +  Q++A+F+LEFG++FHSVFVGLSL+VAG+EF TLFIVL FHQMFE
Sbjct: 216 -------------HSTQLIAIFVLEFGVLFHSVFVGLSLAVAGDEFNTLFIVLIFHQMFE 262

Query: 306 GLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVF 365
           GLGLG R+AETNWP  +R+TPW++ LAF + +PI++AIGIGV+ S+ P S R+LI  GVF
Sbjct: 263 GLGLGARIAETNWPHKRRFTPWMLALAFAVCTPISIAIGIGVKKSYAPYSSRSLIFTGVF 322

Query: 366 DSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           D+IS+GILIY G+VELMAHEF +   F+GP  LK ML A+FIMC GA LM+LLGKWA
Sbjct: 323 DAISAGILIYAGIVELMAHEFFHETTFQGPGKLKSMLWAFFIMCLGAGLMSLLGKWA 379

>YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}
           ZRT1High-affinity zinc transporter of the plasma
           membrane, responsible for the majority of zinc uptake;
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 376

 Score =  239 bits (610), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 154/429 (35%), Positives = 221/429 (51%), Gaps = 91/429 (21%)

Query: 8   DDSTDSCQ------ASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCF 61
           DD   +C         N+YNG+ G RI +VF+IL  S     FP++S++   +R+P + +
Sbjct: 25  DDVWKTCVLQGVYFGGNEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVY 84

Query: 62  FIAKFFGSGVIVATAFVHLLQPAAEALG-DECLG--GTFAEYPWAFGICLMSLFLLFFTE 118
             AK+FGSGVIVATAF+HL+ PA  A+G   C+G  G +  Y W   I L SL   F T+
Sbjct: 85  LFAKYFGSGVIVATAFIHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTD 144

Query: 119 IITHYFVAKTLG--HDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKI 176
           + +  +V +  G  HDH  +E            ++ VRN     +  +NE          
Sbjct: 145 LFSSVWVERKYGLSHDHTHDE----------IKDTVVRNTAAVSSENDNEN--------- 185

Query: 177 PYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYS 236
                     GT     D  + V  Y+                +S AT++  V       
Sbjct: 186 ----------GTANGSHDTKNGVEYYE----------------DSDATSMDVV------- 212

Query: 237 HENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFI 296
                               + +  Q  A  ILEFG+IFHSV +GL+L   G+EF +L+ 
Sbjct: 213 --------------------QSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSLYP 252

Query: 297 VLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSR 356
           VL FHQ FEGLG+G R++   +P SKR+ PW + +A+ LT+PI VAIG+GVR  +V GS 
Sbjct: 253 VLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIGLGVRTRYVSGSY 312

Query: 357 RALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCC---GAA 413
            AL+ +GV D+IS+GIL+YTGLVEL+A +F+++     P   K +    F + C   GA 
Sbjct: 313 TALVISGVLDAISAGILLYTGLVELLARDFIFN-----PQRTKDLRELSFNVICTLFGAG 367

Query: 414 LMALLGKWA 422
           +MAL+GKWA
Sbjct: 368 IMALIGKWA 376

>TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  222 bits (566), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 138/408 (33%), Positives = 213/408 (52%), Gaps = 70/408 (17%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N+YNG  G RI ++F+IL+ S     +P+++ R  ++++  W +  A+ FG GVI+ATAF
Sbjct: 41  NEYNGWMGARISSIFVILVLSTCCTLYPVVAKRVKWLKINKWFYSFARNFGIGVIIATAF 100

Query: 78  VHLLQPA-AEALGDECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDHG 134
           +HLL PA AE  G  C+G  G ++ Y W   I L+++FL F T++ +  +V K  G  H 
Sbjct: 101 IHLLDPAYAEIGGLSCVGMTGNWSIYAWCPAIMLLTIFLTFLTDLFSAVYVEKKYGKTHQ 160

Query: 135 DNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKEKD 194
            +                                              +EI  T V   +
Sbjct: 161 HD---------------------------------------------FDEIEQTIVSPAE 175

Query: 195 PNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIEEE 254
           P       D E    E   +     + H +N       D ++  +     +++       
Sbjct: 176 PVQ-----DFERSQVEEDCD-----HDHHSNTKDKKSIDTFTDSDVDSTTADM------- 218

