Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1988.324ON94394348680.0
Suva_10.2228.324ON94394346120.0
Smik_12.1928.324ON94394345650.0
YLR129W (DIP2)8.324ON94394345020.0
NCAS0C032608.324ON98395937670.0
SAKL0H15532g8.324ON94194736830.0
NDAI0G025808.324ON95896336730.0
Kpol_1036.698.324ON93694336010.0
KAFR0H022608.324ON93894635800.0
TDEL0F045008.324ON93894435700.0
TPHA0C008108.324ON93794235380.0
ZYRO0F10406g8.324ON93894335340.0
KLTH0G12276g8.324ON93794435120.0
TBLA0A039508.324ON93693635110.0
KNAG0G024508.324ON94294734990.0
CAGL0M04279g8.324ON94094234600.0
Kwal_56.239208.324ON93794434520.0
Ecym_42558.324ON93794334270.0
AGL196C8.324ON93594133770.0
KLLA0D16390g8.324ON93694631130.0
Smik_12.2798.435ON8177163382e-31
TDEL0B020108.435ON8056263353e-31
AGR180W8.435ON8066743264e-30
NCAS0C027108.435ON8156323221e-29
TBLA0I025708.435ON8486373184e-29
ZYRO0A09636g8.435ON8087013061e-27
Suva_10.3168.435ON8187222996e-27
CAGL0C00737g8.435ON8166752997e-27
NDAI0E034408.435ON8576112989e-27
Ecym_41348.435ON8102352702e-23
YLR222C (UTP13)8.435ON8173792641e-22
Skud_12.2858.435ON8172352595e-22
TPHA0M020006.363ON6994252585e-22
CAGL0C03608g6.363ON6433572566e-22
Ecym_25236.363ON6462792567e-22
AGL234W6.363ON6292792522e-21
KAFR0H017508.435ON7832352532e-21
TBLA0F042406.363ON7273292513e-21
SAKL0H12760g8.435ON8412012524e-21
KNAG0D002506.363ON6553842504e-21
Kwal_27.115858.435ON8232352515e-21
KNAG0A025108.435ON8492052515e-21
Kpol_1031.498.435ON7602352505e-21
YCR084C (TUP1)6.363ON7132832471e-20
Kpol_1028.236.363ON7442812471e-20
KLLA0F10263g6.363ON6822762461e-20
KLTH0E10120g8.435ON8262352462e-20
KLLA0F13244g8.435ON8142352452e-20
Skud_3.1566.363ON7132832442e-20
TDEL0A077806.363ON6572842442e-20
Smik_3.1836.363ON7092832433e-20
Suva_3.1216.363ON7002612381e-19
Kwal_23.64296.363ON7503162381e-19
KNAG0A037008.544ON8172952382e-19
TPHA0L010808.435ON8352382372e-19
SAKL0A00660g6.363ON6602882352e-19
NCAS0D047806.363ON6213152343e-19
CAGL0E00561g6.363ON8363402354e-19
NCAS0A055206.363ON6713392335e-19
NDAI0K023506.363ON7933712336e-19
ZYRO0D17292g6.363ON7182842318e-19
ZYRO0D01122g7.534ON4663142288e-19
NDAI0C054908.544ON8592292302e-18
KLTH0A07282g6.363ON7252842292e-18
AEL246C8.544ON8152942282e-18
KAFR0E031808.544ON8142952273e-18
KAFR0C047406.363ON6652822254e-18
TPHA0L016908.544ON8322192265e-18
ZYRO0A12980g8.544ON8243232246e-18
TBLA0H036208.544ON8122982246e-18
Ecym_70388.544ON8001752246e-18
CAGL0M05335g8.544ON8062972202e-17
Kpol_487.71.399ON3032852102e-17
SAKL0F15972g7.534ON4703002153e-17
TDEL0B030208.544ON8312952183e-17
KLTH0D04466g2.431ON3192032103e-17
Smik_2.3388.544ON8002162166e-17
YBR198C (TAF5)8.544ON7982162167e-17
ZYRO0E04620g1.399ON3032772061e-16
Skud_2.3248.544ON8023012131e-16
AEL269C7.534ON4552692101e-16
Kwal_23.53517.534ON4742452101e-16
NCAS0B022008.544ON8222842112e-16
Skud_14.3211.399ON3032772023e-16
SAKL0H09988g8.544ON7492162103e-16
TDEL0B059701.399ON3032832023e-16
Suva_14.3421.399ON3032772023e-16
TDEL0H003707.534ON4652522073e-16
KLLA0E23453g8.544ON8261752103e-16
KLTH0A00880g7.534ON4712452065e-16
Smik_14.3221.399ON3032772005e-16
YNL006W (LST8)1.399ON3032772005e-16
Suva_4.4528.544ON8002162085e-16
Kpol_1024.428.544ON8432162077e-16
Kwal_27.120538.544ON7552962051e-15
KAFR0A005102.431ON3191941981e-15
NCAS0F018502.431ON3182011971e-15
KLTH0E12606g8.544ON7552152013e-15
Kpol_1013.377.534ON4682741993e-15
KNAG0H016901.399ON3032771944e-15
TPHA0G023802.431ON3181941944e-15
Suva_13.2952.431ON3191951935e-15
Skud_13.2752.431ON3191951935e-15
Smik_13.3052.431ON3191951935e-15
YMR116C (ASC1)2.431ON3191951935e-15
NCAS0A151707.534ON4742741975e-15
NCAS0A042702.431ON3182011936e-15
TPHA0I032407.534ON4772231976e-15
NDAI0H027102.431ON3181971918e-15
SAKL0D08756g1.399ON3032541901e-14
CAGL0H03729g1.399ON3032431882e-14
KNAG0E023102.431ON3191951882e-14
SAKL0E03960g2.431ON3201981873e-14
TBLA0F005206.363ON6632811923e-14
ADL082C7.231ON5692081905e-14
KAFR0H031401.399ON3032561855e-14
TPHA0I018808.544ON10342091925e-14
TBLA0B091002.431ON3171951856e-14
NDAI0G038303.25ON5102971888e-14
Kpol_297.72.431ON3181561848e-14
AFR199C2.431ON3341971831e-13
Ecym_12931.399ON3032561812e-13
NDAI0I003506.340ON5152901862e-13
Kpol_1070.117.231ON6661821862e-13
KLTH0H12122g1.399ON3032521802e-13
SAKL0F08404g7.231ON6431821852e-13
ZYRO0D08206g6.340ON5152901843e-13
Ecym_43437.231ON5831731843e-13
KAFR0A033801.247ON6661711844e-13
KLLA0E07085g3.25ON4523001815e-13
NCAS0B078401.247ON5892081825e-13
KAFR0I018807.231ON5911821817e-13
TDEL0A020702.431ON3191941767e-13
Suva_9.1547.231ON6381821817e-13
ZYRO0G20152g2.431ON3191941767e-13
TPHA0G016108.672ON4141441797e-13
Kpol_1048.598.544ON8502171828e-13
KLTH0A06754g6.340ON5143621808e-13
Smik_9.1447.231ON6301821818e-13
KNAG0F038707.534ON4652361799e-13
YIL046W (MET30)7.231ON6401821809e-13
ZYRO0F07282g8.672ON4271601781e-12
KNAG0J016808.672ON3981531771e-12
NCAS0A139407.322ON12051601811e-12
Skud_9.1237.231ON6391821791e-12
KLLA0C08547g6.340ON5152861781e-12
KLLA0D04840g1.399ON3032561731e-12
Kwal_23.63246.340ON5142901772e-12
TPHA0O007101.399ON3043161732e-12
Ecym_60982.431ON3181431732e-12
KNAG0I028406.340ON5192851772e-12
KAFR0B003707.534ON4612501762e-12
TDEL0H021307.231ON5841821772e-12
NCAS0D046106.340ON5152831772e-12
AAL009C1.399ON3032541722e-12
NDAI0C026001.399ON3032541722e-12
CAGL0I03718g7.322ON12011601782e-12
YCR072C (RSA4)6.340ON5152831763e-12
SAKL0A03872g6.239ON8783051773e-12
Skud_4.1097.322ON12011601774e-12
Suva_3.1096.340ON5153341744e-12
AFL118W6.239ON8322921754e-12
NDAI0A020907.322ON12001601764e-12
TBLA0F041306.340ON5142901744e-12
Smik_4.907.322ON12011601765e-12
Ecym_24018.672ON4261551725e-12
KNAG0F018406.239ON9112891755e-12
Skud_3.1456.340ON5152831735e-12
YDL145C (COP1)7.322ON12011601755e-12
TPHA0D045007.322ON12081741755e-12
Smik_11.2981.247ON6622391745e-12
Suva_4.997.322ON12011601755e-12
KNAG0B027207.322ON12041601755e-12
Kpol_2001.657.322ON12061881756e-12
Suva_14.223.25ON4692101726e-12
SAKL0H06666g8.672ON4412121726e-12
CAGL0L00781g7.231ON6731821737e-12
KAFR0L013907.322ON12061601747e-12
Kpol_1014.193.25ON4522571717e-12
Ecym_55015.631ON3271881688e-12
ZYRO0D16742g7.231ON6082761728e-12
Smik_3.1726.340ON5152831728e-12
Skud_14.223.25ON4672101718e-12
TBLA0F022307.322ON12161841731e-11
TDEL0F002701.534ON7053271721e-11
Kpol_1028.416.340ON5121451701e-11
CAGL0J03476g6.340ON5173401701e-11
TDEL0A004403.25ON4512951691e-11
Skud_11.2711.247ON6462401701e-11
TPHA0C011507.231ON6871901701e-11
NCAS0G036001.399ON3272691661e-11
TPHA0P014903.25ON4592941682e-11
TBLA0E007607.534ON3842431672e-11
TBLA0A060606.239ON8882731702e-11
YKR036C (CAF4)1.247ON6432391692e-11
Ecym_80727.322ON12011591702e-11
Ecym_28087.534ON4651831682e-11
SAKL0A01276g6.340ON5152831682e-11
KLLA0F21406g1.247ON7051201692e-11
ZYRO0C03124g3.25ON4452951672e-11
Ecym_24986.340ON5422841683e-11
NDAI0B051901.247ON6682151683e-11
KAFR0F043506.340ON5151421673e-11
KNAG0D016907.231ON6541731683e-11
TPHA0B011201.247ON7191231683e-11
TDEL0C022407.322ON12011591683e-11
Kwal_23.57697.231ON6272861673e-11
Suva_2.1174.106ON8402251684e-11
AER263C6.340ON5131451664e-11
NDAI0A026107.231ON7671821674e-11
YNL317W (PFS2)3.25ON4652101654e-11
Ecym_36191.534ON7112231674e-11
KLLA0D07546g8.67ON6473331664e-11
Smik_14.143.25ON4662081654e-11
KLTH0D11132g8.672ON4371441654e-11
TBLA0C018408.672ON4231531645e-11
ZYRO0E07392g6.239ON8972891665e-11
TDEL0A075506.340ON5152911655e-11
KLTH0A04114g7.231ON6581821656e-11
SAKL0F10648g7.322ON12031601666e-11
KLLA0F04884g7.322ON12121831666e-11
CAGL0G04345g1.247ON7111271657e-11
NCAS0A134307.231ON6081821647e-11
Kpol_1054.601.534ON7193151657e-11
Ecym_20936.325ON9231991657e-11
CAGL0M04081g3.25ON4552051637e-11
ADR077C7.322ON12041601658e-11
Kwal_56.245267.322ON12101601658e-11
KLTH0H01892g7.322ON12091601658e-11
KLTH0H03608g6.239ON8753041658e-11
TDEL0A061808.672ON4341551629e-11
ZYRO0D03828g1.247ON7261231649e-11
KNAG0C014101.247ON6531221639e-11
Kwal_26.87768.672ON4331441621e-10
KLLA0F27511g7.231ON6231821631e-10
Suva_6.1871.247ON7141251631e-10
CAGL0L03201g1.247ON5792461631e-10
Smik_2.1124.106ON8412261641e-10
TPHA0M018306.340ON5151451621e-10
ZYRO0F11110g7.322ON12011591641e-10
KLTH0E15576g1.247ON7231211631e-10
Kpol_1031.361.247ON7062191631e-10
TBLA0D048701.399ON3273071591e-10
Suva_11.2681.247ON6452391631e-10
Skud_2.1034.106ON8402251631e-10
KNAG0B016101.247ON6742091621e-10
NCAS0C044503.25ON4612961611e-10
Ecym_80901.247ON7162521622e-10
Kwal_23.62406.325ON9131381622e-10
KLLA0E12277g2.431ON3262171582e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.198
         (943 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1879   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1781   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1763   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1738   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1455   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1423   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1419   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1391   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1383   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1379   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1367   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1365   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1357   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1357   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1352   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1337   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1334   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1324   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1305   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1203   0.0  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   134   2e-31
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   133   3e-31
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   130   4e-30
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   128   1e-29
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   127   4e-29
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   122   1e-27
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   119   6e-27
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   119   7e-27
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   119   9e-27
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   108   2e-23
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   106   1e-22
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   104   5e-22
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...   103   5e-22
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...   103   6e-22
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...   103   7e-22
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...   101   2e-21
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   102   2e-21
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...   101   3e-21
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   101   4e-21
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...   100   4e-21
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   101   5e-21
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   101   5e-21
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   100   5e-21
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...   100   1e-20
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....   100   1e-20
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    99   1e-20
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    99   2e-20
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    99   2e-20
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    99   2e-20
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    99   2e-20
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    98   3e-20
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    96   1e-19
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    96   1e-19
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    96   2e-19
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    96   2e-19
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    95   2e-19
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     95   3e-19
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    95   4e-19
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    94   5e-19
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    94   6e-19
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    94   8e-19
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    92   8e-19
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             93   2e-18
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    93   2e-18
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    92   2e-18
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    92   3e-18
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    91   4e-18
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    92   5e-18
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    91   6e-18
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    91   6e-18
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    91   6e-18
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    89   2e-17
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    86   2e-17
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    87   3e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    89   3e-17
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    86   3e-17
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    88   6e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    88   7e-17
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    84   1e-16
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    87   1e-16
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    86   1e-16
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    86   1e-16
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    86   2e-16
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    82   3e-16
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    86   3e-16
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    82   3e-16
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    82   3e-16
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    84   3e-16
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    86   3e-16
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    84   5e-16
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    82   5e-16
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    82   5e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    85   5e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    84   7e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    84   1e-15
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    81   1e-15
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    80   1e-15
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    82   3e-15
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    81   3e-15
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    79   4e-15
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    79   4e-15
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    79   5e-15
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    79   5e-15
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    79   5e-15
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    79   5e-15
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    80   5e-15
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    79   6e-15
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    80   6e-15
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    78   8e-15
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    78   1e-14
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    77   2e-14
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    77   2e-14
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    77   3e-14
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    79   3e-14
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    78   5e-14
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    76   5e-14
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    79   5e-14
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    76   6e-14
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      77   8e-14
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    75   8e-14
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    75   1e-13
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    74   2e-13
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       76   2e-13
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    76   2e-13
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    74   2e-13
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    76   2e-13
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    75   3e-13
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    75   3e-13
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    75   4e-13
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    74   5e-13
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    75   5e-13
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    74   7e-13
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    72   7e-13
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    74   7e-13
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    72   7e-13
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    74   7e-13
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    75   8e-13
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    74   8e-13
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    74   8e-13
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    74   9e-13
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    74   9e-13
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    73   1e-12
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    73   1e-12
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    74   1e-12
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    74   1e-12
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    73   1e-12
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    71   1e-12
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    73   2e-12
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    71   2e-12
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    71   2e-12
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    73   2e-12
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    72   2e-12
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    73   2e-12
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     73   2e-12
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    71   2e-12
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      71   2e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    73   2e-12
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    72   3e-12
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    73   3e-12
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    73   4e-12
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    72   4e-12
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    72   4e-12
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    72   4e-12
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    72   4e-12
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    72   5e-12
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    71   5e-12
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    72   5e-12
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    71   5e-12
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    72   5e-12
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    72   5e-12
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    72   5e-12
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    72   5e-12
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    72   5e-12
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    72   6e-12
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    71   6e-12
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    71   6e-12
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    71   7e-12
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    72   7e-12
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    70   7e-12
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    69   8e-12
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    71   8e-12
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    71   8e-12
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    70   8e-12
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    71   1e-11
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    71   1e-11
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    70   1e-11
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    70   1e-11
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    70   1e-11
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    70   1e-11
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    70   1e-11
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    69   1e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    69   2e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               69   2e-11
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    70   2e-11
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    70   2e-11
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    70   2e-11
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    69   2e-11
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    69   2e-11
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    70   2e-11
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    69   2e-11
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    69   3e-11
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    69   3e-11
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    69   3e-11
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    69   3e-11
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    69   3e-11
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    69   3e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    69   3e-11
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    69   4e-11
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    69   4e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     69   4e-11
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    68   4e-11
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    69   4e-11
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    69   4e-11
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    68   4e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    68   4e-11
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    68   5e-11
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    69   5e-11
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    68   5e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    68   6e-11
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    69   6e-11
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    69   6e-11
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    68   7e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    68   7e-11
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    68   7e-11
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    68   7e-11
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    67   7e-11
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    68   8e-11
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    68   8e-11
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    68   8e-11
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    68   8e-11
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    67   9e-11
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    68   9e-11
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    67   9e-11
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    67   1e-10
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    67   1e-10
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    67   1e-10
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    67   1e-10
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    68   1e-10
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    67   1e-10
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    68   1e-10
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    67   1e-10
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    67   1e-10
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    66   1e-10
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    67   1e-10
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    67   1e-10
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    67   1e-10
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      67   1e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    67   2e-10
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    67   2e-10
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    65   2e-10
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    66   2e-10
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    67   2e-10
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    67   2e-10
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    67   2e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    66   2e-10
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    67   2e-10
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    66   2e-10
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    67   2e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    65   3e-10
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    66   3e-10
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    66   3e-10
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    66   3e-10
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    65   3e-10
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     65   4e-10
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    66   4e-10
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    65   4e-10
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     65   5e-10
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    65   5e-10
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    64   6e-10
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    65   6e-10
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      64   7e-10
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    64   8e-10
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    65   8e-10
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    65   8e-10
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     65   8e-10
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    64   9e-10
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    64   9e-10
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    65   1e-09
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    64   1e-09
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    64   1e-09
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    64   1e-09
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      64   1e-09
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    64   1e-09
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    64   1e-09
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    63   1e-09
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    64   1e-09
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    64   1e-09
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    64   2e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       64   2e-09
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    63   2e-09
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    63   2e-09
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    60   2e-09
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    60   2e-09
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    64   2e-09
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    64   2e-09
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    63   2e-09
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    64   2e-09
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    63   2e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    63   2e-09
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    62   2e-09
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    63   2e-09
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    63   2e-09
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    63   2e-09
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    63   2e-09
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    63   2e-09
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    62   2e-09
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    62   2e-09
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    62   3e-09
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    62   3e-09
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    63   3e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     62   3e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    62   3e-09
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    62   4e-09
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    62   4e-09
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    62   5e-09
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    62   5e-09
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    62   5e-09
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    61   6e-09
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    62   8e-09
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    62   8e-09
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    62   8e-09
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    61   8e-09
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    61   9e-09
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    61   9e-09
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    61   1e-08
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    60   1e-08
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    61   1e-08
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    61   1e-08
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    61   1e-08
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    61   1e-08
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    60   1e-08
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    61   1e-08
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    61   1e-08
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    61   1e-08
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    61   1e-08
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    61   1e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    59   1e-08
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    60   1e-08
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    60   1e-08
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    59   2e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    60   2e-08
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    59   2e-08
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    60   2e-08
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    60   2e-08
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    60   2e-08
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    60   2e-08
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    60   2e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    59   2e-08
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    59   2e-08
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    59   3e-08
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    60   3e-08
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    59   3e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    58   3e-08
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    59   4e-08
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    58   4e-08
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    58   4e-08
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    58   4e-08
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    59   4e-08
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    59   5e-08
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    58   5e-08
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    59   5e-08
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    58   5e-08
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    58   5e-08
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    58   6e-08
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    59   6e-08
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    59   6e-08
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    59   6e-08
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    58   7e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    59   7e-08
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    59   7e-08
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    59   7e-08
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    59   7e-08
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    57   8e-08
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    58   8e-08
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    57   8e-08
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    58   9e-08
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    58   9e-08
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    57   9e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    57   9e-08
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    58   1e-07
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    58   1e-07
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    58   1e-07
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    57   2e-07
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    57   2e-07
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    56   2e-07
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    57   2e-07
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    56   2e-07
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      57   2e-07
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    57   2e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    56   2e-07
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    56   2e-07
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    55   3e-07
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    57   3e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              56   3e-07
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    56   3e-07
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    56   3e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    56   3e-07
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       56   3e-07
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     56   3e-07
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    55   3e-07
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    56   4e-07
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    55   4e-07
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    56   4e-07
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    56   4e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    56   4e-07
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    56   4e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    56   4e-07
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    55   4e-07
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    56   4e-07
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    56   4e-07
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    55   5e-07
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    55   5e-07
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    55   5e-07
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    56   5e-07
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    55   5e-07
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    55   5e-07
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    55   6e-07
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    55   6e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    55   6e-07
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    55   6e-07
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    55   7e-07
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    55   7e-07
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    55   7e-07
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    55   7e-07
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    54   7e-07
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    55   8e-07
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    55   8e-07
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    55   8e-07
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    54   9e-07
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    55   9e-07
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    55   9e-07
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    54   9e-07
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    54   9e-07
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    55   9e-07
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    54   9e-07
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    54   1e-06
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    54   1e-06
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    54   1e-06
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    54   1e-06
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    54   1e-06
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    54   1e-06
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    55   1e-06
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    54   1e-06
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    54   1e-06
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    54   1e-06
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    54   1e-06
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    54   1e-06
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    53   1e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    54   1e-06
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    54   1e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    54   2e-06
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    53   2e-06
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    54   2e-06
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    54   2e-06
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    53   2e-06
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    54   2e-06
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    53   2e-06
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    54   2e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    53   2e-06
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    53   2e-06
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    54   2e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    54   2e-06
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    54   2e-06
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    54   2e-06
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    54   2e-06
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    54   2e-06
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    53   2e-06
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    53   2e-06
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    54   2e-06
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    53   2e-06
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    53   2e-06
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    53   2e-06
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    53   2e-06
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    53   2e-06
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    52   3e-06
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    53   3e-06
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    53   3e-06
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    53   3e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    53   3e-06
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    53   3e-06
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    53   3e-06
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    52   3e-06
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    53   3e-06
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    53   3e-06
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    52   3e-06
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    53   3e-06
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    52   3e-06
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    53   3e-06
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    52   4e-06
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    53   4e-06
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    52   4e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    52   4e-06
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    52   4e-06
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    52   4e-06
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    52   4e-06
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    52   4e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    52   5e-06
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    52   5e-06
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    52   5e-06
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    52   5e-06
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    52   5e-06
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    52   5e-06
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    51   6e-06
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    52   6e-06
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    52   7e-06
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    51   7e-06
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    52   7e-06
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    52   7e-06
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    52   7e-06
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    52   7e-06
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    52   8e-06
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    52   8e-06
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    51   8e-06
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    51   8e-06
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    52   9e-06
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    52   9e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    51   9e-06
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    52   9e-06
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    51   1e-05
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    51   1e-05
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    51   1e-05
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    51   1e-05
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    50   1e-05
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    51   1e-05
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    50   1e-05
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    51   1e-05
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    51   1e-05
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    51   1e-05
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    50   1e-05
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    51   1e-05
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    51   1e-05
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    51   1e-05
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    50   1e-05
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    51   1e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    51   2e-05
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    51   2e-05
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    50   2e-05
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    50   2e-05
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    50   2e-05
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    50   2e-05
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    51   2e-05
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    50   2e-05
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    50   2e-05
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    50   2e-05
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    50   2e-05
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    50   2e-05
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    50   2e-05
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    50   2e-05
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    50   2e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    50   2e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    50   2e-05
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    50   2e-05
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    50   2e-05
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    50   2e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    50   2e-05
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    50   2e-05
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    50   3e-05
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    50   3e-05
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    50   3e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    49   3e-05
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    50   3e-05
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    50   3e-05
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    49   3e-05
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    50   3e-05
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    49   3e-05
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    49   3e-05
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    50   3e-05
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    50   4e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    49   4e-05
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    49   4e-05
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    49   4e-05
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    49   4e-05
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    49   4e-05
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    49   4e-05
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    49   4e-05
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     49   4e-05
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    49   5e-05
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    49   5e-05
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    48   5e-05
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    49   5e-05
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    49   5e-05
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    49   5e-05
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    49   5e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    48   6e-05
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    49   6e-05
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    49   6e-05
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    49   6e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    48   6e-05
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    49   6e-05
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    48   7e-05
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    49   7e-05
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    48   7e-05
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    48   7e-05
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    48   7e-05
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    48   7e-05
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    48   8e-05
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    49   8e-05
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    48   8e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    49   8e-05
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    48   8e-05
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    49   8e-05
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    48   9e-05
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    48   9e-05
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    48   9e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    48   9e-05
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    48   1e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    48   1e-04
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    48   1e-04
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    48   1e-04
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    47   1e-04
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    47   1e-04
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    48   1e-04
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    47   1e-04
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    47   1e-04
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    47   1e-04
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    47   1e-04
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    47   1e-04
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    47   2e-04
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    47   2e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    48   2e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    47   2e-04
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    48   2e-04
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    47   2e-04
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    47   2e-04
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    47   2e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    47   2e-04
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    47   2e-04
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    47   2e-04
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    47   2e-04
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    47   2e-04
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    47   2e-04
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    47   2e-04
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    47   2e-04
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    47   2e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    46   2e-04
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    47   3e-04
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    47   3e-04
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    46   3e-04
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    47   3e-04
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    46   3e-04
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    46   3e-04
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    46   3e-04
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    47   3e-04
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    47   3e-04
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    46   3e-04
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    46   3e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    46   3e-04
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    46   3e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    46   3e-04
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    47   4e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    45   4e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    46   4e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    46   4e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    46   4e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    46   4e-04
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    46   4e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    44   4e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    46   4e-04
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    46   5e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    45   5e-04
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    46   5e-04
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    45   5e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    46   5e-04
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    45   5e-04
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    45   6e-04
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    45   6e-04
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    46   6e-04
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    45   6e-04
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    45   6e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    45   6e-04
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    45   6e-04
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    45   6e-04
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    45   6e-04
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    45   7e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    45   8e-04
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    45   8e-04
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    45   8e-04
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    45   8e-04
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    45   8e-04
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    45   8e-04
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    45   9e-04
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    45   9e-04
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    45   9e-04
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    45   0.001
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    45   0.001
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    45   0.001
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    45   0.001
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    44   0.001
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    45   0.001
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.001
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    45   0.001
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    44   0.001
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    44   0.001
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    45   0.001
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    45   0.001
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    44   0.001
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    45   0.001
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    44   0.001
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    44   0.001
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    44   0.001
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    44   0.001
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    44   0.001
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    44   0.001
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    44   0.001
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    44   0.001
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    44   0.001
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    44   0.002
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    44   0.002
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    44   0.002
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    44   0.002
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    44   0.002
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    44   0.002
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    44   0.002
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    44   0.002
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    44   0.002
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    44   0.002
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    44   0.002
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    44   0.002
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    44   0.002
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    44   0.002
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    44   0.002
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    44   0.002
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    44   0.002
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    44   0.002
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    44   0.002
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    44   0.002
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    44   0.002
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    44   0.002
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    43   0.002
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    43   0.003
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    43   0.003
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    44   0.003
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    43   0.003
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    44   0.003
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    44   0.003
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    44   0.003
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    43   0.003
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    44   0.003
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    43   0.003
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    43   0.003
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    43   0.003
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    43   0.003
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    43   0.003
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    43   0.003
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    43   0.004
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    43   0.004
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    43   0.004
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    43   0.004
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    43   0.004
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    43   0.004
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    43   0.004
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    43   0.004
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    43   0.004
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    43   0.004
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    42   0.004
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    42   0.004
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    42   0.005
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    42   0.005
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    42   0.005
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    42   0.005
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    42   0.005
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    42   0.005
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    42   0.005
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.005
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    42   0.005
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    42   0.005
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    42   0.005
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    42   0.006
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    42   0.006
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    42   0.006
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    42   0.006
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    42   0.006
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    42   0.006
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    42   0.006
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    42   0.007
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    42   0.008
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    42   0.008
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    42   0.008
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    42   0.008
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    42   0.008
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    42   0.008
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    42   0.008
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    42   0.009
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    42   0.009
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    42   0.009
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    42   0.009
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    42   0.009
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    42   0.009
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    42   0.010
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    42   0.010
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    42   0.010
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    41   0.010
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    41   0.011
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    42   0.011
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    41   0.011
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    41   0.011
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    42   0.011
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    41   0.011
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    42   0.011
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.011
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    41   0.012
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    41   0.012
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    41   0.012
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    41   0.012
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    41   0.013
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    41   0.013
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    41   0.013
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    41   0.013
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    41   0.013
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    41   0.014
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               41   0.015
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    41   0.015
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    41   0.015
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    41   0.015
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    40   0.016
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    41   0.016
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    41   0.016
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    41   0.017
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    40   0.017
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    41   0.017
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    41   0.017
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    41   0.018
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    40   0.018
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    41   0.018
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    41   0.018
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    40   0.020
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    41   0.020
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    40   0.020
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    41   0.020
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    40   0.021
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    40   0.021
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    41   0.021
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    40   0.021
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    40   0.022
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    40   0.022
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    40   0.022
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    40   0.023
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    40   0.025
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    40   0.025
KNAG0B00900 Chr2 (164610..165698) [1089 bp, 362 aa] {ON} Anc_3.4...    40   0.026
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.026
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    40   0.026
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    40   0.027
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    40   0.027
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    40   0.028
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    40   0.029
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    40   0.029
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    40   0.030
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    40   0.030
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    40   0.030
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    40   0.030
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    40   0.031
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    40   0.031
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    40   0.031
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    40   0.033
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    40   0.033
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    40   0.033
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    40   0.035
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    40   0.035
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    40   0.035
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    40   0.035
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    40   0.036
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    40   0.036
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    40   0.036
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    39   0.038
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    40   0.039
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    39   0.039
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    40   0.040
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    40   0.041
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    40   0.042
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    39   0.042
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    39   0.042
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    39   0.042
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    39   0.043
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    39   0.043
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    39   0.045
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    40   0.045
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    39   0.045
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    39   0.046
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    39   0.046
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    39   0.046
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    39   0.048
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    39   0.048
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    39   0.048
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    39   0.049
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    39   0.050
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    39   0.050
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    40   0.051
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    39   0.052
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.053
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    39   0.054
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    39   0.054
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    39   0.055
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    39   0.056
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    39   0.057
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    39   0.057
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    39   0.059
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     39   0.061
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    39   0.061
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    39   0.061
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    39   0.064
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    39   0.065
NDAI0D02490 Chr4 (575553..577499) [1947 bp, 648 aa] {ON} Anc_5.104     39   0.065
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    39   0.069
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    39   0.070
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.071
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    39   0.078
NCAS0A09060 Chr1 (1793006..1793854) [849 bp, 282 aa] {ON} Anc_1....    38   0.080
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    39   0.080
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    39   0.080
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    39   0.080
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    39   0.080
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    39   0.083
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    39   0.084
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    39   0.085
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    39   0.085
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    39   0.087
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    39   0.088
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    39   0.088
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    39   0.089
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.090
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    39   0.090
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    39   0.092
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    38   0.094
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    38   0.095
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    38   0.096
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    38   0.097
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    38   0.099
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    39   0.099
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    39   0.100
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    39   0.10 
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    39   0.10 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    38   0.10 
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    39   0.10 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    39   0.10 
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    38   0.11 
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    38   0.11 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    38   0.11 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    39   0.11 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    38   0.11 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    38   0.12 
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    38   0.12 
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    38   0.12 
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    38   0.12 
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    38   0.12 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    38   0.12 
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    38   0.12 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    38   0.12 
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    38   0.13 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    38   0.13 
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    38   0.13 
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    38   0.13 
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    38   0.13 
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    38   0.13 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    38   0.13 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    38   0.13 
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    38   0.14 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    38   0.14 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    38   0.14 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    38   0.14 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    38   0.14 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    38   0.14 
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    38   0.14 
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    38   0.14 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    37   0.15 
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    38   0.15 
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    38   0.15 
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    37   0.16 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    38   0.16 
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    38   0.16 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    37   0.16 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    37   0.16 
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    38   0.16 
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    37   0.17 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    37   0.17 
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    37   0.17 
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    37   0.17 
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    37   0.17 
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    37   0.18 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    37   0.18 
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    37   0.18 
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    37   0.18 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    37   0.18 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    37   0.18 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    37   0.19 
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    38   0.19 
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    37   0.19 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    37   0.20 
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    37   0.20 
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    37   0.20 
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    37   0.20 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    37   0.21 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    37   0.21 
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    37   0.22 
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      37   0.22 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    37   0.22 
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    37   0.22 
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    37   0.23 
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    37   0.23 
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    37   0.24 
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    37   0.24 
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    37   0.24 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    37   0.25 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    37   0.26 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.26 
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     37   0.26 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    37   0.27 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    37   0.27 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    37   0.29 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    37   0.30 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    37   0.30 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    37   0.30 
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    37   0.30 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    37   0.31 
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    37   0.31 
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    37   0.31 
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    37   0.32 
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.33 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    37   0.33 
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    37   0.33 
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    37   0.33 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    37   0.35 
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    37   0.35 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    36   0.36 
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    36   0.36 
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    36   0.37 
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    37   0.37 
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    36   0.38 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    36   0.38 
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    37   0.39 
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    37   0.39 
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    37   0.39 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    36   0.40 
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    37   0.40 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    36   0.41 
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    36   0.41 
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    36   0.41 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    36   0.42 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    36   0.43 
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    36   0.44 
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    36   0.45 
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    36   0.45 
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    36   0.45 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    36   0.45 
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    36   0.46 
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    36   0.46 
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    36   0.46 
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    36   0.47 
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    36   0.48 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    36   0.48 
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    36   0.48 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    36   0.48 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    36   0.48 
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    36   0.50 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    36   0.51 
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    36   0.51 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    36   0.52 
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    36   0.52 
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    35   0.53 
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    36   0.53 
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    35   0.53 
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    36   0.54 
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             36   0.55 
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    36   0.55 
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    36   0.55 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    36   0.57 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    36   0.59 
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    36   0.59 
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    36   0.60 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    36   0.61 
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    35   0.61 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    36   0.61 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    35   0.63 
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    36   0.63 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    36   0.64 
NDAI0G05990 Chr7 complement(1480864..1482261) [1398 bp, 465 aa] ...    35   0.64 
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    35   0.64 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    36   0.66 
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    35   0.67 
ADL316C Chr4 complement(141605..145861) [4257 bp, 1418 aa] {ON} ...    36   0.67 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    35   0.69 
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    35   0.70 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    35   0.70 
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    35   0.71 
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    35   0.71 
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    35   0.71 
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    35   0.71 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    35   0.72 
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    35   0.73 
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    35   0.75 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    35   0.75 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    35   0.75 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    35   0.76 
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    35   0.77 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    35   0.77 
Kpol_534.25 s534 complement(58326..59444) [1119 bp, 372 aa] {ON}...    35   0.83 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    35   0.84 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    35   0.86 
TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {O...    35   0.86 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    35   0.87 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    35   0.88 
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    35   0.88 
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    35   0.90 
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    35   0.91 
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    35   0.92 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    35   0.92 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    35   0.93 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   0.95 
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    35   0.95 
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    35   0.95 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    35   0.97 
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    35   0.98 
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    35   0.98 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    35   1.0  
Suva_23.1 Chr23 (204..2054) [1851 bp, 617 aa] {ON} YCR067C (REAL)      35   1.0  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    35   1.0  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    35   1.0  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    35   1.0  
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    35   1.1  
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    35   1.1  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    35   1.1  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    35   1.1  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    35   1.1  
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    35   1.1  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    35   1.2  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    35   1.2  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    35   1.2  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    35   1.2  
TDEL0D01740 Chr4 (346288..348957) [2670 bp, 889 aa] {ON} Anc_1.3...    35   1.2  
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    35   1.2  
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    35   1.2  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    34   1.2  
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    34   1.2  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    35   1.2  
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    35   1.3  
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    35   1.3  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    35   1.3  
TBLA0G03390 Chr7 complement(900177..902099) [1923 bp, 640 aa] {O...    35   1.3  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    35   1.3  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    35   1.3  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    35   1.3  
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    35   1.3  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.4  
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    35   1.4  
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    34   1.4  
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    35   1.4  
TBLA0B01860 Chr2 complement(424732..427818) [3087 bp, 1028 aa] {...    35   1.4  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    35   1.5  
KLLA0C02849g Chr3 (255963..257285) [1323 bp, 440 aa] {ON} some s...    34   1.5  
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    34   1.6  
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    34   1.6  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    34   1.6  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    34   1.6  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    34   1.7  
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    34   1.7  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    34   1.7  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    34   1.7  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    34   1.7  
ABR189W Chr2 (764141..765370) [1230 bp, 409 aa] {ON} Syntenic ho...    34   1.7  
Suva_3.105 Chr3 complement(150015..153692) [3678 bp, 1225 aa] {O...    34   1.8  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    34   1.8  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    34   1.8  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    34   1.8  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    34   1.9  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    34   1.9  
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    34   1.9  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    34   1.9  
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    34   1.9  
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    34   2.0  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    34   2.0  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    34   2.0  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    34   2.1  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    34   2.1  
CAGL0I07821g Chr9 complement(751754..755143) [3390 bp, 1129 aa] ...    34   2.1  
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    34   2.1  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    34   2.1  
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    34   2.1  
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    34   2.1  
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    34   2.2  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    34   2.2  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    34   2.2  
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    34   2.3  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    33   2.3  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    34   2.3  
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    34   2.3  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    34   2.3  
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    34   2.4  
AFL038C Chr6 complement(367581..368573) [993 bp, 330 aa] {ON} Sy...    33   2.4  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    34   2.4  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    34   2.4  
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    33   2.4  
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   2.4  
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    34   2.4  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    33   2.4  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    34   2.5  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    33   2.5  
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    34   2.6  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    33   2.6  
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    33   2.6  
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    33   2.7  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   2.7  
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    33   2.8  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    33   2.8  
KLTH0B08800g Chr2 complement(712793..717340) [4548 bp, 1515 aa] ...    34   2.9  
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    33   2.9  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    33   3.0  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    33   3.0  
Skud_4.423 Chr4 (754186..755523) [1338 bp, 445 aa] {ON} YDR165W ...    33   3.0  
YCR067C Chr3 complement(233125..236322) [3198 bp, 1065 aa] {ON} ...    33   3.0  
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    33   3.1  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    33   3.1  
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    33   3.1  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    33   3.1  
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    33   3.1  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    33   3.2  
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    33   3.2  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    33   3.3  
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    33   3.3  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    33   3.5  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    33   3.6  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   3.6  
KNAG0D00440 Chr4 (64241..65488) [1248 bp, 415 aa] {ON} Anc_6.333...    33   3.6  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    33   3.7  
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    33   3.7  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    33   3.8  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    33   3.9  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    33   3.9  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    33   4.0  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    33   4.0  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    33   4.0  
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    33   4.0  
AGL154W Chr7 (407459..408943) [1485 bp, 494 aa] {ON} Syntenic ho...    33   4.1  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    33   4.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   4.2  
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    33   4.2  
Skud_16.374 Chr16 complement(672714..674045) [1332 bp, 443 aa] {...    33   4.2  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    33   4.3  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    33   4.3  
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    33   4.4  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    33   4.4  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    33   4.4  
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    33   4.4  
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    33   4.5  
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    33   4.5  
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    33   4.5  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    33   4.6  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    33   4.6  
NCAS0B05410 Chr2 (1008672..1012064) [3393 bp, 1130 aa] {ON} Anc_...    33   4.6  
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    33   4.6  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    33   4.7  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    33   4.7  
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    33   4.8  
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    33   4.8  
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    33   4.8  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    33   4.8  
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    33   5.0  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    33   5.1  
TDEL0D02140 Chr4 complement(414754..415587) [834 bp, 277 aa] {ON...    32   5.1  
Skud_3.141 Chr3 complement(217949..220924) [2976 bp, 991 aa] {ON...    33   5.1  
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    33   5.3  
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    32   5.4  
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    32   5.4  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    33   5.4  
KAFR0E02470 Chr5 complement(503462..505351) [1890 bp, 629 aa] {O...    33   5.4  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    33   5.4  
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    33   5.5  
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    33   5.5  
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    33   5.5  
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    33   5.6  
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    33   5.6  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    33   5.7  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    32   5.7  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    32   5.7  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    32   5.7  
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    32   5.8  
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    33   5.9  
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    32   6.0  
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    32   6.0  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    32   6.1  
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    32   6.1  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    32   6.1  
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    32   6.5  
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    32   6.7  
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    32   6.7  
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    32   6.7  
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    32   6.9  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    32   7.0  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    32   7.0  
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    32   7.1  
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    32   7.4  
Suva_4.89 Chr4 (162699..164267) [1569 bp, 522 aa] {ON} YDL156W (...    32   7.4  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    32   7.5  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    32   7.6  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    32   7.7  
Suva_16.463 Chr16 (801619..804411) [2793 bp, 930 aa] {ON} YPR135...    32   7.9  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    32   7.9  
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    32   8.1  
Suva_16.415 Chr16 complement(715808..717157) [1350 bp, 449 aa] {...    32   8.1  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   8.2  
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    32   8.2  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    32   8.2  
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    32   8.3  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    32   8.4  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    32   8.5  
Smik_12.117 Chr12 complement(232159..233895) [1737 bp, 578 aa] {...    32   8.7  
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    32   8.7  
ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON...    32   8.7  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    32   8.7  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    32   8.9  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    32   9.0  
Ecym_2258 Chr2 complement(510259..511278) [1020 bp, 339 aa] {ON}...    32   9.1  
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    32   9.2  
CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} simi...    32   9.3  
NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa] ...    32   9.4  
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    32   9.4  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    32   9.9  
YOR026W Chr15 (379781..380806) [1026 bp, 341 aa] {ON}  BUB3Kinet...    32   9.9  
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    32   10.0 