Query: 255 DKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVA 314
               + ++  A  ILEFG++FHSV +GL+L   GEEF TL+ VL FHQ FEGLG+G R++
Sbjct: 219 ---SFKSEFAAFLILEFGVLFHSVMIGLNLGSVGEEFSTLYPVLVFHQSFEGLGIGARLS 275

Query: 315 ETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILI 374
             ++P++KR+ P+ + LA+ LT+PI VAIG+GVR ++   S    + +GV D+IS+G+LI
Sbjct: 276 AIDFPQNKRWWPYALCLAYGLTTPICVAIGLGVRTTYNGESYVVNVVSGVLDAISAGVLI 335

Query: 375 YTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           YTGLVE++A ++L+ N  +  D L+ +      M  GA LMALLGKWA
Sbjct: 336 YTGLVEMLARDYLF-NPHRTKD-LRLLSFNVMSMLWGAGLMALLGKWA 381

>ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 381

 Score =  222 bits (565), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 130/408 (31%), Positives = 219/408 (53%), Gaps = 73/408 (17%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N+YNG+ G RI ++F+IL++S     FP+++ + S++R+  + +  A+ FG+GVI+ATAF
Sbjct: 44  NEYNGNLGARISSIFVILVTSSALTLFPLIAKKVSWLRVHKYVYLFARSFGTGVILATAF 103

Query: 78  VHLLQPAAEALGD-ECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDHG 134
           +HL+ PA + +G   C+   G ++ Y W   I L +++  F  ++    +V +  G  H 
Sbjct: 104 IHLMDPAYQEIGGFSCVAQVGNWSLYSWCPAIMLTTVYFTFLVDLFGGVYVERKYGIAHS 163

Query: 135 DNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKEKD 194
           ++     +DA IA          P+           +H++   +    E +  + + +KD
Sbjct: 164 EDHD-HAMDAVIA----------PH-----------VHDDSHLHNMNKETVDDSSLSKKD 201

Query: 195 PNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIEEE 254
                 + D+   +++     +I   S                                 
Sbjct: 202 ------SVDVSVRSSQDTLEKVISFKS--------------------------------- 222

Query: 255 DKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVA 314
                  +  A  +LEFG++FHSV +GL+L   G+EF TL+ VL FHQ FEGLG+G R++
Sbjct: 223 -------EFSAFLVLEFGVLFHSVMIGLNLGTTGDEFSTLYPVLVFHQAFEGLGIGARLS 275

Query: 315 ETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILI 374
             ++P +KR+ P+++ +A+ LT+PIA+AIG+GVR S+   S    + +GV D+IS+GIL+
Sbjct: 276 AIDFPHNKRWWPYVLCMAYGLTTPIAIAIGLGVRKSYQSNSYAVNVVSGVLDAISAGILL 335

Query: 375 YTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           YTGLVEL+A +FL++ Q      L++++   F +  G  LMALLGKWA
Sbjct: 336 YTGLVELLARDFLFNRQ--RAKTLRELIFNLFCLSWGVGLMALLGKWA 381

>KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON}
           similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 376

 Score =  215 bits (548), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/413 (33%), Positives = 217/413 (52%), Gaps = 84/413 (20%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N Y+G  G RI ++F+IL  S     FP++++R   +++P + +  A++FG+GVIVATAF
Sbjct: 40  NSYSGSLGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAF 99

Query: 78  VHLLQPAAEALGDE-CLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132
           +HLL PA   +G + C+G  G +++Y +   I L ++F +F  ++ +  +V +  G  H 
Sbjct: 100 IHLLDPAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRFGITHG 159

Query: 133 HGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKE 192
           HGD                                                EI    VK 
Sbjct: 160 HGD------------------------------------------------EIENAIVKR 171

Query: 193 KDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIE 252
           ++  +N  N D+E               SH  NL      D  S ++Y      +     
Sbjct: 172 QEATNN--NVDIE---------------SH--NLGHSADSDDKSKKSYDV----VSNAST 208

Query: 253 EEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTR 312
           E   + + +Q+ A  ILEFG+IFHSV +GL+L    +EF TL+ VL FHQ FEGLG+G R
Sbjct: 209 EIVTQSFESQIGAFLILEFGVIFHSVMIGLNLGTTDDEFSTLYPVLVFHQSFEGLGIGAR 268

Query: 313 VAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGI 372
           ++   +P++K + P+ + +A+ LT+PI VAIG+GVR ++   S    + +GV D+IS+GI
Sbjct: 269 LSAIEFPKNKWWWPYALCVAYGLTTPICVAIGLGVRTTYDGNSYTVNVVSGVLDAISAGI 328