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1879 bits (4868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/943 (97%), Positives = 917/943 (97%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIA       
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   TDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALAIASNGSFVVSSSHDHSIRIWEETEDQVF           QYEDTLLASLEEGNADD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
           LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1781 bits (4612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 849/943 (90%), Positives = 895/943 (94%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+A FGVIASNANCVW+P SSRTN GSGPGQLITSALENVNIWDIKTGDL+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
            TLSDGLPPGASDA+GSKPAECTYLEVH+DT+LLAVGYADGVIKVWDL+SKTVLLNFNGH
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           KAAITL+QFDSTGTRLISGS+DSNIIVWDLVGEVGLYKLRSHKD ITG WCQGEDWL+ST
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IK+WDLKTQQCIETHIAHTGECW L+VKDDLLITT TDSQVKIWKLNMEN+KMGE
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KLTE+G+FEKQSKQRGLK+EFITNASDGVSFFYIQNADKTIET+RIRKEEEIA       
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   TDEEI++SIK SYSSL+LHPFQT+RS YK+KSASWTTVTSSKLELV+TTSNN
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+ TSPAPLKTHTIELQGQRTDVRSID+SDDNKLLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           THKCIRTFECGYAL+CKFLPGGLLVILGTR+GELQLFDLASSSLLDT+EDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVE TLVPGTKDK +PMLKLNHDTTLELNDDILSVRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALAI+++GSFVVSSSHDHSIRIWEETEDQVF           QYEDTLL SLEEGN DD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AFKGDA GE+VEDEASGVHKQTLESLKAGE+LMEALD+GIA+IEGME YNKDM+LWQRKK
Sbjct: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
           LGEAPMKPQGNSVLIAV KTPEQYI+DTLSRIR SQLEDALMVMPFSYVLKFLKF D VM
Sbjct: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNKTLLH+HLPL+C+NLFFIIKFNHKEL+SQKNEELKLQINRVKTELRNALKSTEDDLGF
Sbjct: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           NVQGLKFI+QQWNL+HNYEFVDEYDQQEKEN+SARKRVFE VI
Sbjct: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1763 bits (4565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 843/943 (89%), Positives = 888/943 (94%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQSA FGVIASNANCVWLP SSRT  GSGPGQLITSALENVN+WDIKTGDL+
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           +TLSDGLPPGASDARG+KPAECTYLEVH+DTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           KAAITLLQFD TGTRLISGS+DSNIIVWDLVGEVGLYKLRSHKD ITG WCQGEDWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDGMIKLWDLKTQQCIETHIAHTGECW LSVKDDLLITTGTDSQVK+WKLN+ENDK+G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KLTE+G FEKQSKQRGLK+EFITN SDG SFFYIQNADKTIE FRIRKEEEIA       
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   TDEEI +SIK SYSSL+LHPFQT+RS YK+KSASWTT+TSSKLELVLTTSNN
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKRE TSPAPLKTHTIELQGQRTD+RSIDISDDN+LLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           THKCIRTFECGYAL+CKFLPGGLLVILGTR GELQLFDLASSSLLDT+EDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK LP+LKLNHDTTLELNDDILS+RIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALAI+++GSFVVSSSHDHSIRIWEETEDQVF           QYEDTLL SLEEGN DD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AFKGDA GE V+DE SGVHKQTLESLKAGERLMEALD+GIA+IEG+E Y++DM+LWQRKK
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
           LGEAP+KPQGNSVLIAVNKTPEQYI+DTL RIR+SQLEDALMVMPFSYVLKFLKFID++M
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNK+LLHSHLPL+C+NLFFIIKFNHKELVSQKNEELK Q++RVKTELRNALKSTEDDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           NVQGLKFIKQQWNLRHNYEFVDEYDQQEKE++ ARKR FETV+
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1738 bits (4502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 833/943 (88%), Positives = 885/943 (93%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+A FGVIASNANCVW+P SS  + GSGPGQLITSALE+VNIWDIKTGDL+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           + LSDGLPPGASDARG+KPAECTYLE H+DTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           KAAITLLQFD TGTRLISGS+DSNIIVWDLVGEVGLYKLRSHKD ITG WCQGEDWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDGMIKLWDLKT QCIETHIAHTGECW L+VKDDLLITTGTDSQVKIWKL++ENDKMG 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KLTE+G+FEKQSKQRGLK+EFITN+SD  SFFYIQNADKTIETFRIRKEEEIA       
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   T+EEIA+SIK SYSS +LHPFQTIRS YK+KSASWTTV+SSKLELVLTTS+N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+ TSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           THKCIRTFECGYAL+CKFLPGGLLVILGTR GELQLFDLASSSLLDT+EDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDF+VEN+LVPGTK+K LP+LKL+HDTTLEL DDIL VR+S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLP+SHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALA+A++G FVVSSSHDHSIRIWEETEDQVF           QYEDTLL SLEEGN DD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AFK DA+GE VEDEASGVHKQTLESLKAGERLMEALD+GIA+IEG+E YN+DM+LWQRKK
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
           LGEAP+KPQGN+VLIAVNKTPEQYI+DTL RIR SQLEDALMVMPFSYVLKFLKFIDTVM
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           QNKTLLHSHLPL+C+NLFFIIKFNHKELVSQKNEELKLQINRVKTELR+ALKSTEDDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           NVQGLKF+KQQWNLRHNYEFVDEYDQQEKE++SARKRVF TVI
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI 943

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1455 bits (3767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/959 (72%), Positives = 822/959 (85%), Gaps = 19/959 (1%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+++FGVI+SN+NCVWLP +S  +K S PGQ+IT ALENVNIWD+KTG+L 
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTS--SKKSHPGQIITGALENVNIWDLKTGELA 85

Query: 61  ATLSDGL--PPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN 118
           + L+DGL  PPG+ DA+ SKPAE T+L+ H++T+LLAVGY DGV+KVWDL SKTVL N N
Sbjct: 86  SFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLN 145

Query: 119 GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC------- 171
           GH +AIT L+FD++GTRLISGSRDSNIIVWDLV EVGLYKLRSHKD ITGIWC       
Sbjct: 146 GHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNN 205

Query: 172 QGE---DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKI 228
           Q E   DWLISTSKDG+IK+WDLK QQC+ETHIAHTGECWSL+V++DL+ITT +DSQVK 
Sbjct: 206 QEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKF 265

Query: 229 WKLNMENDKM--GEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRI 286
           W+L++++D +  G KL E G++EKQSKQRGL VEFI ++ DGV FF IQNAD+T+E FR+
Sbjct: 266 WQLSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFI-DSIDGVGFFLIQNADRTVEIFRL 324

Query: 287 RKEEEIAXXXXXXXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTV 346
           RKEEEI+               T +EI +S++ S+ S+++HPFQ IRS YKVK+A+WT  
Sbjct: 325 RKEEEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIA 384

Query: 347 TSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLL 406
           TS+KLEL +TT+NNTIEYYSIPYEKRE T P   K + +ELQGQRTD+RSIDISDDNKLL
Sbjct: 385 TSTKLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLL 444

Query: 407 ATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLD 466
           ATASNGSLKIWN+KT  CIRTFECGYAL+CKFLPGG+LVI+GTR GELQLFDLASS+ + 
Sbjct: 445 ATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIA 504

Query: 467 TVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDT 526
            +E+AHDAAIWSLDLTSDGKRL+TGSADK+VKFW+FQ+E  LVPGT DK +P L L+HDT
Sbjct: 505 NIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDT 564

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
           TLEL+DDILSVR+SP+D++LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK
Sbjct: 565 TLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSK 624

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
           MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD ++KYWDG+K
Sbjct: 625 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDK 684

Query: 647 FECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYE 706
           FECIQKL AHQSEVWALAIA++ SFVVSSSHDHSIRIWEETED+VF           QYE
Sbjct: 685 FECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYE 744

Query: 707 DTLLASLEEGNADDAFKGDAAGE-DVE-DEASGVHKQTLESLKAGERLMEALDIGIADIE 764
           DTLLASLEEGN DDAFKGD  G  +VE DEA+ VHKQT+ESLKAGERLMEA D+G+A+IE
Sbjct: 745 DTLLASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIE 804

Query: 765 GMETYNKDMELWQRKKLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVM 824
             E Y+K+++LWQRKK GE P+KPQGN++LIA+ KTPE+YI+DTL RI+ SQLEDAL+V+
Sbjct: 805 SFEEYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVL 864

Query: 825 PFSYVLKFLKFIDTVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVK 884
           PFSYVLKFLKFI+ V+ NK +L++HL L+C+NLFFI+K NHKELVSQKNE LKLQI +VK
Sbjct: 865 PFSYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVK 924

Query: 885 TELRNALKSTEDDLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
            ELRNALK+ EDDLGFN+QG+KFIKQQWNLRHN EFVDEYDQ+  E+  A+KR F T++
Sbjct: 925 NELRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV 983

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1423 bits (3683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/947 (71%), Positives = 811/947 (85%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ + FGVI+SN NCVW+  +SR N+GS  GQ++T ALENVN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWI--ASR-NRGSA-GQILTGALENVNCWDIKTGELS 56

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             L+DGLPPGA DA+ +K AE TYL+ H +T+LLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+AIT+L+FD TGTRLISGS+DS+II+WDLVGEVGLYKLRSHKD ITGIWC+ EDWLIST
Sbjct: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IK+WDLKTQQC+ETH+AHT ECW L++ +DL+ITT T+SQ+KIW L+++ D MG 
Sbjct: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KL E G++EKQSKQRG+ VEFIT  SDGV+FFYIQNADKT+E FR+R +EEI+       
Sbjct: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                    DE+I ++IK SY S+++HPFQTIRS +K+K+A+W   T+SKLE+VLTTSNN
Sbjct: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           T+EYYSIPY+KRE T PAP K +TIELQG RTDVRSIDISDDNKLLATASNG+LKIWN+K
Sbjct: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           TH CIRTFECGYAL+CKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVTGSADKTVKFWDF+V+  L+PGT DK +P LK+ HDTTLELNDDIL+V+IS
Sbjct: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKF+PESHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALAI+++  FVVS+SHDHSIR+WEETED+VF           QYE+TLL SLE G+ DD
Sbjct: 655 WALAISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDD 714

Query: 721 AFKGD--AAGEDVE--DEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELW 776
            F+ D    GED E  D+A+ VHKQT+ESLKAGER++EALD+GIA IE  ETY K+++ W
Sbjct: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774

Query: 777 QRKKLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFI 836
           Q+KK GE P KPQ N++L+A+ K PEQYI++TL +IR SQLEDAL+V+PFSYVL FLKFI
Sbjct: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834

Query: 837 DTVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTED 896
           D V+++K + ++HL L+C+ LFFIIK N++ELV+QKNEELKLQINRVK ELR ALK   D
Sbjct: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894

Query: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           DLGFNVQGLKFI+QQWNLRHN EFVD+YDQ+++E  + +KR+FET++
Sbjct: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1419 bits (3673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/963 (71%), Positives = 803/963 (83%), Gaps = 25/963 (2%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ ++FGVI SN+NC+WLP  S +N  + PGQ+ITSALEN+NIWDIKTG+L 
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLP--SDSNPSTSPGQIITSALENINIWDIKTGELS 58

Query: 61  ATLSDGL--PPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN 118
           + L D L  PPG+ DA+ +KPAE TYL+ H+DT+LLAVGY DGVIKVWDL SKTVL N N
Sbjct: 59  SHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLN 118

Query: 119 GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQ-----G 173
           GH +AIT+L+FDSTGTRLISGSRDSNIIVWDLV EVGLYKLRSHKD ITGIWC      G
Sbjct: 119 GHSSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNG 178

Query: 174 ED------WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVK 227
           ED      WLISTSKDG+IK+WDLK QQCIETHIAHTGECWS++V++DLLITT +DSQ+K
Sbjct: 179 EDDENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIK 238

Query: 228 IWKLNMENDKMGE--KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFR 285
           IW+LN++ND  G+  KL E G++EKQSKQRGL +EFI  A D   FFYIQNADKT+E FR
Sbjct: 239 IWELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTA-DETGFFYIQNADKTVEIFR 297

Query: 286 IRKEEEIAXXXXXXXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTT 345
           +RK++EI                T E+I ++IK SY SL++HPFQ +RS YK+K+ +WT 
Sbjct: 298 LRKQDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTI 357

Query: 346 VTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKL 405
            T SKLEL LTTSNNTIEYYS PYEKRE T P P K HTIELQGQRTD+RSIDISDDNKL
Sbjct: 358 ATPSKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKL 417

Query: 406 LATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLL 465
           LATASNG LKIWN+KT  CIRTFECGY+L+CKFLPGG LVI+GTR GELQLFDLASS+LL
Sbjct: 418 LATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLL 477

Query: 466 DTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHD 525
           +T+EDAHDAAIWSLDLTSDGKRLVTGSADK+VKFWDFQ+E  LV GT DK LP LKL HD
Sbjct: 478 ETIEDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHD 537

Query: 526 TTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           TTLELNDDILSV+ISP+D++LA+SLLDNTVKVFF+D+MKF+LSLYGHKLPVLSIDISFDS
Sbjct: 538 TTLELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDS 597