Query: 373 LIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCC---GAALMALLGKWA 422
           L+YTGLVEL+A +F++       + + K+L   F++ C   GA LMALLGKWA
Sbjct: 329 LMYTGLVELLARDFIFDEN--RTNDISKLL---FMVNCTLWGAGLMALLGKWA 376

>KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 392

 Score =  214 bits (545), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/413 (32%), Positives = 215/413 (52%), Gaps = 89/413 (21%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           ++Y G    RI ++F+IL  S      P++ ++   I++P  C+  A++FG+GVI+ATAF
Sbjct: 61  SEYQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKACYLFARYFGTGVIIATAF 120

Query: 78  VHLLQPAAEALG-DECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132
           +HL++ +  ++G + C+G  G +A+Y W  GI L ++F++F  ++++  ++ +  G    
Sbjct: 121 IHLMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVVFLVDLLSEVYIERKFGISCS 180

Query: 133 HGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKE 192
           HGD              E A+ +                 NN  P    N+   G+PV  
Sbjct: 181 HGD------------LVEGAISD-----------------NN--PRLKENDAETGSPVIS 209

Query: 193 KDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIE 252
              N + ++YD+ +G    IA                                       
Sbjct: 210 ---NKDDVSYDVVSGVNSEIA--------------------------------------- 227

Query: 253 EEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTR 312
               + + +Q+ A  ++EFGIIFHSV +GL L   GEEF  L+ V+ FHQ FEGLG+G R
Sbjct: 228 ---VKPFESQIGAFLVMEFGIIFHSVMIGLELGTTGEEFSILYPVIVFHQSFEGLGIGAR 284

Query: 313 VAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGI 372
           +    +PE K++ P+ + + +  T+PIA+AIG+GVR S+   S +  I +GV D+I++GI
Sbjct: 285 LISIAFPEGKKWWPYALCILYGATTPIAIAIGLGVRMSYNAHSFKMSIISGVLDAIAAGI 344

Query: 373 LIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCC---GAALMALLGKWA 422
           LIYTGLVEL+A +F++      P+  K +    F++ C   GA LMALLG+WA
Sbjct: 345 LIYTGLVELLARDFMFD-----PNRTKNLKKLTFMIICTFSGAGLMALLGRWA 392

>ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]
           {ON} similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 399

 Score =  208 bits (529), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/425 (32%), Positives = 218/425 (51%), Gaps = 61/425 (14%)

Query: 8   DDSTDSCQASNDY------NGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCF 61
           DDS   C     Y      NG  G RI ++F+I I+S     FP+++ +  ++R+  + +
Sbjct: 26  DDSWKYCVLQGVYWGSPEDNGVTGARISSIFVIFITSTALSLFPVVAQKVPWLRIHRYVY 85

Query: 62  FIAKFFGSGVIVATAFVHLLQPAAEALGD-ECLG--GTFAEYPWAFGICLMSLFLLFFTE 118
             A+ FG+GVIV+T+++HL+ PA + +G   C+   G ++ Y W   I L ++F  F  +
Sbjct: 86  QFARSFGTGVIVSTSYIHLMDPAYQEIGGYSCIAQTGNWSIYSWCPAIMLTTVFATFLVD 145

Query: 119 IITHYFVAKTLGHDHGDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPY 178
           + +  +V +  G  H +N      D    +   A +    +P   N   + S+ N+  PY
Sbjct: 146 LFSAVYVERKYGVVHEENG-----DEVANAITHAAKKSNQSPVDNNQMELESLPNSGNPY 200

Query: 179 TTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHE 238
           +          V+  D N   I+ D     T+S A                         
Sbjct: 201 SG---------VQTMDNNDEKISTD-----TQSYA------------------------- 221

Query: 239 NYHQDASELGKGIEEEDKEQYLNQMLAVF-ILEFGIIFHSVFVGLSLSVAGEEFETLFIV 297
                 SE  +   E+D E+     L  F +LE G++FHSV +GL+L   G+EF TL+ V
Sbjct: 222 -----LSESSRSENEQDVERRFRADLGAFMVLEAGLLFHSVMIGLNLGTIGDEFSTLYAV 276

Query: 298 LTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRR 357
           L FHQ FEGLG+G R+    +P  K + P+ + LA+ LT+PI VAIG+GVR S+   S  
Sbjct: 277 LVFHQSFEGLGIGARLCAITFPRDKWWWPYALCLAYGLTTPICVAIGLGVRKSYSSNSYS 336