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           K+IITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD ++KYWDG+
Sbjct: 598 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGD 657

Query: 646 KFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQY 705
           KFECIQKL  HQSEVW++AIA++ SF+VSSSHDHSIRIWEETED+VF            Y
Sbjct: 658 KFECIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELY 717

Query: 706 EDTLLASLEEGNADDAFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEG 765
           EDTLL SLEE N DDAFK D  GED +DEA+ VHKQT+ESLKA ERLMEA D+G+ +IE 
Sbjct: 718 EDTLLTSLEEDNGDDAFKKD-GGED-KDEATDVHKQTMESLKASERLMEAFDLGMKEIEA 775

Query: 766 METYNKDMELWQRKKLGE-----APMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDA 820
           ME Y ++++ WQRK          P+KPQGN++L+A+ KTPE+YI+DTL RI+ SQLEDA
Sbjct: 776 MEEYERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDA 835

Query: 821 LMVMPFSYVLKFLKFIDTVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQI 880
           L+V+PFSY++KFLKFID V+ +K +L++HLPL+CR LFFI+K NHKELVSQKNEELK QI
Sbjct: 836 LLVLPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQI 895

Query: 881 NRVKTELRNALKSTEDDLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFE 940
            RVK  LRNALK+ EDDLGFN+QGLKFIKQQW L+HNYE+VD+ DQ+ +E   A+KR F 
Sbjct: 896 TRVKDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFG 955

Query: 941 TVI 943
           T+I
Sbjct: 956 TII 958

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1391 bits (3601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/943 (69%), Positives = 801/943 (84%), Gaps = 9/943 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+++FGVI++NANCVW+ P S+  K + PG +ITSALEN+NIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESK--KSNSPGSVITSALENINIWDIKTGELI 58

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           + LSDGLP G+ D + SKPAE +YL  H++T+LLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+AIT+++FD TGTRLISGSRDSNIIVWDLV EVGLYKLRSHKD I+GIWC+GEDWL+ST
Sbjct: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IK+WDLK QQCIETHIAHTGECW++ V +DLLIT+G D+Q+K+W L+   +  G 
Sbjct: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKE-AGS 237

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KL E GV++KQSKQRGL ++F + A +G +FFYIQNADKT E FRIR+EEEI+       
Sbjct: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKRE 296

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   TDEEI ++IK SYSS+++HPFQ I+S YK+KS S+TTV+++KLE V+TTS+N
Sbjct: 297 KRLKEKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           +IEYYSIPYEKR+ TSPAP + +TIEL G RTD+RS+DISDD+KLLATASNG LK+WN+K
Sbjct: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T  CIR F+CGYAL+CKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           +TSDG+RLVTGSADKT+KFW+FQVE  LVPGT DK LP++KL HDTT+E+N+D+LSVRIS
Sbjct: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           W++AI S+G+ V+S+SHDHS+R+WEET+DQVF           QYEDTLLASLEEG+ DD
Sbjct: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDD 716

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AFKGDA  E VEDE++ V  QT+ESLKAGERLMEALD+G+++IE  E Y  DM+ W++KK
Sbjct: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774

Query: 781 -LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839
             GE P+KPQGN++LIA+ K P +YI++TL +I+ SQLEDAL+V+PFSYVLK LKFID V
Sbjct: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834

Query: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899
           M++K +  ++L L+C+NLFF+I+ NHKEL+SQ+NE LK QI  VK  LR++L+   DDLG
Sbjct: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942
           FN+QGLKFIKQQWNL+HN++F D++D+  KE SS +KR+F T+
Sbjct: 895 FNIQGLKFIKQQWNLKHNFDFTDDFDK--KEESSGKKRIFGTL 935

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1383 bits (3580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/946 (70%), Positives = 793/946 (83%), Gaps = 11/946 (1%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+++FGVI+SN+N VW+P       G+GPG +ITSALEN+NIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIP------NGNGPGNIITSALENINIWDIKTGELV 54

Query: 61  ATLSDGLPP-GASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
             L+DGLPP G+ D++ SKPA  TY + HEDT+LLA GY+DGVIKVWDL+SKT+LL FNG
Sbjct: 55  NQLTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNG 114

Query: 120 HKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQG-EDWLI 178
           HK+AIT+L FDSTGTRLISGS DS+IIVWDLV EVGLYKLRSHKD ITGIWC   E+WLI
Sbjct: 115 HKSAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLI 174

Query: 179 STSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKM 238
           STSKDG+IK+WDLK QQC+ETHIAHTGECWSL + +DL++TT  +SQVK WKL++EN   
Sbjct: 175 STSKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPN 234

Query: 239 GEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXX 298
           G KL E G+FEKQSKQRGL VEFIT+  D VSFF+IQNADKT+E FRIRK++EI      
Sbjct: 235 GSKLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKK 294

Query: 299 XXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTS 358
                     TD+EIA+++  ++ S ++HPFQT+RS YK+KS  WT  TSSKLELV+TTS
Sbjct: 295 REKRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTS 354

Query: 359 NNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWN 418
           +NTIEYYS+ Y KR    P+  K HTIEL GQRTD+RSI ISDDNKLLATASNG LKIWN
Sbjct: 355 SNTIEYYSVTYAKRIPQPPS--KIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWN 412

Query: 419 VKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWS 478
           +KTHKCIRTFECGYAL CKFLPGGLLVI+GTR GELQLFDLASS+ L+ +EDAHDAAIWS
Sbjct: 413 LKTHKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWS 472

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVR 538
           LD+TSDGKRL+TGSADKTVKFWDF+++   V GT+D  +P+LKL HDTTLE+ +DIL VR
Sbjct: 473 LDITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVR 532

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           +SPDD++LA+SLLD TVK+FFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIK
Sbjct: 533 LSPDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIK 592

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWGLDFGDCHKSLFAH DSIM+VKFL  SHNFFSCSKD  +KYWDG+KFECIQKL AHQ+
Sbjct: 593 IWGLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQN 652

Query: 659 EVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNA 718
           EVW++AIA + SFVVSSSHDHS+RIWEETEDQVF           QYE+TLL SLEEG  
Sbjct: 653 EVWSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTG 712

Query: 719 DDAFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQR 778
           D AFK D  G + EDEA+ VHKQT ESLKAGERLMEALD+GI +IE  ETY KD+ELW++
Sbjct: 713 DSAFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKK 772

Query: 779 KKL-GEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFID 837
           KK+ G+AP+KPQGN++L A+NKTPEQYIL+TL +I+ SQLEDA++V PFSYVLKFLKFID
Sbjct: 773 KKIGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFID 832

Query: 838 TVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDD 897
            V+ +  +L++HL L+C+NLFF+IK NHKEL+SQKNE+LKLQ++RVK  LR AL+  EDD
Sbjct: 833 IVLNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDD 892

Query: 898 LGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           LG+N+QGLKFIKQQWNL HN+EF DE DQ  +E+ S +KRVF T++
Sbjct: 893 LGYNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV 938

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1379 bits (3570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/944 (68%), Positives = 791/944 (83%), Gaps = 7/944 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQSA FGVI+SN+NCV++PP++R     G GQ++T  LE VN+WD+KTGDL+
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANR----KGLGQVLTGGLEKVNLWDLKTGDLV 56

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           + LSDGLPPG+ DA+ +KPAE TYLE H +T+LLAVGYA+GVIKVWDLMSKTVLL  NGH
Sbjct: 57  SCLSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGH 116

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+A+T+L+FD TGTRLISGS+DSNII+WDL+GEVGLYKLRSHK  I+G+W + ++WLIST
Sbjct: 117 KSAVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLIST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           S+DG+IK+WDLKTQQC+ETHIAHTGECWSL V +DL IT   DSQVKIW LN E++  G 
Sbjct: 177 SRDGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESE-AGS 235

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KL E G++EKQS QRG  +EF+T  +D  +FFYIQNADK+IE FRIRKEEEI        
Sbjct: 236 KLIEKGIYEKQSNQRGSSIEFVTT-TDETTFFYIQNADKSIEIFRIRKEEEILKATRKRE 294

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   +DEEI ++I+  Y S+++HPFQ +RS +KVK+A+W   T+SKL+LV+TT++N
Sbjct: 295 KRLKEKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASN 354

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           T+EYY+IPYEKRE   PAP + H++ELQG RTDVR++DIS+D+ LLATASNG+LK+WN+K
Sbjct: 355 TVEYYTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLK 414

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T  C+RTF+CGYAL C+FLPGG L+++GTR G+LQLFDLASS++LD  E AHDAAIWSLD
Sbjct: 415 TRMCLRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           +TSDGK+LVTGSADK+VKFW FQVE  L+ GT DK  P++KL+HDTTLELNDD+LSVRIS
Sbjct: 475 ITSDGKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D+Y AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 535 PEDKYFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKD +VKYWDG+KFECIQKL  HQSEV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEV 654

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALAI++NG +VVS+SHD SIRIWEETEDQVF           Q E  LL+SLEEG+ D 
Sbjct: 655 WALAISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDA 714

Query: 721 AFKGDAAGEDV-EDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRK 779
           AF+ D  G++  +DEA+ V KQT+ESLKAGERLMEALD+GI +IE  E Y K+++ W + 
Sbjct: 715 AFRKDVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKH 774

Query: 780 KLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839
           K    P+KP GN++L A++KTPE+YIL+TL+RI+ SQLEDAL+V+PFSYVLKF +FID  
Sbjct: 775 KGDAKPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAA 834

Query: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899
           + +  +L  +LPL+C+NLFFI+K NH+ELVSQKNEELKL+I +VK  LR ALKS EDDLG
Sbjct: 835 LLDNRILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           FN++GLKFI++QW+LRH  EFVD+Y Q+E+E+ +A+KRVFET++
Sbjct: 895 FNIEGLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETIV 938

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1367 bits (3538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/942 (67%), Positives = 788/942 (83%), Gaps = 6/942 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ ++FGVI +NANCVWLP S   ++ S  GQ++T ALEN+N+WDIKTG+LL
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSD--SRKSNVGQVLTGALENINLWDIKTGELL 58

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           + LSDGLPPG+ D + SKPAE TYLE H++T+LLA GYADGVIK+WDLMSKTVLL+F+GH
Sbjct: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+ +T+L+FDSTGTRL+SGSRDS+II+WDLV EVG++KLRSHKD ITGIWC+GEDWL+ST
Sbjct: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           +KDG+IKLWDLKTQQC+ETHIA TGECW+L V  DL++TTGTDSQ+KIW L+   +  G 
Sbjct: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-GS 237

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           K+ E G +EKQSKQRGL V F T A D  +F YIQN+DKT+E FRIRK++EI+       
Sbjct: 238 KIVEKGTYEKQSKQRGLSVNFKTTA-DETTFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   TDE+I +    +Y SL+L PFQ I+S YK+K+ SWT   +SK+ELV+TTS+N
Sbjct: 297 KRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSN 356

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR   +P+P K +TIE +G RTD+RSIDISDDNKLLA+ASNG LKIWN+K
Sbjct: 357 TIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLK 416

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T  CIRTF+CGYAL+CKFLP G L ++GTR G++QLFDL +S+L+++++ AH+AAIWSLD
Sbjct: 417 TKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           +T DGKRLVTGSADK++KFW+F +E  LVPGT DK +P++KL HDTTLELNDDILSV+IS
Sbjct: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+V FLPESHNFFS SKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALAI S+GS VVSSSHDHS+R+W+ET+DQVF           QYEDTLL SLEEG+ D 
Sbjct: 657 WALAITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDS 716

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AFK D   ED  DE++ V  QT+ESLK+GERLMEAL++G ++IE +E YNKD + W++KK
Sbjct: 717 AFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
            GE P+KPQGN++L+A+N+ P+QYI+DTL +I+ SQLEDAL+V+PFSYVL+FLKFID VM
Sbjct: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
            +  +L + L L+C+NLF I+K NHKEL+SQ+N+ LK QI  VK +LR +L++  DDLGF
Sbjct: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942
           N+QGLKFIKQQWNL+HNYEF+DE DQ+++E  +++KR+F T+
Sbjct: 895 NIQGLKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTL 936

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1365 bits (3534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/943 (69%), Positives = 792/943 (83%), Gaps = 7/943 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSS-RTNKGSGPGQLITSALENVNIWDIKTGDL 59
           MVKSYQRFEQS++FGV++S  N +W+P  + RTN   GPGQ+IT ALENVNIWDIKTG+L
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTN---GPGQIITGALENVNIWDIKTGEL 57

Query: 60  LATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
           ++ LSDGLPPGA DAR +KPAE TY++ + DT LLAVGYADGVIK+WD+ SKTVLL+FNG
Sbjct: 58  VSHLSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNG 117

Query: 120 HKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIS 179
           H++A+T L FDSTGTRLISGSRDSNIIVWDLV EVGLYKLRSHKD ITG+    E+WL+S
Sbjct: 118 HRSAVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMS 177

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMG 239
            SKDG+IKLWDLK QQC+ETHIAH GECW+L V +D+++TT +DSQ+KIW L+++ D  G
Sbjct: 178 VSKDGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDAD-AG 236

Query: 240 EKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXX 299
            K+TE G+FEKQSKQRG+ V FIT  SDG  FFY+QNADKT+E  R+RKEEEI+      
Sbjct: 237 VKVTEKGIFEKQSKQRGVAVSFIT-VSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKR 295

Query: 300 XXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSN 359
                    TDEEI ++ K SY S+++H FQ +RS +K+++ASW   TSSKLEL +TTS 
Sbjct: 296 EKRFKEKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSG 355

Query: 360 NTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNV 419
           NTIEYYSIPYEKRE   P P++ H+IELQG RTDVR+IDISDD KLLATASNG LKIWN+
Sbjct: 356 NTIEYYSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNI 415

Query: 420 KTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSL 479
           +T  C+RTFECGYAL+CKFLPGG+LVI+GTR+G+LQLFDLASS++L+  E+AHDAAIWSL
Sbjct: 416 RTKTCLRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSL 475

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRI 539
           D+TSDG+RLVTGSADKTVKFW+F VE   VPGT DKL+P + L+HDTTLE++DDILSV+I
Sbjct: 476 DITSDGRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKI 535

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP+++ LA+SLLDNTVKVF+L++MKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKI
Sbjct: 536 SPENKLLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKI 595

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           WGLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKDA VKYWDG+KFE IQKL  HQSE
Sbjct: 596 WGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSE 655

Query: 660 VWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNAD 719
           VWALA+A +G+ V+S SHD SIR+WEET+DQVF           Q E+ LL SLEEG+ D
Sbjct: 656 VWALAVARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGD 715

Query: 720 DAFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRK 779
            AFK     +D  D+A  VHKQT+ESLKAGERLMEA+D+GI +IE  E Y K+++LW++K
Sbjct: 716 SAFK-QDEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKK 774

Query: 780 KLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839
           K G  P +PQ N++L+A+NK PE+YI+DTL RI+ SQLEDAL+ +PFSYVLKFLKF+DTV
Sbjct: 775 KQGVEPERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTV 834

Query: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899
           +Q+K LLH+HL L+C+NLFFI++ NH+ELVSQKNEELK +I RVK ELR ALK+ EDDLG
Sbjct: 835 LQDKKLLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942
           FN++GLKFIKQQWNL+HNYEFVDE+DQ+++   +A+KRVFET+
Sbjct: 895 FNIEGLKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETL 937

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1357 bits (3512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/944 (66%), Positives = 783/944 (82%), Gaps = 8/944 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+++ GVI+SN+NC+W+P  +R    +  GQ++T ALENVN W +K+GDLL
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETR----NASGQVLTGALENVNCWSMKSGDLL 56

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           +TLSDGLPPGA DA+ SKPAE T+L+ H +T LLA GY DGV+K+WDL+SK+VL+NFNGH
Sbjct: 57  STLSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGH 116

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+AIT+L+FDSTGTRLISGS+DS+IIVWDLVGEVGL+KLRSHKD ITG+WC+GEDWL+ST
Sbjct: 117 KSAITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IK+WDLKTQQC+ETH+AH GECWS+ V +DL++T G D+Q+K+W ++ E   +G 
Sbjct: 177 SKDGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEK-PVGS 235

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
            LTE G  EKQSKQRG+ VEF T  SDGV+FF++QNAD+T+ETFR+R E+EI+       
Sbjct: 236 MLTERGTHEKQSKQRGVSVEF-TTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKRE 294

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   T EEI  ++K SY+S ++HPFQ +RS YK+KSA W   T+SKLE+V++TSNN
Sbjct: 295 KRLSDKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNN 354

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           T++YYSIPY K+E   P+P K ++I+++G RTDVR+IDISDDNKLLATASNGSLKIWN+K
Sbjct: 355 TVDYYSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIK 414

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T  CIRTFECGYAL+CKFLPGG LV++GT+TG+L LFDLASS+LL ++E AH  AIWSLD
Sbjct: 415 TKSCIRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LT+DGKRLVTGSADK+V+FWDFQVE  LVPGT DK +P LK+ HDTTLELNDD+L+V+IS
Sbjct: 475 LTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PD+R LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIK+W
Sbjct: 535 PDNRLLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAH DSIM V FLPESHNFFSC KD +VKYWDG+KFECIQKL AHQ EV
Sbjct: 595 GLDFGDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEV 654

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           W +AI+ +G+FVVS+SHD SIR+W ET+DQVF           QYE TLL SLE+G  D 
Sbjct: 655 WTIAISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDA 714

Query: 721 AFKGDA-AGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRK 779
            F GD   G ++ DEA+ VHKQT ESLKA ERLMEA+D+G+A+I     Y + ++ WQ+K
Sbjct: 715 MFHGDGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKK 774

Query: 780 KLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839
           K G  P +PQ NS+LIA+NKTP +YI+D L+RI+ SQLEDAL+V+PFSYVL+FL FI+ V
Sbjct: 775 KSGPHPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELV 834

Query: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899
           +++K+L+  HLPL+C+NLFFIIK NH+EL SQKNE+LK+QI+R+K  LRN++K+  DDLG
Sbjct: 835 IEDKSLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           FN+QGLKFIKQQWNL+HN+EF D+     K++   +KRVFETV+
Sbjct: 895 FNIQGLKFIKQQWNLKHNFEFSDDV-IISKQDKKVKKRVFETVV 937

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1357 bits (3511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/936 (68%), Positives = 777/936 (83%), Gaps = 5/936 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQS++FGVI+SN+NCVW+PPSS+ +     G++IT ALEN+++WD+KT +L 
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKS--KSLGKVITGALENISVWDLKTSELE 58

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             LSDGLPPG+ D + SKPAE +YL+ H +T L+A GYADGVIK+WDL+SKTVLL+FNGH
Sbjct: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+ IT+L+FD TGT+LISGS DSNIIVWDLV EVGLYKLRSHK  ITG+WC  ++WLIST
Sbjct: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IK+WDLKTQQCIETHIAHTGECW+L +  D ++T+  DSQ+KIW++++E +  G 
Sbjct: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KL E G FEKQSKQRGL +EF T  SDGV FFY+QNADKT+E FR+RK+ EIA       
Sbjct: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   T+E+I  +I  SY S V+HPFQ +RS YK+KS +WT   S+KLE+V+TT++N
Sbjct: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYS+PYEKR+ TSP P+K HTIELQG RTDVRSIDISDDN LLATASNG LKIWN+ 
Sbjct: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T  CIRTFECGYAL+CKFLPGGLLV++GTR G LQLFDLASS LL T+E AH+ AIWSLD
Sbjct: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           +T+DGKRLVTGSADK++KFWDFQV+  L+ GT DK +P + + HD+TLEL DDILS++IS
Sbjct: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALA++ NG  VVS SHDHSIRIWEET+DQVF           QYEDTLLASLEEGNADD
Sbjct: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADD 716

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
            FKGD    D +DEA+ V KQT+ESLKAGERLM+ALD+GI +IE ME Y  +M  +++K+
Sbjct: 717 TFKGDVKN-DEDDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ 775

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
             +AP+KP GN++L+AV KTP +YI+DTL  I+ SQLED+L+V+PFSYVLKFLKF D VM
Sbjct: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           +   +L++ L L+C+NLFFI+K N KELVSQKNEELKLQI+RVK +LR+AL++ EDDLGF
Sbjct: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARK 936
           N+QGLKFIKQQWN++HN+EFVD+YDQQ +   SA+K
Sbjct: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1352 bits (3499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/947 (68%), Positives = 790/947 (83%), Gaps = 9/947 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQSA+FGVI+S AN VWLPP    + GS PGQ+ITSALENVNIWDIKTG+L+
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGS-PGQIITSALENVNIWDIKTGELI 59

Query: 61  ATLSDGLPPGASDAR-GSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
           A L DG+ PG++D++  +KPAE T+L+ H D+ LLAVGY DG IKVWDL+SKTVL+N NG
Sbjct: 60  AQLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNG 119

Query: 120 HKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE-DWLI 178
           HK++IT+L+FD   TRL+SGS DSNII+WDLV EVG+ KLRSHKD I+ ++   + +WL+
Sbjct: 120 HKSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLL 179

Query: 179 STSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKM 238
           S SKDG+IK+WDLKT QC+ETHIAHTGECWSL +KDD++ITT   SQ+K+W L+++ + +
Sbjct: 180 SVSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGE-V 238

Query: 239 GEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXX 298
           G KL E GV+EKQSKQRG  V+FI N+S GV+FF I NADKTIE FRIR +EEI      
Sbjct: 239 GSKLIEKGVYEKQSKQRGTSVKFIENSS-GVAFFAIGNADKTIEIFRIRPQEEITRALKK 297

Query: 299 XXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTS 358
                      DE+I ++IK S+ S ++H FQT+RS +K+KS SWT  T+SKLELV TTS
Sbjct: 298 REKRLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTS 357

Query: 359 NNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWN 418
           +NTIEYY+I YEKRE T PAP + +TIELQG RTD+R+ DISDDN LLATASNG LKIWN
Sbjct: 358 SNTIEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWN 417

Query: 419 VKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWS 478
           ++T +CIRTF+CGYAL+CKFLPGGLLVILGTR GELQLFDLASS+ ++ +E AHDAAIWS
Sbjct: 418 LRTKQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWS 477

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVR 538
           LDLTS+GKRLVTGSADKTVKFWDFQ+E   + GT  K    L LNHDTTLELNDD+L V+
Sbjct: 478 LDLTSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVK 537

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           ISP+D++LA+SLLDNTVK+FFLD+MKF+LSLYGHKLPVLSIDISFDSKM+ITSSADKNIK
Sbjct: 538 ISPEDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIK 597

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWGLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG+KFEC+QKL +HQS
Sbjct: 598 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQS 657

Query: 659 EVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNA 718
           EVW LA+  +GSFVVS+SHDHSIRIW+ETEDQVF           QYE+TLL SLEEG  
Sbjct: 658 EVWCLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTG 717

Query: 719 DDAFKGDAA-GEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQ 777
           DDAFK D+  GE   DEA+ VHKQT+ESLKA E+LM+ALD+G+ +IE ME YN DM LW+
Sbjct: 718 DDAFKKDSVDGEG--DEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWK 775

Query: 778 RKKLG-EAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFI 836
           +KK+G E P+KP GN+VL+AV K+PEQYI++TL+RI+ SQLEDAL+++PFSYVLKFLKFI
Sbjct: 776 KKKIGSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFI 835

Query: 837 DTVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTED 896
           D V++NK +LH++L L+C+NLFFI++ NHKEL+SQKNEELKLQI RVK ELRN LK  ED
Sbjct: 836 DIVLKNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNED 895

Query: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
            LGFN+QGLKFIKQQW+L+HN+EFVDEYDQ+ +E   A+KR+FET++
Sbjct: 896 ALGFNIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV 942

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1337 bits (3460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/942 (66%), Positives = 770/942 (81%), Gaps = 3/942 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+ +FGVI+SN+N VW+ P +   K    GQ+I   LEN+ +WDIKTG+ +
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           A L+DGLPPGASDA+ SKPAE T+L+ H +T+LLA GYADGVIK+WDL+SKTVL++FNGH
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+AIT+L FD+TGTRLIS S+DS+IIVWDLVGE GLYKLRSHKD ITG+WC+ E+WLIST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG++K+WDLK+QQC+ETH+AHTGECWSL + +D+ +T   DSQVK+WKL+++ +  G 
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-GS 239

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           KLTE G+ EKQSKQRG++++F   A DGV FFYIQNADKTIE +R+RKEEEI+       
Sbjct: 240 KLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKRE 298

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   ++EEI  ++ GS  SL+ H FQ +RS YK+KSA WT  ++SKLELV+TTSNN
Sbjct: 299 KRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNN 357

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           +IEYYSIPY KRE T PAPLK HTI+L GQRTD+RS  ISDDNKLLATASNGSLKIWN+K
Sbjct: 358 SIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIK 417

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T +CIR+FECGYAL+CKFLPGG LV++GTR GELQLFD+ASS++LD  E AHDAAIWSLD
Sbjct: 418 TKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLD 477

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDG++LVTGSADKTV+FW F+V    V    +K +PML+L HDTTLEL+DDILSV IS
Sbjct: 478 LTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVIS 537

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKIW
Sbjct: 538 PDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIW 597

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKDA VKYWDG+KFECIQKL AHQSEV
Sbjct: 598 GLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEV 657

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           W+++++++G+FV+S+ HDHSIR+WEETEDQVF           QYEDTLL SLE G  D+
Sbjct: 658 WSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDE 717

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
                    +  +E  GVHKQT+ESLKAGERLMEAL+IG+ DI  ME +N+ +  W++ K
Sbjct: 718 MLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK 777

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
            G  P++PQ N++L+A+ KTPE+YI++TL +I+ SQ+EDALMVMPFSY+LKFLKFID V 
Sbjct: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
               LL  H+ LVC+ LFF+I+FN+KELV+QKN  LKLQI RVK  LR +LKS  D+LGF
Sbjct: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942
           N++G+KFIKQQW L H+ EF DEY+++  E   ++KRVF T+
Sbjct: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1334 bits (3452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/944 (65%), Positives = 773/944 (81%), Gaps = 8/944 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ ++FGVI+SN+NC+WLP  +R    +  GQ++T ALENVN W +K+G+L+
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENR----NSTGQVLTGALENVNCWSMKSGELI 56

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
            TL+DGLPPGA DA+ +KPAE +YL+ H +T LLAVGY DG IK+WDL+SK+VL++FNGH
Sbjct: 57  GTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGH 116

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
           K+AIT+L FD TGTRLISGSRDS+IIVWDLVGEVGLYKLRSHKD ITG+WC+GE+WLIST
Sbjct: 117 KSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLIST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IK+WDLK QQC+ETH+AH GECWS+ V +DL+IT G D+Q+K+W LN E +  G 
Sbjct: 177 SKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFE-ESAGS 235

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
            L E G  EKQS+QRG+ ++F T  SD  +FF+IQNAD+++ETFR+RK++EIA       
Sbjct: 236 MLIEKGTHEKQSRQRGVAIQF-TTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKRE 294

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   +++EI +++K S++S ++HPFQ +RS YKV+S  W T T+SKL+LV+TT+NN
Sbjct: 295 KRLTEKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANN 354

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           T++YYSI Y+KRE T P+P K H+I+++G R+DVR+IDIS DNKLLATASNG+LKIWN+K
Sbjct: 355 TVDYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIK 414

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T+ CIRTFECGYAL+CKFLPGG LV+LGT+TG+L L+DLASS+LL+T+E AH  AIWSLD
Sbjct: 415 TNSCIRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           +T+DGKRLVTGSADKTV FWDFQVE   VPGT DK  P LK+ HDTTLELNDD+L+V+IS
Sbjct: 475 MTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PD+R LA+SLLDNTVKVFF+DSMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 535 PDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCH+SLFAH DSIM V F+PESHNFFSCSKDA+VKYWDG+KFECIQKL AHQ EV
Sbjct: 595 GLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEV 654