Query: 358 ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMAL 417
             + +G+ DSIS+GIL+YTGLVEL+A ++++ N  +  D L+++      +  GA LMAL
Sbjct: 337 VNVVSGILDSISAGILMYTGLVELLARDYMF-NAHRTKD-LRELFFNVASILTGAGLMAL 394

Query: 418 LGKWA 422
           LGKWA
Sbjct: 395 LGKWA 399

>Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  172 bits (436), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 132/208 (63%), Gaps = 16/208 (7%)

Query: 220 NSHATNLTSVPGKDHYSHENYHQ--DASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHS 277
           N+   N T+    D  +   Y +  DAS L      +  + + +Q  A  ILEFG+IFHS
Sbjct: 176 NTSDENGTANRSYDDKNKVEYFEESDASTL------DTVQSFQSQFYAFLILEFGVIFHS 229

Query: 278 VFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTS 337
           V +GL+L   GEEF TL+ VL FHQ FEGLG+G R++   +P+SKR+ PW + +A+ LT+
Sbjct: 230 VMIGLNLGSTGEEFATLYPVLVFHQSFEGLGMGARLSGIEFPKSKRWWPWALCIAYGLTT 289

Query: 338 PIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDG 397
           PI VAIG+G+R  +V GS  A + +GV D+IS+GILIYTGLVEL+A +FL++     P  
Sbjct: 290 PICVAIGLGIRTKYVSGSYTASVVSGVLDAISAGILIYTGLVELLARDFLFN-----PHR 344

Query: 398 LKKMLSAYFIMCC---GAALMALLGKWA 422
            K M    F + C   GA +MAL+GKWA
Sbjct: 345 TKDMKELSFNVLCTLFGAGIMALIGKWA 372

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 7/147 (4%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N+YNG+ G RI ++F+I + S     FP++S R    ++P + +  AK+FGSGVIVATAF
Sbjct: 41  NEYNGNLGARISSIFVIFVVSTFFTLFPLISLRVKRFKIPLYAYLFAKYFGSGVIVATAF 100

Query: 78  VHLLQPAAEAL-GDECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132
           +HL+ PA  A+ G+ C+G  G ++ Y W   I L SLF  F T++ +  +V +  G  HD
Sbjct: 101 IHLVDPAYSAIGGNSCVGQTGDWSLYAWCPAIMLTSLFFTFLTDLFSSVWVERKYGVAHD 160

Query: 133 HGDNEGVGTVDADIASSESAVRNGGPN 159
           H  +    TV  D A++     NG  N
Sbjct: 161 HTHDTIKDTVVNDAANTSD--ENGTAN 185

>Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  171 bits (432), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 117/169 (69%), Gaps = 8/169 (4%)

Query: 257 EQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAET 316
           + +  Q  A  ILEFG+IFHSV +GL+L   GEEF TL+ VL FHQ FEGLG+G R++  
Sbjct: 209 QSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATLYPVLVFHQSFEGLGIGARLSAI 268

Query: 317 NWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILIYT 376
            +P SKR+ PW + +A+ LT+PI VAIG+GVR  +V GS  AL+ +GV D+IS+GIL+YT
Sbjct: 269 EFPRSKRWWPWALCIAYGLTTPICVAIGLGVRTRYVSGSYTALVISGVLDAISAGILLYT 328

Query: 377 GLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCC---GAALMALLGKWA 422
           GLVEL+A +F+++     P   K +    F + C   GA +MAL+GKWA
Sbjct: 329 GLVELLARDFIFN-----PQRTKNLKELSFNVICTLFGAGIMALIGKWA 372

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 7/146 (4%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N+YNG+ G RI +VF+IL  S     FP++S++   +++P + +  A++FGSGVIVATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKKLKIPLYAYLFARYFGSGVIVATAF 100

Query: 78  VHLLQPAAEAL-GDECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132
           +HL+ PA  A+ G+ C+G  G +  Y W   I L SL + F T++ +  +V K  G  HD
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYAWCPAIMLTSLTITFLTDLFSSVWVEKKYGLSHD 160

Query: 133 HGDNEGVGTV--DADIASSESAVRNG 156
           H  ++   TV  +  ++S E+   NG
Sbjct: 161 HTHDDVKDTVVNNEVVSSPENCTANG 186

>Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  170 bits (431), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 131/207 (63%), Gaps = 15/207 (7%)

Query: 225 NLTSVPGKDHYSHENYHQDASELGKGIEEEDK------EQYLNQMLAVFILEFGIIFHSV 278
           N  +V   +H +    H+  + + +  EE D       + +  Q  A  ILEFG+IFHSV
Sbjct: 172 NDAAVCSTEHGTASGSHESKNGV-EYFEESDASSMDVVQSFQAQFYAFLILEFGVIFHSV 230

Query: 279 FVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSP 338
            +GL+L   GEEF TL+ VL FHQ FEGLG+G R++   +P SKR+ PW + +A+ LT+P
Sbjct: 231 MIGLNLGSVGEEFSTLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTP 290

Query: 339 IAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGL 398
           I VAIG+GVR  +  GS  AL+ +G+ D+IS+GIL+YTGLVEL+A +F+++     PD  
Sbjct: 291 ICVAIGLGVRTRYNSGSYTALVVSGILDAISAGILLYTGLVELLARDFIFN-----PDRT 345

Query: 399 KKMLSAYFIMCC---GAALMALLGKWA 422
           K +    F + C   GA +MAL+GKWA
Sbjct: 346 KNLKELSFNVLCTLFGAGIMALIGKWA 372

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 87/146 (59%), Gaps = 7/146 (4%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N+YNG+ G RI +VF+IL  S     FP++S +   +R+P + +  AK+FGSGVI+ATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISKKVKKLRIPLYAYLFAKYFGSGVILATAF 100

Query: 78  VHLLQPAAEAL-GDECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132
           +HL+ PA  A+ G+ C+G  G +  Y W   I L SL   F T++ +  +V +  G  HD
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGVSHD 160

Query: 133 HGDNEGVGTV--DADIASSESAVRNG 156
           H  +E   TV  DA + S+E    +G
Sbjct: 161 HTHDEIKDTVVNDAAVCSTEHGTASG 186

>Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL255W
           (ZRT1) - high-affinity zinc transport protein [contig
           18] FULL
          Length = 389

 Score =  151 bits (382), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 112/167 (67%), Gaps = 4/167 (2%)

Query: 257 EQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAET 316
           + + +Q+ A F+LEFGIIFHSV +GL L   G EF  L+ V+ FHQ FEGLGLG R+   
Sbjct: 226 KSFESQIGAFFVLEFGIIFHSVMIGLELGTTGSEFSVLYPVIVFHQSFEGLGLGARLMSI 285

Query: 317 NWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSGILIYT 376
            +PE K++ P+ +   + +T+PIAVAIG+GVR ++   S    I +G+ D+IS+GILIYT
Sbjct: 286 KFPEGKKWWPYALCGLYGITTPIAVAIGLGVRLTYNAHSFTMSIISGILDAISAGILIYT 345

Query: 377 GLVELMAHEFLYS-NQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422
           GLVEL+A +F+++ N+ K    L  M+   F    GA LMA LGKWA
Sbjct: 346 GLVELLAKDFIFNPNRTKDMTKLSLMI---FATLSGAGLMAFLGKWA 389

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 83/140 (59%), Gaps = 3/140 (2%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           ++Y G    RI ++F++L  S      PI+ ++   +++P +C+  A++FG+GVIV+TAF
Sbjct: 60  SEYQGSLPARISSIFVLLFVSTSFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAF 119

Query: 78  VHLLQPAAEALG-DECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDHG 134
           +HL++ +  ++G + C+G  G +A+Y W   I ++++F++F  ++++  ++ +  G   G
Sbjct: 120 IHLMEHSYMSIGSNSCVGMTGHWADYTWCSCIVMVTVFVIFLVDLLSDVYIERKYGLTGG 179

Query: 135 DNEGVGTVDADIASSESAVR 154
             + +     D+   E+ V 
Sbjct: 180 HGDSIEEAITDVHKDENDVE 199

>Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON}
           YGL255W (ZRT1) - high-affinity zinc transport protein
           [contig 245] FULL
          Length = 374

 Score =  139 bits (350), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 106/169 (62%), Gaps = 9/169 (5%)

Query: 232 KDHYSHENY-HQDASELGK--------GIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGL 282
           +D  SH N+ H D+ +  K           E   E + +Q  A  ILEFG+IFHSV +GL
Sbjct: 177 EDLESHNNHMHADSDDKSKKSYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGL 236