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           W LAI+S+G FVVS+SHD SIR+W ET+DQVF           QYE TLL SLE G  DD
Sbjct: 655 WTLAISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDD 714

Query: 721 AFKGDAAGE-DVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRK 779
            F+ D  G+ ++ D+A+ VHKQT ESLKA E+LMEALD+G+++I  +  Y K ++ W++K
Sbjct: 715 MFEKDGNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKK 774

Query: 780 KLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839
           + G  P KP  NS+L+A+NKTP +YI+D L +I+ SQLEDAL+V+PF+YVL FL FID V
Sbjct: 775 RSGPHPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLV 834

Query: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899
           ++ K L    LPL+CRNLFFIIK NH+EL SQKNEELK+Q+NR+K  LR ++K+  DDLG
Sbjct: 835 LKEKELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943
           FN+QGL FIKQQWN++HN+EF D+     K N  A+KRVFET++
Sbjct: 895 FNIQGLTFIKQQWNMKHNFEFSDDI-TVNKTNEKAKKRVFETLV 937

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1324 bits (3427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/943 (65%), Positives = 768/943 (81%), Gaps = 7/943 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPP-SSRTNKGSGPGQLITSALENVNIWDIKTGDL 59
           MV SYQRFEQ + FGVIASN+NCVW+P   SRT+    PGQ+ITS+LEN+N WDIKTG+L
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS----PGQIITSSLENINCWDIKTGNL 56

Query: 60  LATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
           L TLSD +PPG+ DA+  KPAE  YLE H +T+LLA GYADGVIK+WD+ ++TVL+ FN 
Sbjct: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNS 116

Query: 120 HKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIS 179
           H AAIT L+FD +GTRLISGSRDSNII+WDLVGEVGL KLRSHKD ITGIW + +DWLIS
Sbjct: 117 HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIS 176

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMG 239
           TSKDG+IK+WD+K+QQC+ETH+AHT ECWSL++ DDL++T   DS++KIW+L++E +  G
Sbjct: 177 TSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-G 235

Query: 240 EKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXX 299
            KL E G++EKQS+QR + V+ +TN  D V FFY+QNADKT E FRIR   E++      
Sbjct: 236 SKLKEKGIYEKQSRQRSVDVKIVTNP-DEVKFFYVQNADKTTEVFRIRTSSELSKALKKR 294

Query: 300 XXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSN 359
                    +++EI   IK S+ + ++ PFQ +RS +K KSA+WT  + SKLELV TTSN
Sbjct: 295 EKRLKEKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSN 354

Query: 360 NTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNV 419
           NTIEYYSIPY+ ++ T  A  K +TIELQG RTDVRSIDIS+DNKLLA ASNG LKIWN+
Sbjct: 355 NTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNI 414

Query: 420 KTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSL 479
            T  CIRTF+CGYAL CKFLPGG LV++GTR GELQLFDLASS +L+  E AHDAAIWSL
Sbjct: 415 TTQSCIRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSL 474

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRI 539
           DLTSDG+RL+TGSADKTVKFW+FQVE  L+  + DK    L++ HDTTLEL +DILSV+I
Sbjct: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKI 534

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKI
Sbjct: 535 SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKI 594

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           WGLDFGDCH+SLFAHQD+IM+VKF+P+SHNFFSC KD V+KYWDG KF+CIQKL AH+SE
Sbjct: 595 WGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSE 654

Query: 660 VWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNAD 719
           VWALA++S+G F VS SHD SIR+WEETEDQVF           QYE+ LL++LE   +D
Sbjct: 655 VWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASD 714

Query: 720 DAFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRK 779
           + F  ++  +    E + VHKQT+ESLKAGERLMEALD+GI+++E  E Y++++ LW + 
Sbjct: 715 EKFARNSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKN 774

Query: 780 KLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839
           K G+ PMKPQ NS+LIAVNK PE+YI+DTL RI+ +QLEDAL+V+PFSYVLKFLKFID  
Sbjct: 775 KSGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDAS 834

Query: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899
           ++ K L+++HLPL+CRNL +++K NHKEL++QKNEELKLQIN+VK +LR ALK   DDLG
Sbjct: 835 IEKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942
           FN++GLKFIKQQWN++HN+EFVDEYDQ++ E  S++KRVF TV
Sbjct: 895 FNIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1305 bits (3377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/941 (65%), Positives = 752/941 (79%), Gaps = 7/941 (0%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQ+ +FGV+ +N+NCVWLP  ++    + PGQ+IT ALE V  W+IKTG+LL
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK----NSPGQVITGALEEVKCWEIKTGELL 56

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
            T+ DGLPPGA D +  KPAE TYL+ HE+T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180
            +AIT+L+FD TGTRLISGSRD+ II+WDLV E GL KLRSHKD ITGIWC+ +DWLIS 
Sbjct: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240
           SKDG+IKLWD+K  QC+ETH+AHTGECWSL+VKD+++IT   +S++K+W+L++E    G 
Sbjct: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
            L E G +EKQSKQR  ++ F T  +DG +FFY  N+DKT+E FRIR E EIA       
Sbjct: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                   +DEEI  S + SY++L+LHPFQ +RS +K+K++SWT  T SKLELV+TT+NN
Sbjct: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420
           TIEYYSIPY+K+E   P  +K H+IE  G RTD+R+ DIS D+KLLATASNG+LK+WN+K
Sbjct: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414

Query: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480
           T  CIR  +CGYAL CKFLPGG LVILGTR G+LQLFDLASS++L+ +E+AH AAIWSLD
Sbjct: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
           LTSDGKRLVT SADKTVKFWDF+VE  LV GT DK +P +KL HDTTL+L +D+  V+IS
Sbjct: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WALA++S+G  VVS SHD SIR+WEETEDQVF           QYE TLL SLE G+ DD
Sbjct: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDD 714

Query: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780
           AF  +   E    E++ VHKQT+ESLKAGERLMEALD+GI +I+  E Y + M+LW  KK
Sbjct: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773

Query: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840
           LG+ P KPQ N++L A++KTPE Y+++TLS+I+ SQLEDAL+V+PFSYVLKFLKFID  +
Sbjct: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833

Query: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900
           +N  +LH  LPL+C+ L F+++ NHKELVSQKNEELK+QINRVK +LR AL+S  DDLGF
Sbjct: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFET 941
           N+QGLKF++  WN+ HNY+F DEYDQ  KE   ++KR+F T
Sbjct: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/946 (62%), Positives = 741/946 (78%), Gaps = 15/946 (1%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           MVKSYQRFEQS +FG+I+++   ++LP ++ T+     G+LIT ALEN+ IW +KT ++ 
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNSTS-----GKLITGALENIQIWTLKTNEV- 54

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             L+DGLP GA +   SKP+  T +  H++T+LL VGY DGVIKVWDL+SK+VL+ FNGH
Sbjct: 55  EVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGH 114

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC-QGEDWLIS 179
           K+ +T+L+ DS GTRL+SGS+DS++I+WDLVGEVGL KLRSHKD ITGIW     DWLIS
Sbjct: 115 KSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLIS 174

Query: 180 TSKDGMIKLWDLKTQ-QCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKM 238
            +KDG+IK+WDLK   QC+ETH+AHTG+CWS+++ ++++ITT  DSQ KIW+L++E    
Sbjct: 175 VAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSN- 233

Query: 239 GEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXX 298
           GEK++E G FE +SKQRG+  EFIT A +G  FFYIQN DKTIE FRIR EEEI      
Sbjct: 234 GEKISERGTFETESKQRGVSTEFIT-APNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNR 292

Query: 299 XXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTS 358
                     ++EEI  ++  +  S++ H F T+RS YK+KS++W   ++SKLE+VLTTS
Sbjct: 293 REKRLRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTS 352

Query: 359 NNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWN 418
           NNTIE Y IPY KR+A    P++ + +ELQG RTD+RS+DISDD KLL+TASNG LK+WN
Sbjct: 353 NNTIESYQIPYSKRDA--EPPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWN 410

Query: 419 VKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWS 478
           + T KCIRTF CGYAL  + LPGGLLV++GTR GELQLFDLASS+LL T E AH AAIWS
Sbjct: 411 LTTKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWS 469

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVR 538
           LDLTS+GKRLVTGSADK+ KFWDF+V   LVPGTKDK +P LKL HDTTLEL DDIL+V+
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           IS +DRYLA+SLLDNTVKVFF DS+KFYLSLYGHKLPVLSID S DSKM+ITSSADKNIK
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWG+DFGDCHKS+FAHQDSIMSV+F  ++HNFFSC KD  VK WDG+KF+CIQKL  HQS
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 659 EVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNA 718
           EVW +A++ +G  VVS+SHDHSIR+W+ET+DQVF           +YE+TLL SLE G+ 
Sbjct: 650 EVWCIAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSG 709

Query: 719 DDAFKGDA-AGED-VEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELW 776
           DD F  D  +G+D V DE SGV+KQTLESLKAGE+LMEALD+G+A+IE  E Y K ++ W
Sbjct: 710 DDQFLRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSW 769

Query: 777 QRKKLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFI 836
           ++KK GE PMKPQ N++LIA+   PE+YI+DTL +I+ SQLED+L+V+PFSYV+KF KF 
Sbjct: 770 KKKKSGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFF 829

Query: 837 DTVMQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTED 896
           D +M+ K L+  HL L+C+ LFFI++ N+KELV+QKNEELK +I RVKT +R  L+   D
Sbjct: 830 DVIMKQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNAD 889

Query: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942
           DLGFN+ GL FIKQQWNLRHN EF D+Y Q E E   A+KRVFETV
Sbjct: 890 DLGFNIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 169/716 (23%), Positives = 295/716 (41%), Gaps = 138/716 (19%)

Query: 39  GQLIT--SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           GQ +T  S  + + I+ +KTG ++ ++    P    DA  +             + LLAV
Sbjct: 73  GQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADST-------------STLLAV 119

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DSTGTRLISGSRDSNIIVWDLVG 152
           G  DG I V D+ +  +  +F GH   I+ L+F    DS    L SG  +  + VWDLV 
Sbjct: 120 GGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVK 179

Query: 153 EVGLYKLRSHKDCITG---IWCQGEDW----LISTSKDGMIKLWDL---KTQQCIETHIA 202
              L+ L+ H   + G   +  Q  D     L+S  +D +I +WD    KT + I+T   
Sbjct: 180 RKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWDFNMKKTCKLIKTLPV 239

Query: 203 H--TGECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQSKQRGLK 258
           +     C  L   DD  L+ T G D+  ++  L            E G+  K++  + ++
Sbjct: 240 NQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDL------------ESGIMIKKT-NKPIE 286

Query: 259 VEFITNASDGVSF--FYIQNADKTIETFR----IRKEEEIAXXXXXXXXXXXXXXXTDEE 312
             FI      VS    ++  +D+T++       I+ E EI                   E
Sbjct: 287 ELFIIGVLPIVSSSKMFLVMSDQTLQLINVEEVIKSENEII------------------E 328

Query: 313 IARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKR 372
           ++ +I G++  +    F                V     +L L T++ ++    IP +  
Sbjct: 329 VSSTIAGNHGIIADMRF----------------VGPELNKLALATNSPSLRIIPIP-DLA 371

Query: 373 EATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECG 431
             T+  PL     E  G    + S+D ++D   +ATAS + S  +W  K ++  R FE  
Sbjct: 372 GTTASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASKDNSAIVW--KYNENTRKFE-- 425

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKR---- 487
             +  K++                                H +A+ ++ L     +    
Sbjct: 426 --VYSKYI-------------------------------GHSSAVTAVGLPKIMPKGYPE 452

Query: 488 -LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYL 546
            L+T S D T+K W  ++     P      +  +K++  T      DI ++ ISP+D   
Sbjct: 453 FLLTASNDLTIKKW--KIPKPTFPFD----VQTIKVSEYTRHAHEKDINALSISPNDSIF 506

Query: 547 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD 606
           A +  D T K++ L++ +   +L  HK  +  +      K++ T S DK +KIW LD   
Sbjct: 507 ATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFS 566

Query: 607 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIA 666
             K+L  H +++    F+ +     SC  D ++K WD    EC++ L  H + +WAL   
Sbjct: 567 VMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTM 626

Query: 667 SNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           ++G  +VS+  D   + W++  +Q             + E +L   + +G+  +AF
Sbjct: 627 NDGDIIVSADADGVFQFWKDCTEQEKEEEQEKAKLQVEQEQSLQNYISQGDWTNAF 682

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 18/188 (9%)

Query: 508 LVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L PG+++ +       H  + E   +I +++++PD +YL        +K+F L + K   
Sbjct: 45  LTPGSRNII-------HRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVR 97

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           S+     P   +D    S ++     D +I +  ++ G    S   H  +I S+KF  + 
Sbjct: 98  SMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQL 156

Query: 628 HN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIA----SNGSF--VVSSSH 677
            +      S   + +VK WD  K +C+  L  H S V  L I     S+  F  ++S   
Sbjct: 157 DSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGR 216

Query: 678 DHSIRIWE 685
           D  I IW+
Sbjct: 217 DDIINIWD 224

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 153/626 (24%), Positives = 273/626 (43%), Gaps = 122/626 (19%)

Query: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDS--TGTRLISGSRDSNII--VW 148
           L+A+G  DG I V D+ +  +  +F GH   I+ L+F     G + +  S D+N +  VW
Sbjct: 115 LIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVW 174

Query: 149 DLVGEVGLYKLRSHKDCITGI---WCQGEDW--LISTSKDGMIKLWDL---KTQQCIETH 200
           DLV    L+ ++ H   I G+     +GED   L+S  +D ++ LW+    K  + ++T 
Sbjct: 175 DLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWEFNMKKHSKLLKTV 234

Query: 201 IAHTG-ECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQSKQRGLKV 259
             H   E      + DL+ T G ++ +++  +++E+ K+ +K            Q+ ++ 
Sbjct: 235 PVHQQVESCGFVRESDLVYTAGGEAVLQL--ISLESQKVIKK-----------TQKPIEE 281

Query: 260 EFITNASDGVSF--FYIQNADKTIETFRIRKEEEIAXXXXXXXXXXXXXXXTDEE---IA 314
            FI      +S   FY+  +D+T++   I  EE I+                D+E   +A
Sbjct: 282 LFIVGVLPILSGREFYLVLSDQTLQL--INMEEAISNF--------------DDELINVA 325

Query: 315 RSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKREA 374
            SI G++ ++                A    V     ++ L T++  +    IP +  E 
Sbjct: 326 SSIAGNHGTI----------------ADIRVVGPGLNKIALATNSPALRIIPIP-QTSEN 368

Query: 375 TSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKI---WNVKTHKCIRTFECG 431
           + P  ++ +    +G    + S+D ++D   LAT S  S  I   +NV+T          
Sbjct: 369 SLPLDVEVY----EGHEDLLNSLDATEDGLWLATCSKDSSAILWRFNVET---------- 414

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKR---- 487
                KF P          TG                   H A++ ++ L +   R    
Sbjct: 415 ----AKFFP------YAKFTG-------------------HSASVTAVALPNVMLRGWPE 445

Query: 488 -LVTGSADKTVKFWDFQVENTLVPGTKD-KLLPMLKLNHDTTLELNDDILSVRISPDDRY 545
            L+T S D TVK W         P  +D   L  +K +  T      DI ++ ++P+D  
Sbjct: 446 FLITASNDLTVKRWKVPK-----PANEDISDLLTIKQSEYTFHVHAKDINALSLAPNDSL 500

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ +++ +   +L GHK  +  +      K++ TSS DK IKIW LD  
Sbjct: 501 FATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWNLDTF 560

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
            C K+L  H +++    F+ +     S   D ++K WD    +C++ L  H + +WA+ +
Sbjct: 561 SCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMNV 620

Query: 666 ASNGSFVVSSSHDHSIRIWEE-TEDQ 690
            ++G  ++S+  D   + W + TE+Q
Sbjct: 621 CNDGDLIISADADGVFQFWRDCTEEQ 646

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 67/149 (44%), Gaps = 3/149 (2%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           L +  +  L A    D   K+WD+ +        GHK  +  + F      L + S D  
Sbjct: 492 LSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKT 551

Query: 145 IIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
           I +W+L     +  L  H + +    +   +  L+S+  DG+IK+WD  T  C++T   H
Sbjct: 552 IKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGH 611

Query: 204 TGECWSLSVKD--DLLITTGTDSQVKIWK 230
               W+++V +  DL+I+   D   + W+
Sbjct: 612 GNRIWAMNVCNDGDLIISADADGVFQFWR 640

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 80/182 (43%), Gaps = 15/182 (8%)

Query: 515 KLLPMLKLNHDTTLELNDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
           +L P  KL H  T+E NDD   I ++R++PD RYL        +K+F LDSMK   S+  
Sbjct: 44  QLKPTQKLLH--TIE-NDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKI 100

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-- 629
              P   +D    S +I     D +I +  ++ G    S   H  +I S+KF  E +   
Sbjct: 101 SS-PSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDK 159

Query: 630 --FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI----ASNGSFVVSSSHDHSIRI 683
               S   + V K WD  K  C+  +  H S +  L        +   ++S   D  + +
Sbjct: 160 WLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNL 219

Query: 684 WE 685
           WE
Sbjct: 220 WE 221

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 13/140 (9%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMS 110
           IWD++TG+  ATL+ G   G  D      + C Y        LLA    D  IK+W+L +
Sbjct: 512 IWDVETGESKATLA-GHKRGLWDV-----SFCQY------DKLLATSSGDKTIKIWNLDT 559

Query: 111 KTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI- 169
            + +    GH  A+    F +   +L+S   D  I +WD +    L  L  H + I  + 
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 170 WCQGEDWLISTSKDGMIKLW 189
            C   D +IS   DG+ + W
Sbjct: 620 VCNDGDLIISADADGVFQFW 639

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query: 40  QLITSALEN-VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGY 98
           QL++S  +  + IWD  TGD L TL         D  G++      + V  D DL+    
Sbjct: 584 QLVSSGADGLIKIWDCITGDCLKTL---------DGHGNR---IWAMNVCNDGDLIISAD 631

Query: 99  ADGVIKVW 106
           ADGV + W
Sbjct: 632 ADGVFQFW 639

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 152/674 (22%), Positives = 277/674 (41%), Gaps = 123/674 (18%)

Query: 77  SKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DST 132
           S PA    L+  E + LLAVG  DG + V+D+ +  V  +  GH A I+ ++F    DS 
Sbjct: 101 SSPA--YVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSG 158

Query: 133 GTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQ----GEDWLISTSKDGMIKL 188
              L SG  +  + +WDLV    ++ ++ H   + G+  +     E  L+S  +D ++ +
Sbjct: 159 MWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHV 218

Query: 189 --WDLKTQQCIETHIA---HTGECWSLSVKDDLLITTGTDSQVKIWKLN-----MENDKM 238
             +D+K +  +   I        C  +     L+ T G D+  +I  L       +  + 
Sbjct: 219 HHFDMKKKCKLLQTIPVKRQIESCGFIGDNTSLIYTAGGDAVYQIISLESGKSIKQTAQP 278

Query: 239 GEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXX 298
            E+L  VGV   Q+  +                 Y+  +D+T+  F I  E+ ++     
Sbjct: 279 VEELFIVGVLPVQNSTK----------------CYLVLSDQTL--FLIDVEKALSQTEKM 320

Query: 299 XXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTS 358
                        EI + I G++ ++                A    V  S   L L T+
Sbjct: 321 I------------EIEKKIAGNHGTI----------------ADMRLVGPSLNRLALATN 352

Query: 359 NNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIW 417
           + T+     P   + +     ++  T   +G    + S+D + D   LATAS + S+ +W
Sbjct: 353 SPTLRIIPTP---QASEDKEVMEIETEMYEGHTDLLNSLDATSDGLWLATASKDHSVILW 409

Query: 418 NVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIW 477
             + ++   +FE       KFL                                H   + 
Sbjct: 410 --RYNEASSSFEP----FTKFL-------------------------------GHAGPVT 432

Query: 478 SLDLTSDGKR-----LVTGSADKTVKFWDFQVENTLVPGTKDK----LLPMLKLNHDTTL 528
           ++ L +   R     L+T S D T+K W        VP   D+    L  ++K +  T  
Sbjct: 433 AIALPNVMNRNWPEFLLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASEYTRR 485

Query: 529 ELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
               DI ++ +SP+D   A +  D T K++ +D+ +   +L  HK  +  +       ++
Sbjct: 486 AHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLL 545

Query: 589 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFE 648
            T S D++I +W L+     K+L  H +++  V F+  +    S   D +VK WD    E
Sbjct: 546 ATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGE 605

Query: 649 CIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDT 708
           C++ L AH + +WALA+A++G  ++++  D   + WE+  ++             + E +
Sbjct: 606 CVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQS 665

Query: 709 LLASLEEGNADDAF 722
           L   + EG+ ++AF
Sbjct: 666 LQNYISEGDWNNAF 679

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 81/213 (38%), Gaps = 68/213 (31%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           IW++ TG++ ATL       A+  RG    A C Y        LLA    D  I +W L 
Sbjct: 514 IWNVDTGEVEATL-------ANHKRGLWGVAFCEY------DWLLATCSGDRSINLWSLE 560

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           S TVL    GH  A+  + F +   +L+S   D  + +W               DC TG 
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIW---------------DCSTG- 604

Query: 170 WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVK 227
                                    +C+ T  AH    W+L+V +D  L+IT   D   +
Sbjct: 605 -------------------------ECVRTLDAHNNRIWALAVANDGQLIITADADGVFQ 639

Query: 228 IWKLNMENDKMGEKLTEVGVFEKQSKQRGLKVE 260
            W+ N E +            E+  +Q  L+VE
Sbjct: 640 FWEDNSEEEH-----------ERNIEQEKLRVE 661

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 5/146 (3%)

Query: 524 HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
           H    E   D+ ++R++PD RYL  +  +  ++ + L++ +   S+     P   +D   
Sbjct: 53  HKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDCDE 111

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVV 639
            S ++     D ++ ++ +  G    SL  H  +I SVKF  E  +      S   + +V
Sbjct: 112 SSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMV 171

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAI 665
           K WD  K  CI  +  H + V  L I
Sbjct: 172 KIWDLVKRRCIHTVQEHTAAVRGLDI 197

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 69/160 (43%), Gaps = 21/160 (13%)

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
           +++  +E+  +  + +L LT DG+ L   S ++ ++F+D + + T           +L  
Sbjct: 50  AIIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDC 109

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDI- 581
           +  +TL                 LA+   D +V VF + +     SL GH   + S+   
Sbjct: 110 DESSTL-----------------LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFY 152

Query: 582 -SFDSKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSI 618
              DS M + +S D N  +KIW L    C  ++  H  ++
Sbjct: 153 GEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAV 192

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 13/99 (13%)

Query: 48  NVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECT-YLEVHEDTDLLAVGYADGVIKVW 106
           +VN++DI  G +  +L            G+  +    Y EV     LLA G  +G++K+W
Sbjct: 124 SVNVFDIANGYVTHSLK---------GHGATISSVKFYGEVDSGMWLLASGDTNGMVKIW 174

Query: 107 DLMSKTVLLNFNGHKAAITLLQF---DSTGTRLISGSRD 142
           DL+ +  +     H AA+  L     +   + L+SG RD
Sbjct: 175 DLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRD 213

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 148/632 (23%), Positives = 258/632 (40%), Gaps = 117/632 (18%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DSTGTR 135
           + C  ++    + L+A+G  DG I V D+ +  +  +  GH A I+ L+F    +S    
Sbjct: 107 SPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWL 166

Query: 136 LISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQ--GEDW-LISTSKDGMIKLWDLK 192
           L SG  +  + VWDLV    L+ ++ H + + G+  +  G++W LIS  +D +  LW+  
Sbjct: 167 LCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFN 226

Query: 193 -TQQC-----IETHIAHTGECWSLSVK-DDLLITTGTDSQVKIWKLNM-----ENDKMGE 240
             ++C     I  H      C  ++ + DDL+ T G D+ ++   L       +  K  E
Sbjct: 227 LKKKCTLLKTIPVH-QQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIE 285

Query: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXX 300
           +L  +GV       +                 Y+  +D+T+E   I+             
Sbjct: 286 ELFIIGVLPILENDK----------------MYLVMSDQTLELVDIKSN----------- 318

Query: 301 XXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360
                      EI   I G+  ++    F                V  +  +L L T++ 
Sbjct: 319 --LLNESSDIIEIESCIAGNNGTIADMKF----------------VGPNHDKLALATNSP 360

Query: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKI-WNV 419
           T+    +P  ++E     P+     E  G    + S+D +DD   +ATAS     I W  
Sbjct: 361 TLRIIPVPSSEQEE---LPINVEMYE--GHEDLLNSLDTTDDGLWMATASKDHTAIVW-- 413

Query: 420 KTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSL 479
           K +  I  F+  Y    KF+                                H A + ++
Sbjct: 414 KYNSIINKFQ-PYV---KFI-------------------------------GHSATVTAV 438

Query: 480 DLTSDGKR-----LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDI 534
            L +   R     L+T S D T+K W     +T V    ++   ++K++  T      DI
Sbjct: 439 GLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTV----EEDCQIVKVSEYTRRAHEKDI 494

Query: 535 LSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSAD 594
            ++ ISP+D   A +  D T K++ L++ +   +L  HK  +  +      K+I T S D
Sbjct: 495 NALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGD 554

Query: 595 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLY 654
           K IKIW LD     K+L  H +++    F+ +     S   D ++K WD    +C++ L 
Sbjct: 555 KTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLD 614

Query: 655 AHQSEVWALAIASNGSFVVSSSHDHSIRIWEE 686
            H + +WAL   ++G  +VS+  D   + W++
Sbjct: 615 GHDNRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 71/159 (44%), Gaps = 3/159 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L +  +  + A    D   K+WDL +  +    + HK  +  + F     
Sbjct: 487 RRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDK 546

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCIT-GIWCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  I +W L     +  L  H + +   ++   +  L+S+  DG+IK+WD  T
Sbjct: 547 LIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCST 606

Query: 194 QQCIETHIAHTGECWSLS-VKD-DLLITTGTDSQVKIWK 230
             C++T   H    W+L+ + D D++++   D   + WK
Sbjct: 607 GDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWK 645

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 62/144 (43%), Gaps = 21/144 (14%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           IWD++ G+L ATLS+         RG    A C Y        L+A    D  IK+W L 
Sbjct: 517 IWDLENGELTATLSN-------HKRGLWDVAFCQY------DKLIATCSGDKTIKIWSLD 563

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           + +V+    GH  A+    F +   +L+S   D  I +WD      L  L  H +    I
Sbjct: 564 TFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDN---RI 620

Query: 170 WCQGE----DWLISTSKDGMIKLW 189
           W   E    D ++S   DG+ + W
Sbjct: 621 WALTEINDGDMIVSADADGVFQFW 644

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 77/167 (46%), Gaps = 13/167 (7%)

Query: 531 NDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMK----FYLSLYGHKLPVLSIDISF 583
           NDD   I +++++PD +YL+    +  +K+F LD  K      +       P   +D   
Sbjct: 57  NDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDS 116

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN--FFSCSKD--AVV 639
            S ++     D +I +  ++ G    SL  H  +I ++KF  ++++  +  CS D   +V
Sbjct: 117 TSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMV 176

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAIASNGS--FVVSSSHDHSIRIW 684
           K WD  K +C+  +  H + V  L +   G    ++S   D+   +W
Sbjct: 177 KVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  127 bits (318), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 154/637 (24%), Positives = 266/637 (41%), Gaps = 108/637 (16%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-------DSTGTRLI 137
           + + + + LLAVG  DG + V D+ +  +  +F GH A I+ ++F       ++ G  L 
Sbjct: 108 MSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLF 167

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-------WCQGED---WLISTSKDGMIK 187
           SG     I V D+V    LY  + H   I G+         + ++    L+S  +D ++ 
Sbjct: 168 SGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVN 227

Query: 188 LWDL---KTQQCIETHIAH--TGECWSLSVK-DDLLITTGTDSQVKIW-----KLNMEND 236
           LW+    +  + I+T   +     C  L+   +DL+ T G+D+  +I      K+  +  
Sbjct: 228 LWEFNLRRKSKLIKTIPVYQQVEACGFLNGNYEDLIYTGGSDAIFQILSISSNKILKKTL 287

Query: 237 KMGEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXX 296
           K  E+L  +GV       +                FY+  +D+T+    +  EE +A   
Sbjct: 288 KPIEELFIIGVLPILDNSK----------------FYLVLSDQTL--LLVDVEENMAEDE 329

Query: 297 XXXXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLT 356
                       T  +I  SI G++ ++                A    V  +  +L L 
Sbjct: 330 NPSEYVDH----TIIKIENSIAGNHGTI----------------ADMRVVDPTLSKLALA 369

Query: 357 TSNNTIEYYSIPYEKREATSPAPLKTHTIEL---QGQRTDVRSIDISDDNKLLATAS-NG 412
           T++ T+    I     EA S   L    I++   +G    + S+D ++D+  +ATAS + 
Sbjct: 370 TNSPTLRIIPISEANEEADSKDALSRIPIDVDMYEGHTDLLNSLDSTEDSLWIATASKDN 429

Query: 413 SLKIW--NVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVED 470
           S  +W  N    K        Y +  KFL     V   T  G   L ++ + +  D V  
Sbjct: 430 SCILWRYNAVLEK--------YQIYAKFLGHASSV---TAVG---LPNVLTKNYPDYV-- 473

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPM-LKLNHDTTLE 529
                             +T S D T+K W    + T      D   P  +KL+  T   
Sbjct: 474 ------------------ITASNDSTIKKWKVP-KPTKNLDNNDSFKPHEVKLSEYTRRA 514

Query: 530 LNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMII 589
            + DI ++ ISP+D   A +  D T K++ L+S     +L  HK  +  +      K I+
Sbjct: 515 HDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIV 574

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           T+S DK IK+W LD     K+   H +++   +F+ +     SC  D ++K WD    EC
Sbjct: 575 TASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGEC 634

Query: 650 IQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEE 686
           I+ L  H + +WAL++ ++G  ++S+  D   + W +
Sbjct: 635 IKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRD 671

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 95/224 (42%), Gaps = 19/224 (8%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L +  +  + A    D   K+WDL S  +      HK  +  + F     
Sbjct: 512 RRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDK 571

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQ---GEDWLISTSKDGMIKLWDL 191
            +++ S D  I +W L     +     H + +    CQ    +  L+S   DG+IK+WD 
Sbjct: 572 FIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQR--CQFINKQKQLVSCGADGLIKIWDC 629

Query: 192 KTQQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKIWK----LNMENDKMGEKLTEV 245
            + +CI+T   H+   W+LSV +  D++I+   D   + W+     N E D   E+L   
Sbjct: 630 SSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRDCTGENREKDLEKERLK-- 687

Query: 246 GVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKE 289
            V ++QS Q  L  E  TNA     F      D  +  F + ++
Sbjct: 688 -VEQEQSLQNYLANEDWTNA-----FLLAMTLDHPLRLFNVLRK 725

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 154/701 (21%), Positives = 282/701 (40%), Gaps = 135/701 (19%)

Query: 49  VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDL 108
           + I+D++ G ++ ++    P    D+  +             + LLA+G  DG I V D+
Sbjct: 84  LKIFDLREGKIVRSMKISSPSYVVDSDST-------------STLLAIGGTDGSITVVDV 130

Query: 109 MSKTVLLNFNGHKAAITLLQF--DSTGTRLISGSRDSN--IIVWDLVGEVGLYKLRSHKD 164
            +  V  +  GH   I+ ++F  +  G   +  S D+N  + +WDLV    ++ ++ H  
Sbjct: 131 ENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTA 190

Query: 165 CITGIWC-------QGEDWLISTSKDGMIKLW--DLKTQQCIETHIAHTGECWSLSVKD- 214
            + GI         + E +LIS  +D +I  W  +LK +  +   +  + +  S    + 
Sbjct: 191 AVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKKCTLLKTLPVSQQVESCGFANS 250

Query: 215 DLLITTGTDSQVKIWKLN-----MENDKMGEKLTEVGVFEKQSKQRGLKVEFITNASDGV 269
           +L+ T G+D+ +++  L          K  E+L  VGV                    G 
Sbjct: 251 ELIYTAGSDAFLQLISLESGKAVKRTHKPVEELFTVGVLSIL----------------GG 294

Query: 270 SFFYIQNADKTIETFRIRK--EEEIAXXXXXXXXXXXXXXXTDEEIARSIKGSYSSLVLH 327
           S  Y+  +D+T+    + +  E E A                  E+   I G++ ++   
Sbjct: 295 SKLYMVISDQTLALINLEEALESESALI----------------EVESYIAGNHGTIADM 338

Query: 328 PFQTIRSFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIEL 387
            F                V     +L L T++ T+    +  E        P+     E 
Sbjct: 339 NF----------------VGPELDKLALATNSPTLRIIPVSME-----GGLPIDVELYE- 376

Query: 388 QGQRTDVRSIDISDDNKLLATASNGSLKI-WNVKTHKCIRTFECGYALSCKFLPGGLLVI 446
            G +  + ++D ++D   LATAS  S  I W  +++            S KF+P      
Sbjct: 377 -GHKDLLNAVDATEDGLWLATASKDSTAILWWYQSN------------SNKFVPYAKF-- 421

Query: 447 LGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKR-----LVTGSADKTVKFWD 501
                                  + H +A+ ++ L +   +     ++T S D TVK W 
Sbjct: 422 -----------------------EGHSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKWA 458

Query: 502 FQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLD 561
                  V   +   L ++K++  T      DI ++ ++P+D   A +  D T KV+ L+
Sbjct: 459 VPKP---VASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLE 515

Query: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSV 621
           S +   +L  H+  +  +      ++I T S DK IKIW LD     K+   H +++   
Sbjct: 516 SGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRC 575

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSI 681
            F+ +     S S D +VK WD    EC++ L  H + +WAL +A +G  +VS+  D   
Sbjct: 576 SFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVF 635

Query: 682 RIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           + W+++ +Q             + E +L   L +G+  +AF
Sbjct: 636 QFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQGDWTNAF 676

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 93/219 (42%), Gaps = 9/219 (4%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L V  +    A    D   KVWDL S  V      H+  +  + F     
Sbjct: 481 RRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYER 540

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  I +W L     +     H + +    +   +  L+S+S DG++K+WD  T
Sbjct: 541 LIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCST 600

Query: 194 QQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKIWKLNMENDKMGEKLTE-VGVFEK 250
            +C++T   HT   W+L V +  DL+++   D   + WK + E ++      + + V ++
Sbjct: 601 GECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQE 660

Query: 251 QSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKE 289
           QS Q  L     TNA     F      D  +  FR+ K+
Sbjct: 661 QSLQNYLSQGDWTNA-----FLLAITLDHPLRLFRVLKQ 694

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 14/167 (8%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           + T L++  D   L       ++K++DL    ++ +      +  ++  DST T L  G 
Sbjct: 62  DITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPSY-VVDSDSTSTLLAIGG 120

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGED----WLISTS-KDGMIKLWDLKTQQ 195
            D +I V D+      + L+ H   I+ +   GE     WL+++   +GM+K+WDL  ++
Sbjct: 121 TDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRK 180

Query: 196 CIETHIAHTGECWSLSVKDD--------LLITTGTDSQVKIWKLNME 234
           CI T   HT     +   +          LI+ G D  +  W+ N++
Sbjct: 181 CIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLK 227

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 13/171 (7%)

Query: 527 TLELND--DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
           T+E +D  DI +++++ D RYL  +     +K+F L   K   S+     P   +D    
Sbjct: 54  TIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS-PSYVVDSDST 112

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVK 640
           S ++     D +I +  ++ G    SL  H  +I SVKF  E +       S   + +VK
Sbjct: 113 STLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVK 172

Query: 641 YWDGEKFECIQKLYAHQSEVWALAIASNGS------FVVSSSHDHSIRIWE 685
            WD  K +CI  +  H + V  +    + +      F++S   D  I  W+
Sbjct: 173 IWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQ 223

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 27/188 (14%)

Query: 465 LDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNH 524
           L T+E+  +  I +L LT+DG+ L   S  + +K +D + E  +V   K    P   ++ 
Sbjct: 52  LFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLR-EGKIVRSMKIS-SPSYVVDS 109

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDI--S 582
           D+T  L               LAI   D ++ V  +++     SL GH   + S+     
Sbjct: 110 DSTSTL---------------LAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGE 154

Query: 583 FDSKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN------FFSCS 634
            + ++ + +S D N  +KIW L    C  ++  H  ++  + F    +N        S  
Sbjct: 155 QNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGG 214

Query: 635 KDAVVKYW 642
           +D V+ YW
Sbjct: 215 RDDVINYW 222

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 164/722 (22%), Positives = 289/722 (40%), Gaps = 149/722 (20%)

Query: 39  GQLIT--SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTY-LEVHEDTDLLA 95
           GQ +T  S  + + I+ +KTG ++              R  K +  +Y L+    + LLA
Sbjct: 73  GQYLTYVSQAQLLKIFQLKTGKVV--------------RSMKISSPSYILDTDSTSTLLA 118

Query: 96  VGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DSTGTRLISGSRDSNIIVWDLV 151
           VG  DG I V D+ +  +  +  GH   I+ L+F    DS    L SG  +  + VWDLV
Sbjct: 119 VGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLV 178

Query: 152 GEVGLYKLRSHKDCITGI---WCQGEDW-----LISTSKDGMIKLWDL---KTQQCIETH 200
               L+ L+ H   + G+     +  D      LIS  +D ++  WD    K  + I+T 
Sbjct: 179 KRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKCKLIKTL 238

Query: 201 IAH--TGECWSLSVKDD--LLITTGTDSQVKIWKLN-----MENDKMGEKLTEVGVFEKQ 251
             +     C  L+ +D   ++ T G D+  ++  L         +K  E+L  +GV    
Sbjct: 239 PVNQQVESCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNKPIEELYIIGVLPIM 298

Query: 252 SKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIAXXXXXXXXXXXXXXXTDE 311
           S  +                 ++  +D+T++   I +  E                 + E
Sbjct: 299 SDSK----------------MFLVMSDQTLQLINIEEALE-----------------SKE 325

Query: 312 EIAR---SIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIP 368
           EI +   SI G++  +    F                V     +L L T++  +    IP
Sbjct: 326 EIIQAESSIAGNHGIIADMRF----------------VGPELNKLALATNSPALRIIPIP 369

Query: 369 YEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIW--NVKTHKCI 425
            +     S  PL     E  G    + S+D ++D   +ATAS + S  +W  N  T K  
Sbjct: 370 -DLTSTESSLPLDVEIYE--GHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDTSK-- 424

Query: 426 RTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDG 485
                                          FD+ +  +       H +A+ ++ L +  
Sbjct: 425 -------------------------------FDIYAKYI------GHSSAVTAVGLPNVM 447

Query: 486 KR-----LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
            +     L+T S D T+K W      +    T D  + ++K++  T      DI ++ +S
Sbjct: 448 PKGYPEFLLTASNDLTIKKWKIPKPTS----TND--VQIIKVSEYTRHAHEKDINALSVS 501

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D   A +  D T K++ L++ +   +L  HK  +  +      K++ T S DK +KIW
Sbjct: 502 PNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIW 561

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
            L+     K+L  H +++    F+ +     SC  D ++K WD    EC++ L  H + +
Sbjct: 562 SLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRL 621

Query: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADD 720
           WAL   ++G  +VS+  D   + W++  +Q             + E +L   + +G+  +
Sbjct: 622 WALNTMNDGDTIVSADADGIFQFWKDCTEQEKEEELEKTKIQVEQEQSLQNYMSQGDWTN 681

Query: 721 AF 722
           AF
Sbjct: 682 AF 683

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 89/216 (41%), Gaps = 23/216 (10%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E T L++  D   L       ++K++ L +  V+ +      +  +L  DST T L  G 
Sbjct: 63  EITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISSPSY-ILDTDSTSTLLAVGG 121

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE----DWLISTS-KDGMIKLWDLKTQQ 195
            D +IIV D+      + L+ H   I+ +   G+     WL+++   +GM+K+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CIETHIAHTGECWSLSVKDD---------LLITTGTDSQVKIWKLNMENDKMGEKLTEVG 246
           C+ T   HT     L + +           LI+ G D  V  W  +M   K   KL +  
Sbjct: 182 CLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDM---KKKCKLIKTL 238

Query: 247 VFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIE 282
              +Q +  G       N  DG    Y    D   +
Sbjct: 239 PVNQQVESCGF-----LNTRDGKHIIYTAGGDAIFQ 269

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 5/149 (3%)

Query: 521 KLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580
           K+ H  + E   +I +++++PD +YL        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILD 109

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKD 636
               S ++     D +I +  ++ G    SL  H  +I S+KF  +  +      S   +
Sbjct: 110 TDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTN 169

Query: 637 AVVKYWDGEKFECIQKLYAHQSEVWALAI 665
            +VK WD  K +C+  L  H S V  L I
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 154/675 (22%), Positives = 280/675 (41%), Gaps = 113/675 (16%)

Query: 75  RGSKPAECTYLEVHEDTD-LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-DST 132
           R  K +  +Y+   + T  L+A+G  DG I V D+ +  +  +F GH   I+ L+F    
Sbjct: 98  RSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGEL 157

Query: 133 GTRL-ISGSRDSNII--VWDLVGEVGLYKLRSHKDCITGI-WCQGEDW----LISTSKDG 184
           GT + + GS D+N +  VWDLV     + ++ H   I GI + + +D     LI+  +D 
Sbjct: 158 GTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDN 217

Query: 185 MIKLWDL----KTQQCIETHIAH--TGECWSLSVKDDLLI-TTGTDSQVKIWKLNMENDK 237
           ++ LW      K+ + ++T  AH     C  ++  D+    T G D+  +I  LN     
Sbjct: 218 VLNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLN----- 272

Query: 238 MGEKLTEVGVFEKQSKQRGLKVEFITNA---SDGVSFFYIQNADKTIETFRIRKEEEIAX 294
                 E  V   +  ++ ++  FIT     + G  F+ +  +D+TI+   ++   EI  
Sbjct: 273 ------ESSVV--KCTKKPIEELFITGVIPINQGNQFYAVL-SDQTIQL--LQPNSEIFS 321

Query: 295 XXXXXXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELV 354
                            +I   I G++ ++                A    VT +K  + 
Sbjct: 322 SKSEFI-----------QIQEYIAGNHGTV----------------ADLCLVTKNKDCIA 354

Query: 355 LTTSNNTIEYYSIPYEKREA-TSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGS 413
           L T++ ++    IP  K +A T    L       +G    + S+  ++D + LATAS   
Sbjct: 355 LATNSPSLRI--IPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACTEDGQWLATASKDK 412

Query: 414 LKI---WNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVED 470
             I   WN  + +                      I  T  G      +++  L + +E 
Sbjct: 413 TAILWHWNNTSKR--------------------FYIYATFVGHAA--SVSAVCLPNVMEK 450

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKL--LPMLKLNHDTTL 528
            +             K ++T S D TVK W+       +P  K+ L  +P +  +   T 
Sbjct: 451 NYP------------KYIITASNDLTVKKWE-------IPPMKNDLNEVPFIVKSSIYTR 491

Query: 529 ELND-DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
             ++ DI ++ ++P+D   A +  D T K++ +D+ +   +L  HK  +  +      K 
Sbjct: 492 HAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKW 551

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKF 647
           I T S DK +KIW L+     K+L  H +++    F+ +     S   D ++K WD    
Sbjct: 552 IATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASG 611

Query: 648 ECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYED 707
           +CI+ L  H + +WAL++  +G  ++S+  D   + W++  +              + E 
Sbjct: 612 DCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQ 671

Query: 708 TLLASLEEGNADDAF 722
           +L   +  G   +AF
Sbjct: 672 SLTNYMNNGEWSNAF 686

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 102/251 (40%), Gaps = 33/251 (13%)

Query: 6   QRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALE-NVNIWDIKTGDLLATLS 64
           +RF   A F   A++ + V LP     N    P  +IT++ +  V  W+I          
Sbjct: 424 KRFYIYATFVGHAASVSAVCLPNVMEKNY---PKYIITASNDLTVKKWEI---------- 470

Query: 65  DGLPPGASD-------------ARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSK 111
              PP  +D              R +   +   + +  +  + A    D   K+W++ + 
Sbjct: 471 ---PPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTG 527

Query: 112 TVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-W 170
             +     HK  +  + F  +   + + S D  + +W L     L  L  H + +    +
Sbjct: 528 EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSF 587

Query: 171 CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKI 228
              +  L+S   DG+IK+WD+ +  CI+    H+   W+LSV +  DL+I+   DS  + 
Sbjct: 588 MNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQF 647

Query: 229 WKLNMENDKMG 239
           WK   E +  G
Sbjct: 648 WKDCTEAEIQG 658

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 70/179 (39%), Gaps = 9/179 (5%)

Query: 515 KLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           +L+P  KL H        +I  + ++PD +YL        VK+  +++     SL     
Sbjct: 46  QLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSS- 104

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE-SHNFF-- 631
           P   +     S ++     D +I +  ++ G    S   H  +I S+KF  E   N +  
Sbjct: 105 PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLL 164

Query: 632 -SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS----FVVSSSHDHSIRIWE 685
            S   + + K WD    +C   +  H S +  +    N       +++   D+ + +W 
Sbjct: 165 GSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWR 223

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 140/611 (22%), Positives = 254/611 (41%), Gaps = 96/611 (15%)

Query: 126 LLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGED----WLI-ST 180
           ++  DST T +  G  D +IIV D+      +  + H   I+ +   G +    WL+ S 
Sbjct: 123 IMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSG 182

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK------DDL---LITTGTDSQVKIWKL 231
             +GM+K+WDL  + CI T   H      L V+      D++   L++   D+ V +W+ 
Sbjct: 183 DTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEF 242

Query: 232 NMENDKMGEKLTEVGVFEKQSKQRGL------KVEFITNASDGVSFFYIQNADK-TIETF 284
           N+   K+ + L  + V  +Q +  G       +++ I   + G + F + +  K ++   
Sbjct: 243 NLR--KLCKLLKTLPV-NQQVESCGFIHDHDNELQDIIYTAGGEAIFQLISLSKGSVIKR 299

Query: 285 RIRKEEEIAXXXXXXXXXXXXXXXTDEEIARSIKGSYSSL-------VLHPFQTIRSFYK 337
            ++  EE+                T+ ++   I  S  +L        L P +      +
Sbjct: 300 TVKPTEEL------FIIGTLPFTATNNDLNSYIVMSDQTLQMINLTKALSPTELSNPIIE 353

Query: 338 VKS---ASWTTVTSSKL------ELVLTTSNNTIEYYSIPYEKREATSP------APLKT 382
           ++S    +  T+   K       +L L T++ T+    +P   +EA  P      A L  
Sbjct: 354 IESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPI 413

Query: 383 HTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGG 442
           +    +G    + S+  ++D + LATAS     I    + +  R F   YA   KF+   
Sbjct: 414 NMETYEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFF--AYA---KFI--- 465

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKR-----LVTGSADKTV 497
                                        H +++ ++ L +   R     L+T S D T+
Sbjct: 466 ----------------------------GHSSSVTAVGLPNVLLRGYPEFLITASNDLTI 497

Query: 498 KFWDFQVENTLVPG--TKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTV 555
           K W     +       +KDK   ++K++  T    + DI S+ ISP+D  +A    D + 
Sbjct: 498 KKWKIPTPSKERSDDESKDKT-HIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSC 556

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
           K++ LDS +   +L  HK  +  +      K+I T S DK IK+W LD     K+   H 
Sbjct: 557 KLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHT 616

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSS 675
           +++    F+ +     S   D ++K WD    +C++ L  H + +WAL   ++G  +VS+
Sbjct: 617 NAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSA 676

Query: 676 SHDHSIRIWEE 686
             D  ++ W +
Sbjct: 677 DADGVLQFWND 687

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 55/118 (46%)

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
           + H   + SI IS +  +I T S DK+ K+W LD G+   +L  H+  I  V F      
Sbjct: 529 HAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKL 588

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEET 687
             +CS D  +K W  + F  ++    H + V      +    +VSS  D  I+IW+ T
Sbjct: 589 IATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCT 646

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 3/158 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   + +  +  L+A G  D   K+W+L S  ++   N HK  I  + F     
Sbjct: 528 RHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDK 587

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCIT-GIWCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  I +W L     L     H + +    +   +  L+S+  DG+IK+WD  T
Sbjct: 588 LIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTT 647

Query: 194 QQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIW 229
             C++T   H    W+L+  +D  L+++   D  ++ W
Sbjct: 648 GDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFW 685

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 69/154 (44%), Gaps = 21/154 (13%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           +W++ +G+L+ATL++         RG    + C +        L+A    D  IK+W L 
Sbjct: 558 LWNLDSGELVATLNN-------HKRGIWDVSFCQF------DKLIATCSGDKTIKLWSLD 604

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           +  VL  F GH  A+    F +   +L+S   D  I +WD      L  L  H + I  +
Sbjct: 605 TFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWAL 664

Query: 170 --WCQGEDWLISTSKDGMIKLWDLKTQQCIETHI 201
             W  GE  ++S   DG+++ W+     C E  I
Sbjct: 665 TTWNDGE-LIVSADADGVLQFWN----DCTELEI 693

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 86/186 (46%), Gaps = 26/186 (13%)

Query: 526 TTLELNDD--ILSVRISPDDRYL-AISLLDNTVKVFFLDSMKFYLSLYGHKL-------- 574
           TT+  ND+  I  ++++PD ++L +I+L    +K++ L +++   ++   +         
Sbjct: 56  TTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTL 115

Query: 575 ----PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP--ESH 628
               P   +D    S ++     D +I +  ++ G    S   H  +I SVKF    +++
Sbjct: 116 KLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTN 175

Query: 629 NFFSCSKD--AVVKYWDGEKFECIQKLYAHQSEVWALAIAS----NGSFV---VSSSHDH 679
            +  CS D   +VK WD  K  CI  L  H S V  L + S    N + V   +S S D+
Sbjct: 176 CWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDN 235

Query: 680 SIRIWE 685
            + +WE
Sbjct: 236 IVNLWE 241

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-------DSTGTRLISGSRDSNI 145
           LL  G  +G++K+WDL+ ++ +     H +A+  L         D+   +L+SGSRD+ +
Sbjct: 178 LLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIV 237

Query: 146 IVWDL 150
            +W+ 
Sbjct: 238 NLWEF 242

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 58/145 (40%), Gaps = 29/145 (20%)

Query: 117 FNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLY----KLRSHKDCITGIWCQ 172
           + GH   +  L     G  L + S+D   I+W    E   +    K   H   +T +   
Sbjct: 418 YEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGLP 477

Query: 173 G------EDWLISTSKDGMIKLWDLKT--------QQCIETHI---------AHTGECWS 209
                   ++LI+ S D  IK W + T        +   +THI         AH  +  S
Sbjct: 478 NVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINS 537

Query: 210 LSVK-DDLLITTGT-DSQVKIWKLN 232
           +S+  +D LI TG+ D   K+W L+
Sbjct: 538 ISISPNDSLIATGSYDKSCKLWNLD 562

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 117/235 (49%), Gaps = 3/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           L++ S D TVK W  +V       T+D++ P++K +  T      DI ++ ISP+D   A
Sbjct: 447 LLSSSTDMTVKKW--KVPKPTQNPTEDEI-PVVKTSEYTRRAHEKDINALSISPNDSIFA 503

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L + +   +L  HK  +  +      K+I T S DK IKIW L+  + 
Sbjct: 504 TASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNI 563

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
             +L  H +++  + F+ ++    SC  D +VK WD    EC++ L AH + +WAL +A 
Sbjct: 564 KATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVAD 623

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G   V++  D   + W++  ++             + E +L   L +G+  +AF
Sbjct: 624 DGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQSLQNYLSKGDWVNAF 678

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 3/165 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L +  +  + A    D   K+WDL++  ++     HK  +  + F     
Sbjct: 483 RRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDK 542

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  I +W L        L  H + +  I +      L+S   DG++K+WD  T
Sbjct: 543 LIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCST 602

Query: 194 QQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKIWKLNMEND 236
            +C+ T  AH    W+L V D  D  +T   D   + WK N E +
Sbjct: 603 GECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 77/174 (44%), Gaps = 11/174 (6%)

Query: 520 LKLNHDTTLELNDD----ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLP 575
           LK  H+   ++N+D    I +++++PD  YL     +  ++++ L S K   S+     P
Sbjct: 45  LKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVSS-P 103

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFFSC 633
           V  +D    S +++    D ++ I+ ++ G    S   H   I SVKF  E    N+   
Sbjct: 104 VYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLA 163

Query: 634 SKD--AVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS--FVVSSSHDHSIRI 683
           S D   VVK WD  K  C+  +  H + V  L      S   ++S   D  I +
Sbjct: 164 SGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 78/157 (49%), Gaps = 10/157 (6%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E T L++  D   L     + +++++ L SK ++ +     + + ++  D T T L+ G 
Sbjct: 62  EITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKV-SSPVYVMDCDETSTLLVIGG 120

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE----DWLISTS-KDGMIKLWDLKTQQ 195
            D ++ ++D+      +  + H   I+ +   GE    +WL+++   +G++K+WDL  ++
Sbjct: 121 TDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRR 180

Query: 196 CIETHIAHTGECWSL--SVKDD--LLITTGTDSQVKI 228
           C+ T   HT     L   VKD   LLI+ G D  + +
Sbjct: 181 CMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 58/102 (56%), Gaps = 6/102 (5%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFECGYALSCK---FLPGGLLVILGTRTGELQLFD 458
           +KL+AT S + ++KIW+++ +    T E G+  + +   F+     ++     G ++++D
Sbjct: 541 DKLIATCSGDKTIKIWSLENYNIKATLE-GHTNAVQRISFINKNKQLVSCGADGLVKIWD 599

Query: 459 LASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            ++   L T+ DAHD  IW+L++  DG R VT  AD   +FW
Sbjct: 600 CSTGECLRTL-DAHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 82/188 (43%), Gaps = 25/188 (13%)

Query: 119 GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIW----CQGE 174
            H+  I  L      +   + S D    +WDLV    +  L +HK    G+W    CQ +
Sbjct: 485 AHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHK---RGLWDVSFCQHD 541

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIWKLN 232
             + + S D  IK+W L+      T   HT     +S   K+  L++ G D  VKIW  +
Sbjct: 542 KLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCS 601

Query: 233 MENDKMGEKLTEVGVFEKQSKQRGLKV-----EFITNASDGVSFFYIQNA----DKTIET 283
                 GE L  +   +  ++   L+V      F+T  +DG+  F+  N+    ++ +E 
Sbjct: 602 -----TGECLRTLDAHD--NRIWALEVADDGDRFVTADADGLFQFWKDNSEEEHEQDLEK 654

Query: 284 FRIRKEEE 291
            R++ E+E
Sbjct: 655 KRLKVEQE 662

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 27/143 (18%)