Query: 283 SLSVAGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVA 342
           +L   G+EF  L+ VL FHQ FEGLG+G R++   +P+ K + P+ + + + L +PI VA
Sbjct: 237 NLGTVGDEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVA 296

Query: 343 IGIGVRHSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQ 391
           IG+GVR S+   S    I +GV D+IS+GILIYTGLVEL+A +F++  +
Sbjct: 297 IGLGVRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEK 345

 Score =  109 bits (272), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 81/123 (65%), Gaps = 5/123 (4%)

Query: 18  NDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAF 77
           N+YNG  G RI ++F+I   S L   FP++++R   IR+P + +  A++FG+GVIVATAF
Sbjct: 40  NEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATAF 99

Query: 78  VHLLQPA-AEALGDECLG--GTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLG--HD 132
           +HLL PA  E  GD C+G  G +A+Y W   I L+++F++F  ++ +  +V +  G  H+
Sbjct: 100 IHLLDPAYGEIGGDSCVGKTGHWADYSWCPAIVLLTIFIIFLVDLASDVYVKRRFGVAHN 159

Query: 133 HGD 135
           HGD
Sbjct: 160 HGD 162

>NDAI0G03980 Chr7 complement(947806..949518) [1713 bp, 570 aa] {ON}
           Anc_3.50
          Length = 570

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 9/91 (9%)

Query: 29  LAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIVATAFVHLLQPAAEAL 88
           +A+F+ L+   LG    +  SR   + LP W  +I  FF    I+AT         AE +
Sbjct: 118 IAIFLQLLCIKLGTVTGLDLSRACRMHLPKWMNYIIYFFAECAIIATDI-------AEVI 170

Query: 89  GDECLGGTFAEYPWAFG--ICLMSLFLLFFT 117
           G         + P   G  I +  +F++ FT
Sbjct: 171 GTAIALNILIKVPLPAGVAITVADVFIIMFT 201

>Kwal_27.12129 s27 complement(1099493..1106494) [7002 bp, 2333 aa]
            {ON} YPL085W (SEC16) - vesicle coat component [contig 23]
            FULL
          Length = 2333

 Score = 32.7 bits (73), Expect = 2.6,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 21/114 (18%)

Query: 202  YDLETGNTESIANGLIPMNSHATNLTSVPGKDHYSHENYHQDASELGKGIEEEDKEQYLN 261
            + +  GN++ +  GLI          S P K++++ +N+    S +   + +   +  L 
Sbjct: 1317 FQVSVGNSKRVIKGLI----------SDPSKENWAMQNWKIITSAVLNNMNQTGDKAELT 1366

Query: 262  QMLAVFILEFGIIFHSVFVGLSLSVAGEEFE--TLFIV----LTFHQMFEGLGL 309
            + + V  LEF + F     G+ L   G E E  T+F++    L+ H++  G G+
Sbjct: 1367 RTIPVLYLEFLLEF-----GVFLCQRGMEMEGYTIFVIADIPLSTHEVLPGSGI 1415

>SAKL0A02420g Chr1 (222751..223635) [885 bp, 294 aa] {ON} similar to
           uniprot|P40344 Saccharomyces cerevisiae YNR007C ATG3
           Protein involved in autophagy E2-like enzyme that plays
           a role in formation of Atg8p- phosphatidylethanolamine
           conjugates which are involved in membrane dynamics
           during autophagy
          Length = 294

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 55/146 (37%), Gaps = 28/146 (19%)

Query: 174 NKIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNLTSVPGKD 233
            K+P + R E++V T +  +D        D E      +     P   H   L+ V G  
Sbjct: 75  RKVPSSVRAEQLVATGLGSRD--------DTEENEDGWVVEDQAPFQKHQRELSDVFG-- 124

Query: 234 HYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAGEE--- 290
                   +D  E+ +G+EE D E+ L     V I      ++ +++  S S    +   
Sbjct: 125 --------EDIDEMLEGMEEHDDEEDL-----VAIAPNNKRYYDLYITYSTSYRVPKIYL 171

Query: 291 --FETLFIVLTFHQMFEGLGLGTRVA 314
             F +    LT  QMFE +    R  
Sbjct: 172 VGFNSDGSPLTPEQMFEDISPDYRTK 197

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,213,044
Number of extensions: 2076828
Number of successful extensions: 6376
Number of sequences better than 10.0: 75
Number of HSP's gapped: 6632
Number of HSP's successfully gapped: 100
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)