Query: 568 SLYGHKLPVL-SIDISFDSKMIITSSADKNIKIWGL--DFGDC--HKSLFAHQDSIMSVK 622
           ++YG  + +L ++D S D   I T+S D  + +W      GD   +     H  S+ +V 
Sbjct: 375 NMYGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVA 434

Query: 623 F--LPESH--NF-FSCSKDAVVKYWDGEK---------------FECIQKLYAHQSEVWA 662
              + + H  NF  S S D  VK W   K                E  ++  AH+ ++ A
Sbjct: 435 LPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRR--AHEKDINA 492

Query: 663 LAIASNGSFVVSSSHDHSIRIWE 685
           L+I+ N S   ++S+D + +IW+
Sbjct: 493 LSISPNDSIFATASYDKTCKIWD 515

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 55/140 (39%), Gaps = 25/140 (17%)

Query: 117 FNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLY----KLRSHKDCITGIWCQ 172
           + GH   +  L     G  + + S+D  +++W    ++G +    K   H   +T +   
Sbjct: 377 YGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALP 436

Query: 173 G------EDWLISTSKDGMIKLWDL--KTQQCIETHI-----------AHTGECWSLSV- 212
                   ++L+S+S D  +K W +   TQ   E  I           AH  +  +LS+ 
Sbjct: 437 NIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSIS 496

Query: 213 -KDDLLITTGTDSQVKIWKL 231
             D +  T   D   KIW L
Sbjct: 497 PNDSIFATASYDKTCKIWDL 516

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/379 (23%), Positives = 169/379 (44%), Gaps = 56/379 (14%)

Query: 352 ELVLTTSNNTIEYYSIP-YEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS 410
           +L L T++ ++    +P     EA+ P  ++ +    +G    + S+D ++D   +ATAS
Sbjct: 352 KLALATNSPSLRIIPVPDLSGPEASLPLDVEIY----EGHEDLLNSLDATEDGLWIATAS 407

Query: 411 NGSLKI-WNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVE 469
             +  I W    +            SCKF                   D+ +  +     
Sbjct: 408 KDNTAIVWRYNEN------------SCKF-------------------DIYAKYI----- 431

Query: 470 DAHDAAIWSL---DLTSDG--KRLVTGSADKTVKFWDFQVENTLVPGTKDKL-LPMLKLN 523
             H AA+ ++   ++ S G  + L+T S D T+K W       ++P     + + ++K++
Sbjct: 432 -GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIPKPTASMDVQIIKVS 483

Query: 524 HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
             T      DI ++ +SP+D   A +  D T K++ L++ +   +L  HK  +  +    
Sbjct: 484 EYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQ 543

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWD 643
             K++ TSS DK +KIW LD     K+L  H +++    F+ +     SC  D ++K WD
Sbjct: 544 YDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWD 603

Query: 644 GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXX 703
               EC++ L  H + +WAL+  ++G  +VS+  D   + W++  +Q             
Sbjct: 604 CSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAKLQV 663

Query: 704 QYEDTLLASLEEGNADDAF 722
           + E +L   + +G+  +AF
Sbjct: 664 EQEQSLQNYMSKGDWTNAF 682

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 3/159 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L V  +  + A    D   K+W+L +  +      HK  +  + F     
Sbjct: 487 RHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDK 546

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + +W L     +  L  H + +    +   +  LIS   DG+IK+WD  +
Sbjct: 547 LLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSS 606

Query: 194 QQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKIWK 230
            +C++T   H    W+LS  +  D++++   D   + WK
Sbjct: 607 GECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK 645

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 91/208 (43%), Gaps = 27/208 (12%)

Query: 41  LITSALENVNIWDIKTGD--LLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGY 98
           L T  L+ +NI D+  G   +L  +S+               E T L++  D   L    
Sbjct: 32  LATPVLDEINIIDLTPGSRKILHKISN-----------EDEQEITALKLTPDGQYLTYVS 80

Query: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYK 158
              ++K++ L +  V+ +      +  +L  DST T L  G  D +IIV D+      + 
Sbjct: 81  QAQLLKIFHLKTGKVVRSMKISSPSY-ILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 159 LRSHKDCITGIWCQGE----DWLISTS-KDGMIKLWDLKTQQCIETHIAHTGECWSL--- 210
            + H   I+ +   G+     WL+++   +GM+K+WDL  ++C+ T   HT     L   
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDII 199

Query: 211 SVKDD-----LLITTGTDSQVKIWKLNM 233
            V D+      L++ G D  + +W  NM
Sbjct: 200 EVPDNDEPSLNLLSGGRDDIINLWDFNM 227

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 75/166 (45%), Gaps = 26/166 (15%)

Query: 39  GQLIT--SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           GQ +T  S  + + I+ +KTG ++ ++    P    DA  +             + LLAV
Sbjct: 73  GQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADST-------------STLLAV 119

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DSTGTRLISGSRDSNIIVWDLVG 152
           G  DG I V D+ +  +  +F GH   I+ L+F    +S    L SG  +  + VWDLV 
Sbjct: 120 GGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVK 179

Query: 153 EVGLYKLRSHKDCITG---IWCQGEDW----LISTSKDGMIKLWDL 191
              L+ L+ H   + G   I     D     L+S  +D +I LWD 
Sbjct: 180 RKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDF 225

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 62/141 (43%), Gaps = 15/141 (10%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           IW+++ G+L ATL       A+  RG    + C Y        LLA    D  +K+W L 
Sbjct: 517 IWNLENGELEATL-------ANHKRGLWDVSFCQY------DKLLATSSGDKTVKIWSLD 563

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           + +V+    GH  A+    F +   +LIS   D  I +WD      L  L  H + +  +
Sbjct: 564 TFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWAL 623

Query: 170 WCQGE-DWLISTSKDGMIKLW 189
               + D ++S   DG+ + W
Sbjct: 624 STMNDGDMIVSADADGVFQFW 644

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 508 LVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L PG++       K+ H  + E   +I +++++PD +YL        +K+F L + K   
Sbjct: 45  LTPGSR-------KILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVR 97

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           S+     P   +D    S ++     D +I +  ++ G    S   H  +I S+KF  + 
Sbjct: 98  SMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQL 156

Query: 628 HN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
           ++      S   + +VK WD  K +C+  L  H S V  L I
Sbjct: 157 NSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 55/336 (16%), Positives = 114/336 (33%), Gaps = 104/336 (30%)

Query: 176 WLISTSKDGMIKLWDLKTQQC----IETHIAHTGECWSLSVKD-------DLLITTGTDS 224
           W+ + SKD    +W      C       +I H+    ++ + +       + L+T   D 
Sbjct: 402 WIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDL 461

Query: 225 QVKIWKLNMENDKMGEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETF 284
            +K W +      M  ++ +V  + + + ++ +      + S   S F   + DKT + +
Sbjct: 462 TIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINA---LSVSPNDSIFATASYDKTCKIW 518

Query: 285 RIRKEEEIAXXXXXXXXXXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWT 344
            +   E  A                             +L  H     R  + V    + 
Sbjct: 519 NLENGELEA-----------------------------TLANHK----RGLWDVSFCQYD 545

Query: 345 TVTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNK 404
            +      L  ++ + T++ +S+       T    L+ HT  +Q      R   I+   +
Sbjct: 546 KL------LATSSGDKTVKIWSLDTFSVMKT----LEGHTNAVQ------RCSFINKQKQ 589

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSL 464
           L++  ++G +KIW+  + +C++T                                     
Sbjct: 590 LISCGADGLIKIWDCSSGECLKTL------------------------------------ 613

Query: 465 LDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
                D H+  +W+L   +DG  +V+  AD   +FW
Sbjct: 614 -----DGHNNRLWALSTMNDGDMIVSADADGVFQFW 644

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 112/235 (47%), Gaps = 6/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           L+T S D T+K W      +++       + ++K++  T      DI ++ +SP+D   A
Sbjct: 454 LLTASNDLTIKKWKVPKPTSIMD------VQIIKVSEYTRHAHEKDINALSVSPNDSIFA 507

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K++ TSS DK +KIW LD    
Sbjct: 508 TASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSV 567

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
            K+L  H +++    F+ +     SC  D ++K WD    EC+  L  H + +WAL   +
Sbjct: 568 MKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMN 627

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G  +VS+  D   + W++  +Q             + E +L   + +G+  +AF
Sbjct: 628 DGDMIVSADADGVFQFWKDCSEQEKEEELEKAKVQVEQEQSLQNYISQGDWTNAF 682

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 126/315 (40%), Gaps = 46/315 (14%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASN 411
           +L L T++ ++    IP +   A +  PL     E  G    + S+D ++D   +ATAS 
Sbjct: 352 KLALATNSPSLRIIPIP-DLSGADASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 412 GSLKI---WNVKTHKC-IRTFECGYALSC------KFLPGGLLVILGTRTGEL------- 454
            +  I   +N +T K  I     G++ +         +P G    L T + +L       
Sbjct: 409 DNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKV 468

Query: 455 ----QLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVENT 507
                + D+    + +    AH+  I +L ++ +     T S DKT K W     ++E T
Sbjct: 469 PKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEAT 528

Query: 508 LVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L              NH   L        V     D+ LA S  D TVK++ LD+     
Sbjct: 529 LA-------------NHKRGL------WDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMK 569

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           +L GH   V         K +++  AD  IKIW    G+C  +L  H + + ++  + + 
Sbjct: 570 TLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDG 629

Query: 628 HNFFSCSKDAVVKYW 642
               S   D V ++W
Sbjct: 630 DMIVSADADGVFQFW 644

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 3/159 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L V  +  + A    D   K+W L +  +      HK  +  + F     
Sbjct: 487 RHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDK 546

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + +W L     +  L  H + +    +   +  L+S   DG+IK+WD  +
Sbjct: 547 LLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSS 606

Query: 194 QQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKIWK 230
            +C+ T   H    W+L+  +  D++++   D   + WK
Sbjct: 607 GECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWK 645

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 514 DKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK 573
           D  L   K+ H  + E   +I ++R++PD +YLA       +K+F L + +   SL    
Sbjct: 44  DLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS 103

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFF 631
            P   +D    S ++     D +I I  ++ G    SL  H  +I S+KF  +  S  + 
Sbjct: 104 -PSYILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWL 162

Query: 632 SCSKD--AVVKYWDGEKFECIQKLYAHQSEVWALAI----ASNGSF--VVSSSHDHSIRI 683
             S D   +VK WD  K +C+  L  H S V  L I    + +GS   ++S   D  + +
Sbjct: 163 LASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNV 222

Query: 684 WE 685
           W+
Sbjct: 223 WD 224

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 106/257 (41%), Gaps = 35/257 (13%)

Query: 41  LITSALENVNIWDIKTG--DLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGY 98
           L T  L+ +NI D+  G   +L  +S+               E T L +  D   LA   
Sbjct: 32  LATPILDEINIIDLTLGCRKILHKISN-----------EDEQEITALRLTPDGQYLAYVS 80

Query: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYK 158
              ++K++ L +  ++ +      +  +L  D T T L  G  D +I++ D+      + 
Sbjct: 81  QAQLLKIFQLKTGRIVRSLKISSPSY-ILDTDPTSTLLAVGGTDGSIVIVDIENGYITHS 139

Query: 159 LRSHKDCITGIWCQG----EDWLISTS-KDGMIKLWDLKTQQCIETHIAHTGECWSLSVK 213
           L+ H   I+ +   G    E WL+++   +GM+K+WDL  ++C+ T   H+     L + 
Sbjct: 140 LKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDII 199

Query: 214 DD--------LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQSKQRGLKVEFITNA 265
           +          L++ G D  V +W  +M   K   KL +     +Q +  G    F+ N 
Sbjct: 200 EGESGDGSSLKLLSGGRDDIVNVWDFDM---KKKCKLVKTLPVNQQVESCG----FLKN- 251

Query: 266 SDGVSFFYIQNADKTIE 282
            DG    Y    D   +
Sbjct: 252 HDGKRIIYTAGGDAIFQ 268

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 15/141 (10%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           IW ++ G+L ATL       A+  RG    + C Y        LLA    D  +K+W L 
Sbjct: 517 IWSLENGELEATL-------ANHKRGLWDVSFCQY------DKLLATSSGDKTVKIWSLD 563

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           + +V+    GH  A+    F +   +L+S   D  I +WD      L  L  H + +  +
Sbjct: 564 TFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWAL 623

Query: 170 WCQGE-DWLISTSKDGMIKLW 189
               + D ++S   DG+ + W
Sbjct: 624 NTMNDGDMIVSADADGVFQFW 644

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 105/425 (24%), Positives = 173/425 (40%), Gaps = 115/425 (27%)

Query: 357 TSNNTIEYYSIPYEKR-EATSPAP-----LKTHTIE--LQGQRTDV---------RSIDI 399
           TS     +Y +PY++R   T P P     L + TI   L+ Q  D          R+ID+
Sbjct: 284 TSATKESHYLVPYDQRANHTKPIPPFLLDLDSQTIPAGLKKQTDDYYILYNPALPRNIDV 343

Query: 400 -----------------SDDNKLLATASNGSLKIWNVKTHKCI----------------- 425
                            S+D K LAT  N + +++NV + + I                 
Sbjct: 344 ELHKSLDHTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNS 403

Query: 426 RTFECG-------------------YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLD 466
           +  E G                   Y  S  F P G  +  G     ++++D+A   ++ 
Sbjct: 404 KDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKII- 462

Query: 467 TVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDT 526
            V   H+  I+SLD    G++LV+GS D+TV+ WD +     +                 
Sbjct: 463 MVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL----------------- 505

Query: 527 TLELNDDILSVRISPDD-RYLAISLLDNTVKV------FFLDSMKFYLSL-YGHKLPVLS 578
           TL + D + +V +SP+D +Y+A   LD  V+V      F ++ +     L  GHK  V S
Sbjct: 506 TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS 565

Query: 579 IDISFDSKMIITSSADKNIKIWGLD-----------FGDCHKSLFAHQDSIMSVKFLPES 627
           +  + D   +++ S D+++K+W L+            G C  +   H+D ++SV      
Sbjct: 566 VVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGD 625

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASN-------GSFVVSSSHDHS 680
               S SKD  V +WD +    +  L  H++ V ++A+A+        G F   S  D  
Sbjct: 626 EYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSG-DCK 684

Query: 681 IRIWE 685
            RIW+
Sbjct: 685 ARIWK 689

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 105/231 (45%), Gaps = 36/231 (15%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECT----------------- 83
           L T   +   ++++ +G+L+A LSD      +  + SK +E                   
Sbjct: 367 LATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTTYSTSATTSS 426

Query: 84  --YLE---VHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLIS 138
             Y+       D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+S
Sbjct: 427 DLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVS 486

Query: 139 GSRDSNIIVWDL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQ 195
           GS D  + +WDL  G+  L    S +D +T +    ED  ++ + S D  +++WD +T  
Sbjct: 487 GSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGF 544

Query: 196 CIET-------HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDK 237
            +E           H    +S+   +D   + +G+ D  VK+W LN  N+K
Sbjct: 545 LVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNK 595

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 92/221 (41%), Gaps = 45/221 (20%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+               T     ED   +A G  D  ++VW
Sbjct: 493 VRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPEDGKYIAAGSLDRAVRVW 538

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDL--------- 150
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L         
Sbjct: 539 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLK 598

Query: 151 --VGEVGLYKLRSHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
             V          HKD +  +   QG+++++S SKD  +  WD K+   +     H    
Sbjct: 599 PNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 658

Query: 208 WSLSVKD--------DLLITTGTDSQVKIWKLN--MENDKM 238
            S++V +         +  T   D + +IWK     ++DKM
Sbjct: 659 ISVAVANGHPLGTEYGVFATGSGDCKARIWKYRKIADSDKM 699

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score =  103 bits (256), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 153/357 (42%), Gaps = 70/357 (19%)

Query: 379 PLKTHTIELQGQRT-----DVRSIDISDDNKLLATASNGSLKIWNVKTHKCIRTF----E 429
           P +   I+++  RT      V  +  S++ + LAT  N + KI+ V T   +       +
Sbjct: 301 PTQPKDIDIELHRTLLHDSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTK 360

Query: 430 CG------------YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIW 477
            G            Y  S  F P G  +  G     ++++D+A   ++  V   H+  I+
Sbjct: 361 TGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIV-MVLRGHEQDIY 419

Query: 478 SLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSV 537
           SLD    G +LV+GS D+T++ WD       +                 TL + D + +V
Sbjct: 420 SLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL-----------------TLSIEDGVTTV 462

Query: 538 RISPDD-RYLAISLLDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKM 587
            +SP +  Y+A   LD TV+V+  DS   +L         +  GHK  V S+  + D K 
Sbjct: 463 AVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKN 520

Query: 588 IITSSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMSVKFLPESHNFFSCS 634
           I++ S D+++K+W L               G+C  +   H+D ++SV          S S
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGS 580

Query: 635 KDAVVKYWDGEKFECIQKLYAHQSEVWALAIA------SNGSFVVSSSHDHSIRIWE 685
           KD  V +WD      +  L  H++ V ++A+A      +N +   + S D   +IW+
Sbjct: 581 KDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWK 637

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 98/205 (47%), Gaps = 16/205 (7%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEV--HEDTDLLAVGY 98
           L T   +   I+++ TG+L+  L D    G  DA  +  A+     V    D   LA G 
Sbjct: 333 LATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGA 392

Query: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VGEVGLY 157
            D +I++WD+  + +++   GH+  I  L +  +G +L+SGS D  I +WDL  G+  L 
Sbjct: 393 EDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL- 451

Query: 158 KLRSHKDCITGIWCQ--GEDWLISTSKDGMIKLWDLKTQQCI-------ETHIAHTGECW 208
              S +D +T +       +++ + S D  +++WD  +   +       ET + H    +
Sbjct: 452 -TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVY 510

Query: 209 SLS-VKDDLLITTGT-DSQVKIWKL 231
           S+   +D   I +G+ D  VK+W L
Sbjct: 511 SVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 88/227 (38%), Gaps = 45/227 (19%)

Query: 36  SGPGQLITSALENVNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDL 93
           SG   +  S    + IWD+ TG    TLS  DG+   A       P    Y         
Sbjct: 426 SGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVA-----VSPGNGNY--------- 471

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNII 146
           +A G  D  ++VWD  S  ++   +       GHK ++  + F   G  ++SGS D ++ 
Sbjct: 472 VAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVK 531

Query: 147 VWDLVGEVGL-------------YKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           +W+L    G                   HKD +  +   + + +++S SKD  +  WD  
Sbjct: 532 LWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKV 591

Query: 193 TQQCIETHIAHTGECWSLSVKD--------DLLITTGTDSQVKIWKL 231
           +   +     H     S++V +        ++  T   D + KIWK 
Sbjct: 592 SGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKF 638

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 25/165 (15%)

Query: 49  VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDL 108
           V +WD  +G L+  L      G     G K +  + +   +  ++++ G  D  +K+W+L
Sbjct: 481 VRVWDSNSGFLVERLDSEGETGV----GHKDSVYSVVFTRDGKNIVS-GSLDRSVKLWNL 535

Query: 109 MS-------------KTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVG 155
            +                 + + GHK  +  +        ++SGS+D  +I WD V  V 
Sbjct: 536 RNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVP 595

Query: 156 LYKLRSHKDCITGIWCQ-----GEDWLI--STSKDGMIKLWDLKT 193
           L  L+ H++ +  +        G ++ +  + S D   K+W  +T
Sbjct: 596 LLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score =  103 bits (256), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 129/279 (46%), Gaps = 41/279 (14%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++DL+S  +L T++  H+  I+SLD    G +LV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 429

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV+V      F ++ +     L  GHK  V S+  + D + +++ S D+++K+W L 
Sbjct: 473 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLR 532

Query: 603 ------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 533 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 592

Query: 657 QSEVWALAIASN-------GSFVVSSSHDHSIRIWEETE 688
           ++ V ++A+ +        G F   S  D   RIW+ T+
Sbjct: 593 RNSVISVAVVNGFPLGPDIGVFATGSG-DCKARIWKYTK 630

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 104/240 (43%), Gaps = 37/240 (15%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGS------------------KPAEC 82
           L T   +   ++ + TG+L+A LSD    G ++   S                  +P   
Sbjct: 308 LATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSATIQPGSS 367

Query: 83  TYLEVHE-----DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLI 137
           + L +       D   LA G  D +I++WDL SK +L+   GH+  I  L +   G +L+
Sbjct: 368 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLV 427

Query: 138 SGSRDSNIIVWDL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQ 194
           SGS D  + +WDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T 
Sbjct: 428 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 195 QCIET-------HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGEKLTEV 245
             +E           H    +S+   +D   + +G+ D  VK+W L   N +      EV
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATCEV 545

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 91/215 (42%), Gaps = 45/215 (20%)

Query: 44  SALENVNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADG 101
           S    V IWD++TG    TLS  DG+   A       P +  Y+         A G  D 
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDR 475

Query: 102 VIKVWDLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEV 154
            ++VWD  +  ++   +       GHK ++  + F   G  ++SGS D ++ +WDL G  
Sbjct: 476 TVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRG-- 533

Query: 155 GLYKLRSHKDC-----------ITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
            L   +SH  C           ++    Q +++++S SKD  +  WD  +   +     H
Sbjct: 534 -LNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 592

Query: 204 TGECWSLSV-------KDDLLITTGT-DSQVKIWK 230
                S++V        D  +  TG+ D + +IWK
Sbjct: 593 RNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWK 627

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + DK I+IW L       +L  H+  I S+ + P      S 
Sbjct: 370 LYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSG 429

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L              +G ++ + S D ++R+W+
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 481

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 128/279 (45%), Gaps = 41/279 (14%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++DL +  +L T++  H+  I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV+V      F ++ +     L  GHK  V S+  + D + +I+ S D+++K+W L 
Sbjct: 456 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLR 515

Query: 603 ------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 516 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 575

Query: 657 QSEVWALAIASN-------GSFVVSSSHDHSIRIWEETE 688
           ++ V ++A+ +        G F   S  D   RIW+ T+
Sbjct: 576 RNSVISVAVVNGFPLGPDVGVFATGSG-DCKARIWKYTK 613

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 123/268 (45%), Gaps = 32/268 (11%)

Query: 394 VRSIDISDDNKLLATASNGSL-KIWNVKTHKCIRTFECGYA---LSCKFLPGGLLVILGT 449
           +RS+  S D K LAT +   L +IW++ T K + T + G+     S  + P G  ++ G+
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSGS 413

Query: 450 RTGELQLFDLASS--SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT 507
               ++++DL +   SL  ++ED       S     DGK +  GS D+TV+ WD +    
Sbjct: 414 GDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRTVRVWDSET--- 467

Query: 508 LVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFY- 566
                   L+  L   ++ +    D + SV  + D + +    LD +VK++ L  +    
Sbjct: 468 ------GFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQK 521

Query: 567 ------LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 620
                 ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H++S++S
Sbjct: 522 SHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVIS 581

Query: 621 VKFL------PESHNFFSCSKDAVVKYW 642
           V  +      P+   F + S D   + W
Sbjct: 582 VAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 103/240 (42%), Gaps = 37/240 (15%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAE----------CTYLEVHED 90
           L T   +   ++ + TG+LLA LSD    G ++   + PA              ++    
Sbjct: 291 LATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASS 350

Query: 91  TDL-------------LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLI 137
           +DL             LA G  D +I++WDL +K +L+   GH+  I  L +   G +L+
Sbjct: 351 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 138 SGSRDSNIIVWDL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQ 194
           SGS D  + +WDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T 
Sbjct: 411 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 195 QCIET-------HIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEV 245
             +E           H    +S+    D   +I+   D  VK+W L   N +      EV
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEV 528

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 108/231 (46%), Gaps = 24/231 (10%)

Query: 385 IELQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFL-PG- 441
           + LQG   D+ S+D     +KL++ + + +++IW+++T +C  T      ++   + PG 
Sbjct: 388 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 447

Query: 442 GLLVILGTRTGELQLFDLASSSLLDTVED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+    ++++D  +  L++ ++        H  +++S+  T DG+ +++GS D+
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDR 507

Query: 496 TVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTV 555
           +VK WD +  N    G K      +     T     D +LSV  + DD Y+     D  V
Sbjct: 508 SVKLWDLRGLN----GQKSHATCEV-----TYTGHKDFVLSVATTQDDEYILSGSKDRGV 558

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDI------SFDSKMIITSSADKNIKIW 600
             +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 559 LFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 85/214 (39%), Gaps = 24/214 (11%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT + +       L            +L+ D+   +N
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA-----------RLSDDSVAGVN 322

Query: 532 DDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
           ++       P +   A +  +N+  +    S   Y         + S+  S D K + T 
Sbjct: 323 NE---ASTGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSPDGKYLATG 370

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           + DK I+IW L       +L  H+  I S+ + P      S S D  V+ WD    +C  
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL 430

Query: 652 KLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            L              +G ++ + S D ++R+W+
Sbjct: 431 TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 96/227 (42%), Gaps = 47/227 (20%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+               T      D   +A G  D  ++VW
Sbjct: 418 VRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPGDGKYIAAGSLDRTVRVW 463

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +  ++   +       GHK ++  + F   G  +ISGS D ++ +WDL G   L   
Sbjct: 464 DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRG---LNGQ 520

Query: 160 RSHKDC-----------ITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW 208
           +SH  C           ++    Q +++++S SKD  +  WD  +   +     H     
Sbjct: 521 KSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVI 580

Query: 209 SLSV-------KDDLLITTGT-DSQVKIWKLNMENDK--MGEKLTEV 245
           S++V        D  +  TG+ D + +IWK   +++    G KL E+
Sbjct: 581 SVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTATGAKLQEL 627

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 109/235 (46%), Gaps = 3/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           L+T S D T+K W     +    G ++     +K++  T      DI ++ ISP+D   A
Sbjct: 423 LLTASNDLTIKKWKIPKPSA---GDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFA 479

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K+I T S DK IKIW LD    
Sbjct: 480 TASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSV 539

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
            K+L  H +++    F+ + +   S   D ++K WD    ECI  L  H + +WAL + +
Sbjct: 540 IKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQN 599

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G  +VS+  D   + W +  D+             + E +L   L E +  +AF
Sbjct: 600 DGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQEQSLQNYLNERDWTNAF 654

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 136/621 (21%), Positives = 240/621 (38%), Gaps = 90/621 (14%)

Query: 126 LLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE----DWLI-ST 180
           ++  D T T +  G  D +++V D+      + L+ H   I+ +   GE     WL+ S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDD-------LLITTGTDSQVKIWKLNM 233
             +GM+K+WDL  ++CI T   HT     + + +         L+T G D+ V  W+ N+
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNL 194

Query: 234 ENDKMGEKLTEVGVFEKQSKQRG-LKVEFI-TNASDGV-SFFYIQNADKTIETFRIRKEE 290
              K    L +     +Q +  G +  +FI T  SD V     ++N      T +  +E 
Sbjct: 195 ---KKKCTLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISLKNGQVIKRTRKPIEEL 251

Query: 291 EIAXXXXXXXXXXXXXXXTDEEIAR-SIKGSYSS---LVLHPFQTIRSFYKVKSASWTTV 346
            I                +D+ +    ++G+       ++     I   + +  A  T V
Sbjct: 252 FIIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISSKSCIAGNHGI-IADMTFV 310

Query: 347 TSSKLELVLTTSNNTIEYYSIPYEKR----EATSPAPLKTHTIELQGQRTDVRSIDISDD 402
                 L L T++ T+    +P   +    E  S  P+     E  G    + +ID ++D
Sbjct: 311 GPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESFLPIDVDMYE--GHEDLLNAIDSTED 368

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFEC---GYALSC------KFLPGGLLVILGTRTG 452
              +ATAS + S  +W   T K   T      G++ S         +P      L T + 
Sbjct: 369 GLWIATASKDHSAIVWKYNTIKQKFTQYARFSGHSSSVTAVGLPNVMPKSYPEYLLTASN 428

Query: 453 ELQL--FDLASSSLLDTVEDAHDAAIW------------SLDLTSDGKRLVTGSADKTVK 498
           +L +  + +   S  D   + HD  I             +L ++ +     T S DKT K
Sbjct: 429 DLTIKKWKIPKPSAGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCK 488

Query: 499 FWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVF 558
            WD +   ++   +          NH   L        V     D+ +A    D T+K++
Sbjct: 489 IWDLETGESVATLS----------NHKRGL------WDVSFCQFDKIIATCSGDKTIKIW 532

Query: 559 FLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 618
            LD+     +L GH   V           ++++ AD  IKIW +  G+C  +L  H + I
Sbjct: 533 SLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRI 592

Query: 619 MSVKFLPESHNFFSCSKDAVVKYW--------------DGEKFECIQKLYAHQSEV-WAL 663
            ++    +     S   D V ++W              + E+ E  Q L  + +E  W  
Sbjct: 593 WALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQEQSLQNYLNERDWT- 651

Query: 664 AIASNGSFVVSSSHDHSIRIW 684
                 +F+++ S DH +R++
Sbjct: 652 -----NAFLLAISLDHPMRLF 667

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 123/295 (41%), Gaps = 24/295 (8%)

Query: 6   QRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALE-NVNIWDI---KTGDLLA 61
           Q+F Q A F   +S+   V LP        S P  L+T++ +  +  W I     GD   
Sbjct: 391 QKFTQYARFSGHSSSVTAVGLP---NVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEV 447

Query: 62  TLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHK 121
              D     +   R +   +   L +  +  + A    D   K+WDL +   +   + HK
Sbjct: 448 EFHD--VKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHK 505

Query: 122 AA---ITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWL 177
                ++  QFD     + + S D  I +W L     +  L  H + +    +   ++ L
Sbjct: 506 RGLWDVSFCQFDKI---IATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQL 562

Query: 178 ISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKD--DLLITTGTDSQVKIWKLNMEN 235
           +ST  DG+IK+WD+   +CI T   H    W+L V++  DL+++   D   + W+     
Sbjct: 563 VSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWR----- 617

Query: 236 DKMGEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQ-NADKTIETFRIRKE 289
           D   E+  E    EK+  ++   ++   N  D  + F +  + D  +  F + +E
Sbjct: 618 DCTDEQREEDMAKEKERIEQEQSLQNYLNERDWTNAFLLAISLDHPMRLFNVLRE 672

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 10/180 (5%)

Query: 515 KLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           +L P+ K+ H  +     +I +++++PD +YL        +K+  + + K   S+     
Sbjct: 13  QLKPVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS- 71

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFFS 632
           P   ID    S ++     D ++ +  ++ G    SL  H  +I S+KF  E  S+ +  
Sbjct: 72  PSYIIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLL 131

Query: 633 CSKD--AVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS-----FVVSSSHDHSIRIWE 685
           CS D   +VK WD  K +CI  +  H S V  + I  + +      +V+   D+ +  WE
Sbjct: 132 CSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 142/329 (43%), Gaps = 60/329 (18%)

Query: 397 IDISDDNKLLATASNGSLKIWNVKTHKCIRTFECG--------------------YALSC 436
           +  S+D + LAT  N + +++   T + I T                        Y  S 
Sbjct: 404 VRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSV 463

Query: 437 KFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
            F P G  +  G     ++++D+ +  ++  +   H+  I+SLD    G++LV+GS DKT
Sbjct: 464 CFSPDGKFLAAGAEDKLIRIWDITTKQIV-MILKGHEQDIYSLDYFPSGEKLVSGSGDKT 522

Query: 497 VKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISLLDNTV 555
           V+ WD +     +                 TL + D + +V  SP++ +++A   LD + 
Sbjct: 523 VRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAAGSLDRSA 565

Query: 556 KV------FFLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD-- 606
           ++      F L  +     L  GHK  + S+  + D K +++ S D+++K+W LD  +  
Sbjct: 566 RIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNN 625

Query: 607 ----CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWA 662
               C  +   H+D ++SV          S SKD  V +WD      +  L  H++ V +
Sbjct: 626 SNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVIS 685

Query: 663 LAIASN-------GSFVVSSSHDHSIRIW 684
           +A+A+        G F   S  D + +IW
Sbjct: 686 VAVANGQPLGPEFGVFSTGSG-DFTAKIW 713

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 109/227 (48%), Gaps = 18/227 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
           +H + +  +  ++DG+ L TG  +KT + +       +     D   P    N ++  + 
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTGELIATLLVD---PQSSNNSNSEQQT 451

Query: 531 NDD-----ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           N +     I SV  SPD ++LA    D  ++++ + + +  + L GH+  + S+D     
Sbjct: 452 NPESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSG 511

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDG 644
           + +++ S DK ++IW L  G C  +L + +D + +V   P +  F +  S D   + WD 
Sbjct: 512 EKLVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDT 570

Query: 645 EKFECIQKL-------YAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
           E    +++L         H+  +++++   +G  +VS S D S+++W
Sbjct: 571 ETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 102/224 (45%), Gaps = 21/224 (9%)

Query: 36  SGPGQ-LITSALENVNIWDIKTGDLLATL-SDGLPPGASDARGSKPAECTYLEVH----- 88
           S  GQ L T   +   ++   TG+L+ATL  D      S++      E + L +      
Sbjct: 407 SNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFS 466

Query: 89  EDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVW 148
            D   LA G  D +I++WD+ +K +++   GH+  I  L +  +G +L+SGS D  + +W
Sbjct: 467 PDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIW 526

Query: 149 DL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKT-------QQCIE 198
           DL  G+  L    S +D +T +     +  ++ + S D   ++WD +T           +
Sbjct: 527 DLRTGQCSL--TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTD 584

Query: 199 THIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGE 240
               H    +S+S   D   L++   D  VK+W L+  N+   E
Sbjct: 585 LQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNE 628

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 104/234 (44%), Gaps = 35/234 (14%)

Query: 387 LQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGL 443
           L+G   D+ S+D      KL++ + + +++IW+++T +C  T   E G          G 
Sbjct: 495 LKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK 554

Query: 444 LVILGTRTGELQLFDLASSSLLDTV------EDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+     +++D  +  LL  +      ++ H  +I+S+  T DGK+LV+GS D++V
Sbjct: 555 FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSV 614

Query: 498 KFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELN-----DDILSVRISPDDRYLAISLLD 552
           K W+    N                N + + E+      D +LSV  S +D Y+     D
Sbjct: 615 KLWNLDTTNN---------------NSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKD 659

Query: 553 NTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
             V  +  +S    L L GHK  V+S+ ++    +        T S D   KIW
Sbjct: 660 RGVLFWDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 87/206 (42%), Gaps = 38/206 (18%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+   +S     K               +A G  D   ++W
Sbjct: 523 VRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK--------------FIAAGSLDRSARIW 568

Query: 107 DLMSKTVLLNF-------NGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL------VGE 153
           D  +  +L          NGHK +I  + F   G +L+SGS D ++ +W+L        E
Sbjct: 569 DTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNE 628

Query: 154 VGLYKLRSHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
                   HKD +  +   Q +++++S SKD  +  WD  +   +     H     S++V
Sbjct: 629 SCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV 688

Query: 213 KDDL-------LITTGT-DSQVKIWK 230
            +         + +TG+ D   KIW+
Sbjct: 689 ANGQPLGPEFGVFSTGSGDFTAKIWR 714

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 47/110 (42%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSK 635
           + S+  S D K +   + DK I+IW +        L  H+  I S+ + P      S S 
Sbjct: 460 IRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSG 519

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           D  V+ WD    +C   L          +  +NG F+ + S D S RIW+
Sbjct: 520 DKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWD 569

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 61/149 (40%), Gaps = 17/149 (11%)

Query: 29  SSRTNKGS--GPGQLITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLE 86
           SS  N G     G L  SA     IWD +TG LL  L        +D +         + 
Sbjct: 547 SSSPNNGKFIAAGSLDRSA----RIWDTETGFLLKRLD-----SQTDLQNGHKDSIYSVS 597

Query: 87  VHEDTDLLAVGYADGVIKVWDL------MSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
             +D   L  G  D  +K+W+L       +++  + F GHK  +  +        ++SGS
Sbjct: 598 FTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGS 657

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           +D  ++ WD      L  L+ HK+ +  +
Sbjct: 658 KDRGVLFWDTNSGNPLLMLQGHKNSVISV 686

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 102/201 (50%), Gaps = 9/201 (4%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTTLELNDDILSVRISPDDRY 545
           L++ S D T+K W        VP  +D    + ++K +  T      DI ++ +SP+D  
Sbjct: 486 LLSASNDLTIKKW-------AVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSV 538

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ LD+ +   +L  HK  +  ++     K++ T S DK +KIW LD  
Sbjct: 539 FATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTY 598

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
              K+L  H +++    F+ ++    S   D +VK WD    EC++ L AH + +WAL++
Sbjct: 599 SVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSV 658

Query: 666 ASNGSFVVSSSHDHSIRIWEE 686
             +G  +V++  D   + W++
Sbjct: 659 LKDGDIIVTADADGVFQFWKD 679

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 3/159 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L V  +  + A    D   K+W L +  +      HK  +  + F     
Sbjct: 520 RRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDK 579

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + +W L     +  L  H + +    +      L+S+  DG++KLWD  T
Sbjct: 580 LLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCST 639

Query: 194 QQCIETHIAHTGECWSLSV-KD-DLLITTGTDSQVKIWK 230
            +C++T  AH    W+LSV KD D+++T   D   + WK
Sbjct: 640 GECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFWK 678

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 82/172 (47%), Gaps = 8/172 (4%)

Query: 334 SFYKVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIE--LQGQR 391
           + + VK++ +T     K    L  S N   + +  Y+K        L T  +E  L   +
Sbjct: 509 TVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYDK--TCKIWSLDTGELEATLANHK 566

Query: 392 TDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALSCKFLPGGLLVILG 448
             +  ++    +KLLAT S + ++KIW++ T+  ++T E        C F+     ++  
Sbjct: 567 RGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSS 626

Query: 449 TRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
              G ++L+D ++   + T+ DAH+  IW+L +  DG  +VT  AD   +FW
Sbjct: 627 GADGLVKLWDCSTGECVKTL-DAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 65/138 (47%), Gaps = 11/138 (7%)

Query: 69  PGASDARGSKPAECTY-LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLL 127
           P     R  K +   Y +E    + LLA+G  DG + + D+ +  V  +F GH   I+ +
Sbjct: 110 PSKKIVRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSV 169

Query: 128 QF----DSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITG----IWCQGED--WL 177
           +F    +S   RL SG     + +WDLV    L+ ++ H   + G    +  + ED   L
Sbjct: 170 KFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQL 229

Query: 178 ISTSKDGMIKLWDLKTQQ 195
           IS  +D +I L+   +++
Sbjct: 230 ISGGRDNIINLYQFDSRK 247

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 531 NDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I ++RI+PD ++L        ++V+ L S K   S+     PV  ++    S +
Sbjct: 77  NDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVMECDVTSTL 135

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ I  ++ G    S   H  +I SVKF  E ++      S     VVK WD
Sbjct: 136 LAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWD 195

Query: 644 GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
             K +C+  +  H   V  L                  R+ +E EDQ+
Sbjct: 196 LVKRKCLHTVQEHTMAVRGL----------------DFRVLDEDEDQM 227

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 74/164 (45%), Gaps = 13/164 (7%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E T L +  D   L       +++V+ L SK ++ +     + + +++ D T T L  G 
Sbjct: 82  EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKV-SSPVYVMECDVTSTLLAIGG 140

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE----DW-LISTSKDGMIKLWDLKTQQ 195
            D ++ + D+      +  + H   I+ +   GE     W L S    G++K+WDL  ++
Sbjct: 141 TDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRK 200

Query: 196 CIETHIAHTGECWSLSVK------DDL-LITTGTDSQVKIWKLN 232
           C+ T   HT     L  +      D + LI+ G D+ + +++ +
Sbjct: 201 CLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQFD 244

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 36/77 (46%), Gaps = 14/77 (18%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-----DSTGTRLISGSRDSNIIVW 148
           LA G   GV+K+WDL+ +  L     H  A+  L F     D    +LISG RD NII  
Sbjct: 182 LASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRD-NII-- 238

Query: 149 DLVGEVGLYKLRSHKDC 165
                  LY+  S K C
Sbjct: 239 ------NLYQFDSRKKC 249

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 22/135 (16%)

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLD----FGDCHKSLFAHQDSIMSVKFLPE 626
           GH+  + S+D + D   + T+S D  + +W  D        +     H   + +V  LP 
Sbjct: 418 GHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVG-LPN 476

Query: 627 SHN------FFSCSKDAVVKYW------DGEKFECIQKL-----YAHQSEVWALAIASNG 669
             N        S S D  +K W      DG+    + K       AH+ ++ ALA++ N 
Sbjct: 477 VMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPND 536

Query: 670 SFVVSSSHDHSIRIW 684
           S   ++S+D + +IW
Sbjct: 537 SVFATASYDKTCKIW 551

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 50/252 (19%), Positives = 99/252 (39%), Gaps = 61/252 (24%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS 410
           E +L+ SN+ TI+ +++P  +    +   +K      +    D+ ++ +S ++ + ATAS
Sbjct: 484 EFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATAS 543

Query: 411 -NGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVE 469
            + + KIW++ T                              GEL+      ++L +   
Sbjct: 544 YDKTCKIWSLDT------------------------------GELE------ATLAN--- 564

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLE 529
             H   +W ++     K L T S DKTVK W     + +                  TLE
Sbjct: 565 --HKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVM-----------------KTLE 605

Query: 530 LNDD-ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
            + + +        ++ L  S  D  VK++   + +   +L  H   + ++ +  D  +I
Sbjct: 606 GHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDII 665

Query: 589 ITSSADKNIKIW 600
           +T+ AD   + W
Sbjct: 666 VTADADGVFQFW 677

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 162/384 (42%), Gaps = 79/384 (20%)

Query: 362 IEYYSIPYEKREAT-------SPAPLKTHTIELQG---QRTDVRSIDISDDNKLLATASN 411
           ++Y  +P   R+ T       +PA  +T  +EL       + V  +  S+D + LAT  N
Sbjct: 276 LDYKQVPENLRKKTEEYDVLYNPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGCN 335

Query: 412 GSLKIWNVKTHKCIR--------TFECG-----------YALSCKFLPGGLLVILGTRTG 452
            + +++ V   + +         + + G           Y  S  F P G  +  G    
Sbjct: 336 KTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDR 395

Query: 453 ELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
            ++++DLA   ++  V   HD  ++SLD    G +LV+GS D+TV+ WD +     +   
Sbjct: 396 LIRIWDLAQQKIV-MVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--- 451

Query: 513 KDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISLLDNTVKV------FFLDSMKF 565
                         TL + D + +V +SP D +Y+A   LD  V+V      F ++ +  
Sbjct: 452 --------------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDS 497

Query: 566 YLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL-------DFGD---------CH 608
              L  GH+  V S+  + D   +++SS D+++K+W L       +  D         C 
Sbjct: 498 ENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVCE 557

Query: 609 KSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASN 668
            +   H+D ++SV          S SKD  V +WD      +  L  H++ V ++A+A N
Sbjct: 558 VTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVA-N 616

Query: 669 G-------SFVVSSSHDHSIRIWE 685
           G           + S D   RIW+
Sbjct: 617 GHPLGPEYQVFATGSGDCRARIWK 640

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 101/222 (45%), Gaps = 20/222 (9%)

Query: 34  KGSGPGQ-LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHE--- 89
           K S  GQ L T   +   ++ +  G+L+A LSD   P   +      +  T L +     
Sbjct: 322 KFSNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCF 381

Query: 90  --DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIV 147
             D   LA G  D +I++WDL  + +++   GH   +  L +  +G +L+SGS D  + +
Sbjct: 382 SPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRI 441

Query: 148 WDL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIET----- 199
           WDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +E      
Sbjct: 442 WDLKTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 499

Query: 200 --HIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLNMENDK 237
                H    +S+    D   ++++  D  VK+W L   N+K
Sbjct: 500 ELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEK 541

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 88/218 (40%), Gaps = 48/218 (22%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD+KTG    TLS  DG+   A       P +  Y+         A G  D  ++VW
Sbjct: 439 VRIWDLKTGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDRAVRVW 484

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVG----EVG 155
           D  +  ++   +       GH+ ++  + F   G +++S S D ++ +W+L G    E  
Sbjct: 485 DSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENA 544

Query: 156 LYKLRS------------HKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIA 202
               +S            HKD +  +     D +++S SKD  +  WD  T   +     
Sbjct: 545 ADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQG 604

Query: 203 HTGECWSLSVKD--------DLLITTGTDSQVKIWKLN 232
           H     S++V +         +  T   D + +IWK +
Sbjct: 605 HRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWKFS 642

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  101 bits (251), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 112/235 (47%), Gaps = 5/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D T+K W         P + D  +  +K++  T      DI ++ ISP+D   A
Sbjct: 466 IITASNDLTIKKWSVPK-----PTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFA 520

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ +DS +   +L  HK  +  +      K++ T S DK IK+W L+    
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSV 580

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
            K+L  H +++    F+  +    S   D ++K WD    ECI+ L AH + +WAL++ S
Sbjct: 581 VKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLS 640

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G   V++  D   + W++  ++             + E +L   + +G+  +AF
Sbjct: 641 DGKEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGDWTNAF 695

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 109/243 (44%), Gaps = 31/243 (12%)

Query: 458 DLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVENTLVPGTKD 514
           D+ +  + D    AH+  I +L ++ +     T S DKT K W+    ++E TL      
Sbjct: 489 DMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLA----- 543

Query: 515 KLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
                   NH   L        V     D+ LA    D T+KV+ L+SM    +L GH  
Sbjct: 544 --------NHKRGL------WDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTN 589

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCS 634
            V        +K I+++ AD  IK+W L  G+C ++L AH + I ++  L +   F +  
Sbjct: 590 AVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTAD 649

Query: 635 KDAVVKYW----DGEKFECI--QKLYAHQSEVWALAIASN---GSFVVSSSHDHSIRIWE 685
            D V ++W    + E+ E +  QKL   Q +     +A      +F+++ + +H +R++ 
Sbjct: 650 ADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGDWTNAFLLAMTLNHPMRLYR 709

Query: 686 ETE 688
             E
Sbjct: 710 VLE 712

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 76/178 (42%), Gaps = 17/178 (9%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAA---ITLLQFDS 131
           R +   +   L +  +  + A    D   K+W++ S  +      HK     +T  Q+D 
Sbjct: 500 RRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDK 559

Query: 132 TGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWD 190
               L + S D  I VW L     +  L  H + +    +      ++ST  DG+IK+WD
Sbjct: 560 L---LATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWD 616

Query: 191 LKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIW--------KLNMENDKM 238
           L T +CI T  AH+   W+LSV  D    +T   D   + W        K N+EN K+
Sbjct: 617 LSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLENQKL 674

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 57/101 (56%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALSCKFLPGGLLVILGTRTGELQLFDL 459
           +KLLAT S + ++K+W++++   ++T E        C F+     ++     G ++++DL
Sbjct: 558 DKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDL 617

Query: 460 ASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ DAH   IW+L + SDGK  VT  AD   +FW
Sbjct: 618 STGECIRTL-DAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 109/255 (42%), Gaps = 33/255 (12%)

Query: 41  LITSALENVNIWDIK-TGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYA 99
           L TS ++ VNI ++  T  L+ T+ +               E T L++  + + L     
Sbjct: 32  LATSVVDEVNIMELSPTKRLIHTIEN-----------DDEQEITALKLTPNGEYLCFVSQ 80

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
             +++++ L SK ++ +     + + ++  DS+ T +  G  D ++ V D+      +  
Sbjct: 81  AQLLRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSF 139

Query: 160 RSHKDCITGIWCQGED----W-LISTSKDGMIKLWDLKTQQCIETHIAHT----GECWSL 210
           + H   I+ +   GE     W L S    GM+K+WDL  + CI T   H     G  + L
Sbjct: 140 KGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRL 199

Query: 211 SVKDD---LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQSKQRGLKVEFITNASD 267
           S  DD    L+T G D  V +++LN        KL       +Q +  G    FI ++ D
Sbjct: 200 SPADDGVLELLTGGRDDIVNLFQLNSTKKA---KLMRTIPVHQQIEACG----FIRDSPD 252

Query: 268 GVSFFYIQNADKTIE 282
           G S FY    D   +
Sbjct: 253 G-SLFYTAGGDAVFQ 266

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 68/156 (43%), Gaps = 11/156 (7%)

Query: 515 KLLPMLKLNHDTTLELNDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
           +L P  +L H  T+E NDD   I +++++P+  YL        ++++ L S K   S+  
Sbjct: 44  ELSPTKRLIH--TIE-NDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKV 100

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-- 629
              PV  +D    S ++     D ++ +  ++ G    S   H  +I SVKF  E     
Sbjct: 101 SS-PVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSI 159

Query: 630 --FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL 663
               S     +VK WD  +  CI  +  H + V  L
Sbjct: 160 WRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 95/254 (37%), Gaps = 65/254 (25%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS 410
           E ++T SN+ TI+ +S+P           +K      +    D+ ++ IS ++ + ATAS
Sbjct: 464 EFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATAS 523

Query: 411 -NGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVE 469
            + + KIWNV +                              GEL+   LA+        
Sbjct: 524 YDKTCKIWNVDS------------------------------GELE-GTLAN-------- 544

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ---VENTLVPGTKDKLLPMLKLNHDT 526
             H   +W +      K L T S DKT+K W  +   V  TL   T         +   +
Sbjct: 545 --HKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTN-------AVQRCS 595

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +  N  I+S               D  +KV+ L + +   +L  H   + ++ +  D K
Sbjct: 596 FINRNKQIVSTGA------------DGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGK 643

Query: 587 MIITSSADKNIKIW 600
             +T+ AD   + W
Sbjct: 644 EFVTADADGVFQFW 657

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 73/180 (40%), Gaps = 24/180 (13%)

Query: 528 LELNDDILSVRISPDDRYLAISLLDN-TVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDS 585
           L  N   L V  +P  ++ A    D  T KV   + +   + LY GH   + S+D S + 
Sbjct: 353 LATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELYEGHTDLLNSLDSSENG 412

Query: 586 KMIITSSADKNIKIWGLDFGDCHK-----SLFAHQDSIMSVKFLPESHN-----FFSCSK 635
           + + T S D  + +W L+  D  K         H   + +V       N       + S 
Sbjct: 413 EWLATCSKDHTVILWKLN-ADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITASN 471

Query: 636 DAVVKYWDGEK-------FECIQ----KLYAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
           D  +K W   K          I+       AH+ ++ AL+I+ N S   ++S+D + +IW
Sbjct: 472 DLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIW 531

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  101 bits (251), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 100/205 (48%), Gaps = 9/205 (4%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKL--LPMLKLNHDTTLELNDDILSVRISPDDRY 545
           L+T S D T+K W+       +P   DK+  + ++K +  T      DI ++ +SP+D  
Sbjct: 488 LLTASNDLTIKKWN-------IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSV 540

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ L++ +   +L  HK  +  +      K++ T S DK IKIW LD  
Sbjct: 541 FATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTF 600

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
              ++L  H +++    F+ +     S   D ++K WD    EC++ L  H + +WAL I
Sbjct: 601 SVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTI 660

Query: 666 ASNGSFVVSSSHDHSIRIWEETEDQ 690
             +G  + S+  D   + W +  +Q
Sbjct: 661 QRDGELIASADADGVFQFWTDCSEQ 685

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 136/621 (21%), Positives = 231/621 (37%), Gaps = 92/621 (14%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E T L++  D   L       ++K+ ++ +  V+ +      +  ++  ++T T +  G 
Sbjct: 92  EITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISSPSY-IMDSEATSTLVAVGG 150

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGED----WLISTS-KDGMIKLWDLKTQQ 195
            D +IIV D+      +  + H   I+ +   GE     WL+++   +GMIK+W+L T++
Sbjct: 151 TDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRK 210

Query: 196 CIETHIAHTGECWSL---SVKDDL------LITTGTDSQVKIWKLNMENDKMGEKLTEVG 246
           C  T   HT     +   S+ DD       +I+ G D  V  W+L   ++K   KL +  
Sbjct: 211 CTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWEL---DNKKKCKLLQTI 267

Query: 247 VFEKQSKQRGL------KVEFITNASDGVSFF-------YIQNADKTIETFRI------- 286
              +Q +Q G       K    T+  D +  F        ++ + K IE   I       
Sbjct: 268 PAHQQVEQCGFIASPGHKNLIYTSGGDAIMQFISLEKGSIVKKSKKPIEELFIIGVLPIS 327

Query: 287 RKEEEIAXXXXXXXX---XXXXXXXTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASW 343
           + E+ I+                  T+EE     + +Y S +     TI        A  
Sbjct: 328 QGEKLISVMSDQSLHYLDVESNLKATNEE-----ELTYESALAGNHGTI--------ADM 374

Query: 344 TTVTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDN 403
             V      L L T++ T+     P +     +   L       +G    + ++D ++D 
Sbjct: 375 VFVGPKFQHLALATNSPTLRIIPTPLDDSTVDTNNLLPIDVDMYEGHEDLLNAVDATEDG 434

Query: 404 KLLATASNGSLKI-W-----NVKTHKCIRTFECGYALSCKFLPGGLLV----ILGTRTGE 453
             LATAS     I W       K     +      +++   LP  +L      L T + +
Sbjct: 435 LWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHWPEFLLTASND 494

Query: 454 LQLFDLASSSLLDTVEDAH------------DAAIWSLDLTSDGKRLVTGSADKTVKFWD 501
           L +         D +E  H            +  I +L ++ +     T S DKT K WD
Sbjct: 495 LTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWD 554

Query: 502 FQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLD 561
            +             L     NH   L        V     D+ LA    D T+K++ LD
Sbjct: 555 LETGE----------LTATLANHKRGL------WDVSFCQYDKLLATCSGDKTIKIWSLD 598

Query: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSV 621
           +     +L GH   V           +++S AD  IKIW    G+C K+L  H + I ++
Sbjct: 599 TFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWAL 658

Query: 622 KFLPESHNFFSCSKDAVVKYW 642
               +     S   D V ++W
Sbjct: 659 TIQRDGELIASADADGVFQFW 679

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 67  LPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITL 126
           L  G+   R +   +   L V  +  + A    D   K+WDL +  +      HK  +  
Sbjct: 514 LIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWD 573

Query: 127 LQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGM 185
           + F      L + S D  I +W L     +  L  H + +    +   +  L+S+  DG+
Sbjct: 574 VSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGL 633

Query: 186 IKLWDLKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIW 229
           IK+WD  + +C++T   H    W+L+++ D  L+ +   D   + W
Sbjct: 634 IKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFW 679

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 69/148 (46%), Gaps = 16/148 (10%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           IWD++TG+L ATL       A+  RG    + C Y        LLA    D  IK+W L 
Sbjct: 552 IWDLETGELTATL-------ANHKRGLWDVSFCQY------DKLLATCSGDKTIKIWSLD 598

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           + +V+    GH  A+    F +  T+L+S   D  I +WD      +  L  H + I  +
Sbjct: 599 TFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWAL 658

Query: 170 WCQGEDWLISTS-KDGMIKLW-DLKTQQ 195
             Q +  LI+++  DG+ + W D   QQ
Sbjct: 659 TIQRDGELIASADADGVFQFWTDCSEQQ 686

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 110/235 (46%), Gaps = 2/235 (0%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D TVK W  +V +       D  + ++K++  T      DI ++ I+P+D   A
Sbjct: 396 IITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ LDS +   +L  HK  +  +      K I T+S DK IKIW L+    
Sbjct: 454 TASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKV 513

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
             +L  H +++    F+ +     S   D ++K WD    EC++ L  H + +WAL +  
Sbjct: 514 VNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLR 573

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G  ++++  D   + W++  ++V            + E +L   +  G   +AF
Sbjct: 574 DGDMIITADADGVFQFWKDCTEEVKEQDLEKEKLRVEQEQSLRNFIANGEWTNAF 628

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 98/227 (43%), Gaps = 33/227 (14%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
           AH+  I +L +  +     T S DKT K WD             +L+  L  NH   L  
Sbjct: 435 AHEKDINALSIAPNDSIFATASYDKTCKIWDLD---------SGELMATLA-NHKRGL-- 482

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                 V     D+Y+A +  D T+K++ L++ K   +L GH   V         K I++
Sbjct: 483 ----WDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVS 538

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW-------- 642
           + AD  IKIW    G+C K+L  H + I ++  L +     +   D V ++W        
Sbjct: 539 TGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTEEVK 598

Query: 643 --DGEKFECIQKLYAHQSEVWALAIAS---NGSFVVSSSHDHSIRIW 684
             D EK    +KL   Q +     IA+     +F+++ + DH +R++
Sbjct: 599 EQDLEK----EKLRVEQEQSLRNFIANGEWTNAFLLAMTLDHPMRLY 641

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 119/292 (40%), Gaps = 13/292 (4%)

Query: 4   SYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALE-NVNIWDIKTGDLLAT 62
           S  +F++ A F   AS+   V LP  +  N G  P  +ITS+ +  V  W + +    + 
Sbjct: 362 SENKFKKYAQFIGHASSVTSVSLP--NVINNG-WPEFIITSSNDFTVKKWKVPSPTKKSD 418

Query: 63  LSDG--LPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             D   L   +   R +   +   L +  +  + A    D   K+WDL S  ++     H
Sbjct: 419 NDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANH 478

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLIS 179
           K  +  + F      + + S D  I +W L     +  L  H + +    +   +  ++S
Sbjct: 479 KRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVS 538

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIWKLNMENDK 237
           T  DG+IK+WD  + +C++T   H    W+L V    D++IT   D   + WK   E  K
Sbjct: 539 TGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTEEVK 598

Query: 238 MGEKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKE 289
             +   E    E++   R     FI N     +F      D  +  + + K+
Sbjct: 599 EQDLEKEKLRVEQEQSLRN----FIANGEWTNAFLLAMTLDHPMRLYNVLKQ 646

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALSCKFLPGGLLVILGTRTGELQLFDL 459
           +K +ATAS + ++KIW+++T K + T E        C F+     ++     G ++++D 
Sbjct: 491 DKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDC 550

Query: 460 ASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           +S   L T+ D H   IW+L +  DG  ++T  AD   +FW
Sbjct: 551 SSGECLKTL-DGHANRIWALCVLRDGDMIITADADGVFQFW 590

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 79/358 (22%), Positives = 146/358 (40%), Gaps = 81/358 (22%)

Query: 387 LQGQRTDVRSIDI---SDDNKLLATASNGSLKIWN------VKTHKCIRTFE-------C 430
           LQ   + VR ID    S D+ ++   + G   I N      +K  K IRTF        C
Sbjct: 130 LQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEAC 189

Query: 431 GYALS-----CKFLPGGLLVILGTRTGELQLFDLASSSLLD-TVEDAHDAAIWSLDLTSD 484
           G+  S     C +  GG  V         Q+  L++ S++  T +   +  I  +    +
Sbjct: 190 GFIKSTEDDNCIYTAGGDAV--------FQILSLSNGSVIKKTKKPTEELFIIGVLPIKN 241

Query: 485 GKRLVTGSADKTVKFWD----FQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540
             +L    +D+T++  D    F+ ++ ++      +   +  NH T  ++        + 
Sbjct: 242 FTKLYLVLSDQTLQLIDLIDTFEEDSEII-----TIKSSIAGNHGTIADMR------LVG 290

Query: 541 PDDRYLAISLLDNTVKVFFL------DSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSA 593
           P+ + +A++    T+++  +      +++   + LY GH+  + S+D + D   I T+S 
Sbjct: 291 PELKSIALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLLNSLDATEDGLWIATASK 350

Query: 594 DKNIKIWGLDFGDC------HKSLFAHQDSIMSVKFLPESHN------FFSCSKDAVVKY 641
           D    +W   F D       +     H  S+ SV  LP   N        + S D  VK 
Sbjct: 351 DNTAMLWR--FNDSENKFKKYAQFIGHASSVTSVS-LPNVINNGWPEFIITSSNDFTVKK 407

Query: 642 W----------DGEKFECIQ----KLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           W          + +    I+       AH+ ++ AL+IA N S   ++S+D + +IW+
Sbjct: 408 WKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWD 465

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 52/258 (20%), Positives = 102/258 (39%), Gaps = 70/258 (27%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREATSPAPLKTHTIEL-----QGQRTDVRSIDISDDNKL 405
           E ++T+SN+ T++ + +P   +++ +   +  H I++     +    D+ ++ I+ ++ +
Sbjct: 394 EFIITSSNDFTVKKWKVPSPTKKSDNDDDM--HLIKVSEYTRRAHEKDINALSIAPNDSI 451

Query: 406 LATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLL 465
            ATAS                     Y  +CK                  ++DL S  L+
Sbjct: 452 FATAS---------------------YDKTCK------------------IWDLDSGELM 472

Query: 466 DTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVENTLVPGTKDKLLPMLKL 522
            T+ + H   +W +      K + T S DKT+K W    F+V NTL   T          
Sbjct: 473 ATLAN-HKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHT---------- 521

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS 582
                    + +         + +  +  D  +K++   S +   +L GH   + ++ + 
Sbjct: 522 ---------NAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVL 572

Query: 583 FDSKMIITSSADKNIKIW 600
            D  MIIT+ AD   + W
Sbjct: 573 RDGDMIITADADGVFQFW 590

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 11/87 (12%)

Query: 157 YKLRSHKDCITGIWCQGED----WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
           + L+ H   I+ +   GE     WL+++    M+K+WDL  ++CI T   H+     +  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 213 KDDL-------LITTGTDSQVKIWKLN 232
           K          L+T G D+ +  W ++
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHWTIS 169

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 7/123 (5%)

Query: 36  SGPGQLITSALENVNIWDIKTGDLLATLS-DGLPPGASDARGSKPAECTYLEVHEDTDLL 94
           +G G L+T+ +EN +  D   G  ++ L  +     +    G+  +   +    ED+  L
Sbjct: 49  AGNGTLLTT-VENDDEQDXXXGGPVSVLDIENYITHSLKGHGATISSLKFYGESEDSVWL 107

Query: 95  AVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT-----RLISGSRDSNIIVWD 149
                  ++KVWDL+ +  +     H +A+  + F  + T      L++G RD+ I  W 
Sbjct: 108 LASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWT 167

Query: 150 LVG 152
           + G
Sbjct: 168 ISG 170

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQF--DSTGTRLISGSRDSNII-VWDLVGEVGLY 157
           G + V D+    +  +  GH A I+ L+F  +S  +  +  S D+N++ VWDLV    ++
Sbjct: 70  GPVSVLDI-ENYITHSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIH 128

Query: 158 KLRSHKDCITGIWCQGED------WLISTSKDGMIKLW---DLKTQQCIETHIAH--TGE 206
            L+ H   + GI  +          L++  +D +I  W    LK  + I T   H     
Sbjct: 129 TLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEA 188

Query: 207 CWSL-SVKDDLLI-TTGTDSQVKIWKLN-----MENDKMGEKLTEVGVF 248
           C  + S +DD  I T G D+  +I  L+      +  K  E+L  +GV 
Sbjct: 189 CGFIKSTEDDNCIYTAGGDAVFQILSLSNGSVIKKTKKPTEELFIIGVL 237

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 8/83 (9%)

Query: 610 SLFAHQDSIMSVKFLPESHN---FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIA 666
           SL  H  +I S+KF  ES +     +     +VK WD  K +CI  L  H S V  +   
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFK 143

Query: 667 SNGS-----FVVSSSHDHSIRIW 684
            + +      +V+   D+ I  W
Sbjct: 144 QSSTDSDIIHLVTGGRDNIINHW 166

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 129/283 (45%), Gaps = 50/283 (17%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+ +  ++  ++  H+  I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQ-GHEQDIYSLDYFPSGDKLVSG 503

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 650 IQKLYAHQSEVWALAIASNGS-------FVVSSSHDHSIRIWE 685
           +  L  H++ V ++A+A NGS          + S D   RIW+
Sbjct: 665 LLMLQGHRNSVISVAVA-NGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +       E+
Sbjct: 514 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGEKLTEVGVFE 249
              H    +S+   +D   + +G+ D  VK+W L   N+K   K    G  E
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 91/214 (42%), Gaps = 48/214 (22%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+   A       P +  Y+         A G  D  ++VW
Sbjct: 509 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDRAVRVW 554

Query: 107 DLMSKTVLL---------NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL------- 150
           D  S+T  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 555 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKS 612

Query: 151 ---VGEVGLYKLR--SHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHT 204
                  G  ++    HKD +  +   Q +++++S SKD  +  WD K+   +     H 
Sbjct: 613 DSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHR 672

Query: 205 GECWSLSVKD--------DLLITTGTDSQVKIWK 230
               S++V +        ++  T   D + +IWK
Sbjct: 673 NSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L              +G ++ + S D ++R+W+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 82/217 (37%), Gaps = 40/217 (18%)

Query: 39  GQLITSALEN--VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ + +  E+  + IWDI+   ++  L                 +   L+     D L  
Sbjct: 455 GKFLATGAEDRLIRIWDIENRKIVMILQ------------GHEQDIYSLDYFPSGDKLVS 502

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD   E G 
Sbjct: 503 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGF 560

Query: 157 YKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDLKTQQ----------- 195
              R          HKD + + ++ +    ++S S D  +KLW+L+              
Sbjct: 561 LVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 196 -CIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIW 229
            C  T+I H     S++    D+ +++   D  V  W
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFW 657

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 125/281 (44%), Gaps = 43/281 (15%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+A   ++  V   H+  I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIV-MVLQGHEQDIYSLDYFPSGDKLVSG 522

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 566 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLR 625

Query: 604 -----------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQK 652
                       G C  +   H+D ++SV          S SKD  V +WD +    +  
Sbjct: 626 GDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLM 685

Query: 653 LYAHQSEVWALAIAS------NGSFVVSSSHDHSIRIWEET 687
           L  H++ V ++A+A+      N     + S D   RIW+ T
Sbjct: 686 LQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWKYT 726

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 14/160 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 473 DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 532

Query: 150 LV-GEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +E        
Sbjct: 533 LRNGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENEL 590

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDK 237
              H    +S+   +D   + +G+ D  VK+W L  +N++
Sbjct: 591 GTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQ 630

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 90/211 (42%), Gaps = 43/211 (20%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++ G    TLS  DG+               T      D   +A G  D  ++VW
Sbjct: 528 VRIWDLRNGQCSLTLSIEDGV--------------TTVAVSPGDGKYIAAGSLDRAVRVW 573

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE------ 153
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L G+      
Sbjct: 574 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVK 633

Query: 154 ---VGLYKLR--SHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
               G  ++    HKD +  +   Q +++++S SKD  +  WD K+   +     H    
Sbjct: 634 PNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 693

Query: 208 WSLSVKDDL-------LITTGT-DSQVKIWK 230
            S++V +         +  TG+ D + +IWK
Sbjct: 694 ISVAVANGFPLGPNVGVFATGSGDCKARIWK 724

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 129/276 (46%), Gaps = 41/276 (14%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++DL +  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD      L  GT              TL + D + +V +SP + +++A   
Sbjct: 467 SGDRTVRIWD------LTTGT-----------CSLTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD TV+V      F ++ +     L  GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 604 -------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                    +C  +   H+D ++SV          S SKD  V +WD +    +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 657 QSEVWALAIASN-------GSFVVSSSHDHSIRIWE 685
           ++ V ++ +A+        G F   S  D   RIW+
Sbjct: 630 RNSVISVTVANGHPLGPEYGVFATGSG-DCKARIWK 664

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 125/270 (46%), Gaps = 36/270 (13%)

Query: 394 VRSIDISDDNKLLATASNGSL-KIWNVKTHKCIRTFECGYA---LSCKFLPGGLLVILGT 449
           +RS+  S D K LAT +   L +IW+++T K + T + G+     S  + P G  ++ G+
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSGS 467

Query: 450 RTGELQLFDL--ASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT 507
               ++++DL   + SL  ++ED       S     +GK +  GS D+TV+ WD      
Sbjct: 468 GDRTVRIWDLTTGTCSLTLSIEDGVTTVAVS---PGEGKFIAAGSLDRTVRVWD------ 518

Query: 508 LVPGTKDKLLPMLKLNHDTTLELN--DDILSVRISPDDRYLAISLLDNTVKVFFLDSM-- 563
                 D    + +L+ +  L     D + SV  + D + +    LD +VK++ L+ +  
Sbjct: 519 -----SDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSG 573

Query: 564 -----KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 618
                +  ++  GHK  VLS+  + + + I++ S D+ +  W    G+    L  H++S+
Sbjct: 574 QKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSV 633

Query: 619 MSVKFL------PESHNFFSCSKDAVVKYW 642
           +SV         PE   F + S D   + W
Sbjct: 634 ISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 70/153 (45%), Gaps = 10/153 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WDL +K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 150 LVGEVGLYKLRSHKDCITGIWCQGEDWLIST-SKDGMIKLWDLKTQQCIET-------HI 201
           L        L       T     GE   I+  S D  +++WD  T   +E          
Sbjct: 477 LTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT 536

Query: 202 AHTGECWSLS-VKDDLLITTGT-DSQVKIWKLN 232
            H    +S+   +D   + +G+ D  VK+W LN
Sbjct: 537 GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 104/231 (45%), Gaps = 24/231 (10%)

Query: 385 IELQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFL-PG- 441
           + L+G   D+ S+D     NKL++ + + +++IW++ T  C  T      ++   + PG 
Sbjct: 442 MTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGE 501

Query: 442 GLLVILGTRTGELQLFDLASSSLLDTVED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+    ++++D  +  L++ ++        H  +++S+  T DGK +V+GS D+
Sbjct: 502 GKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDR 561

Query: 496 TVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTV 555
           +VK W+    N L          +    H       D +LSV  + +D Y+     D  V
Sbjct: 562 SVKLWNL---NGLSGQKSHAECEVTYTGH------KDFVLSVATTQNDEYILSGSKDRGV 612

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
             +   S    L L GH+  V+S+ ++    +        T S D   +IW
Sbjct: 613 LFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 100/241 (41%), Gaps = 53/241 (21%)

Query: 25  WLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLS--DGLPPGASDARGSKPAEC 82
           + P  ++   GSG           V IWD+ TG    TLS  DG+   A       P E 
Sbjct: 456 YFPSGNKLVSGSGD--------RTVRIWDLTTGTCSLTLSIEDGVTTVAV-----SPGEG 502

Query: 83  TYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDSTGTR 135
            ++         A G  D  ++VWD  +  ++   +       GH+ ++  + F   G  
Sbjct: 503 KFI---------AAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKG 553

Query: 136 LISGSRDSNIIVWDLVGEVGLYKLRSHKDC-----------ITGIWCQGEDWLISTSKDG 184
           ++SGS D ++ +W+L G   L   +SH +C           ++    Q +++++S SKD 
Sbjct: 554 VVSGSLDRSVKLWNLNG---LSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDR 610

Query: 185 MIKLWDLKTQQCIETHIAHTGECWSLSVKD--------DLLITTGTDSQVKIWKLNMEND 236
            +  WD K+   +     H     S++V +         +  T   D + +IWK + +N 
Sbjct: 611 GVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYSKKNS 670

Query: 237 K 237
           +
Sbjct: 671 Q 671

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + DK I+IW L+      +L  H+  I S+ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD     C   L               G F+ + S D ++R+W+
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD 518

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 41/70 (58%)

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSH 677
           I SV F P+     + ++D +++ WD E  + +  L  H+ ++++L    +G+ +VS S 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 678 DHSIRIWEET 687
           D ++RIW+ T
Sbjct: 469 DRTVRIWDLT 478

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 114/235 (48%), Gaps = 5/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D T+K W         PG +     ++K++  T    + DI ++ ISP+D   A
Sbjct: 469 IITASNDLTIKKWTVPK-----PGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T KV+ +DS +   +L  HK  +  +      K++ T S DK +K+W LD    
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSV 583

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
            K+L  H +++    F+ ++    S   D ++K WD    EC++ L AH++ +WAL++  
Sbjct: 584 VKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLH 643

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G   V++  D   + W++  ++             + + +L   + +G+  +AF
Sbjct: 644 DGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQNYMSQGDWTNAF 698

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 105/232 (45%), Gaps = 25/232 (10%)

Query: 466 DTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHD 525
           D    AHD  I +L ++ +     T S DKT K WD  V++  + GT          NH 
Sbjct: 500 DYTRRAHDKDINALSISPNDSTFATASYDKTCKVWD--VDSGELQGT--------LANHK 549

Query: 526 TTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
             L        V     D+ LA    D TVKV+ LD++    +L GH   V        +
Sbjct: 550 RGL------WDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKN 603

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW-DG 644
           K ++++ AD  IK+W L  G+C ++L AH++ I ++  L +   F +   D V ++W D 
Sbjct: 604 KQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDC 663

Query: 645 EKFECIQKLYAHQSEVWALAIASN--------GSFVVSSSHDHSIRIWEETE 688
            + +  + L  H+ +V       N         +F+++ + DH +R++   E
Sbjct: 664 SEEQEKENLENHKRKVEQDQSLQNYMSQGDWTNAFLLAMTLDHPMRLYRVLE 715

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 87/216 (40%), Gaps = 9/216 (4%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L +  +    A    D   KVWD+ S  +      HK  +  + F     
Sbjct: 503 RRAHDKDINALSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDK 562

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + VW L     +  L  H + +    +      L+ST  DG+IKLWDL T
Sbjct: 563 LLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLST 622

Query: 194 QQCIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIWK-LNMENDKMGEKLTEVGVFEK 250
            +C+ T  AH    W+LSV    D  +T   D   + WK  + E +K   +  +  V + 
Sbjct: 623 GECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQD 682

Query: 251 QSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRI 286
           QS Q  +     TNA     F      D  +  +R+
Sbjct: 683 QSLQNYMSQGDWTNA-----FLLAMTLDHPMRLYRV 713

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 79/195 (40%), Gaps = 47/195 (24%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS 410
           E ++T SN+ TI+ +++P    E   P  +K      +    D+ ++ IS ++   ATAS
Sbjct: 467 EFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATAS 526

Query: 411 -------------------------------------------NGSLKIWNVKTHKCIRT 427
                                                      + ++K+W++ T   ++T
Sbjct: 527 YDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKT 586

Query: 428 FE--CGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDG 485
            E        C F+     ++     G ++L+DL++   + T+ DAH+  IW+L +  DG
Sbjct: 587 LEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTL-DAHENRIWALSVLHDG 645

Query: 486 KRLVTGSADKTVKFW 500
              VT  AD   +FW
Sbjct: 646 DEFVTADADGVFQFW 660

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 80/184 (43%), Gaps = 34/184 (18%)

Query: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DSTGTRLISGSRDSNIIVW 148
           L+A+G  DG + V D+ +  V  +  GH A I+ ++F    +ST  RL SG  +  + VW
Sbjct: 115 LVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVW 174

Query: 149 DLVGEVGLYKLRSHKDCITGIWCQGEDW------LISTSKDGMIKLWDLKT--------- 193
           DLV    L+ ++ H   + G+  +  D       L+S  +D ++ L+ L +         
Sbjct: 175 DLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLVKT 234

Query: 194 ----QQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNM-----ENDKMGEKLTE 244
               QQ       H GE        DL  T G D+  +I  L       + +K  E+L  
Sbjct: 235 IPVHQQIEACGFIHDGE------HQDLFYTAGGDAVYQILSLATASVIKKTNKPIEELFI 288

Query: 245 VGVF 248
           +GV 
Sbjct: 289 IGVL 292

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 77/181 (42%), Gaps = 11/181 (6%)

Query: 515 KLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
           +L P  ++ H    +   +I +++++PD  YL        ++++ L S +   S+     
Sbjct: 44  ELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS- 102

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----F 630
           PV  ID    S ++     D ++ +  ++ G    SL  H  +I SVKF  E ++     
Sbjct: 103 PVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRL 162

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQ 690
            S   + VVK WD  +  C+  +  H + V  L       F VS + D  + +     D 
Sbjct: 163 GSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGL------DFRVSDADDDVLELLSGGRDD 216

Query: 691 V 691
           +
Sbjct: 217 I 217

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 15/141 (10%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           +WD+ +G+L  TL       A+  RG    + C Y        LLA    D  +KVW L 
Sbjct: 533 VWDVDSGELQGTL-------ANHKRGLWDVSFCQY------DKLLATCSGDKTVKVWSLD 579

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           + +V+    GH  A+    F +   +L+S   D  I +WDL     +  L +H++ I  +
Sbjct: 580 TLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWAL 639

Query: 170 WC-QGEDWLISTSKDGMIKLW 189
                 D  ++   DG+ + W
Sbjct: 640 SVLHDGDEFVTADADGVFQFW 660

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 86  EVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-----DSTGTRLISGS 140
           E++  T  L  G  +GV+KVWDL+ ++ L     H AA+  L F     D     L+SG 
Sbjct: 154 ELNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGG 213

Query: 141 RDSNIIVWDL 150
           RD  + ++ L
Sbjct: 214 RDDIVNLYQL 223

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 109/235 (46%), Gaps = 4/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLA 547
           ++T S D T+K W        V   + + L ++K +  T      DI ++ ISP+D   A
Sbjct: 456 IITASNDLTIKKWKVPK----VTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFA 511

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ LD  +F  +L  HK  +  +      K++ T S DK IKIW L+    
Sbjct: 512 TASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAV 571

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS 667
            K+L  H +++    F+ ++    S   D +V  WD    E ++ L AH + +WALA+ +
Sbjct: 572 VKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMN 631

Query: 668 NGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +G   V++  D     W +  ++             + E +L   L EG+  +AF
Sbjct: 632 DGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAF 686

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 76/189 (40%), Gaps = 14/189 (7%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   + +  +  L A    D   K+W+L           HK  +  + F     
Sbjct: 491 RRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDK 550

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  I +W L     +  L  H + +    +      LIST  DG++ +WDL T
Sbjct: 551 LLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLST 610

Query: 194 QQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQ 251
            + ++T  AH    W+L+V +D    +T   D   + W+ N E +            E+ 
Sbjct: 611 GESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEH-----------ERN 659

Query: 252 SKQRGLKVE 260
            +Q  LK+E
Sbjct: 660 LEQEKLKIE 668

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 94/223 (42%), Gaps = 25/223 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
           AH+  I ++ ++ +     T S DKT K W+            D        NH   L  
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLD----------DGEFQATLANHKRGL-- 540

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                 V     D+ LA    D T+K++ L+S     +L GH   V        +K +I+
Sbjct: 541 ----WDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLIS 596

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW------DG 644
           + AD  + IW L  G+  K+L AH + I ++  + +  +F +   D   ++W      + 
Sbjct: 597 TGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEH 656

Query: 645 EKFECIQKLYAHQSEVWALAIAS---NGSFVVSSSHDHSIRIW 684
           E+    +KL   Q +     ++      +F+++ + DH +R++
Sbjct: 657 ERNLEQEKLKIEQEQSLQNYLSEGDWTNAFLLAMTLDHPMRLY 699

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%), Gaps = 4/101 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALSCKFLPGGLLVILGTRTGELQLFDL 459
           +KLLAT S + ++KIW+++++  ++T E        C F+     +I     G + ++DL
Sbjct: 549 DKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDL 608

Query: 460 ASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ DAH+  IW+L + +DG+  VT  AD   +FW
Sbjct: 609 STGESVKTL-DAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 61/142 (42%), Gaps = 17/142 (11%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGS-KPAECTYLEVHEDTDLLAVGYADGVIKVWDLM 109
           IW++  G+  ATL       A+  RG    A C Y        LLA    D  IK+W L 
Sbjct: 521 IWNLDDGEFQATL-------ANHKRGLWDVAFCQY------DKLLATCSGDKTIKIWSLE 567

Query: 110 SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI--T 167
           S  V+    GH  A+    F +   +LIS   D  +I+WDL     +  L +H + I   
Sbjct: 568 SYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWAL 627

Query: 168 GIWCQGEDWLISTSKDGMIKLW 189
            +   GE + ++   DG  + W
Sbjct: 628 AVMNDGESF-VTADADGFFEFW 648

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF----DSTGTRLISGSRDSNIIVW 148
           LLA+G  DG + V D+ +  V  +  GH A I+ ++F    +S   +L SG  +  I VW
Sbjct: 115 LLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVW 174

Query: 149 DLVGEVGLYKLRSHKDCITGIWCQGED------WLISTSKDGMIKLWDLKTQQ 195
           DLV       ++ H   + G+  +  D       L+S  +D ++ L++  + +
Sbjct: 175 DLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFEFNSTK 227

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 60/144 (41%), Gaps = 5/144 (3%)

Query: 524 HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
           H    E   DI ++ ++PD  YL        ++V+ L   +   S+     PV  ++   
Sbjct: 53  HSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PVYVMNCDQ 111

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVV 639
            S ++     D ++ +  ++ G    SL  H  +I SVKF  E ++      S   + ++
Sbjct: 112 TSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMI 171

Query: 640 KYWDGEKFECIQKLYAHQSEVWAL 663
           K WD  K  C   +  H + V  L
Sbjct: 172 KVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 72/164 (43%), Gaps = 13/164 (7%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           + T L +  D   L       +++V+ L  + ++ +     + + ++  D T T L  G 
Sbjct: 62  DITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGG 120

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE----DW-LISTSKDGMIKLWDLKTQQ 195
            D ++ V D+      + L+ H   I+ +   GE     W L S   +GMIK+WDL  + 
Sbjct: 121 TDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRN 180

Query: 196 CIETHIAHTGECWSL--SVKDD-----LLITTGTDSQVKIWKLN 232
           C  T   HT     L   V D+      L++ G D+ + +++ N
Sbjct: 181 CQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFEFN 224

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 23/136 (16%)

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV---K 622
           GH   + S+D + D   + T+S D ++ +W       DF    K    H  S+ +V    
Sbjct: 388 GHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTK-FVGHVGSVNAVGLPN 446

Query: 623 FLPESHNFF--SCSKDAVVKYWDGEKFECIQK------------LYAHQSEVWALAIASN 668
            +P S   F  + S D  +K W   K    +               AH+ ++ A++I+ N
Sbjct: 447 VMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPN 506

Query: 669 GSFVVSSSHDHSIRIW 684
            S   ++S+D + +IW
Sbjct: 507 DSLFATASYDKTCKIW 522

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 128/283 (45%), Gaps = 50/283 (17%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+ +  ++  ++  H+  I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQ-GHEQDIYSLDYFPSGDKLVSG 503

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD      
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNP 664

Query: 650 IQKLYAHQSEVWALAIASNGS-------FVVSSSHDHSIRIWE 685
           +  L  H++ V ++A+A NGS          + S D   RIW+
Sbjct: 665 LLMLQGHRNSVISVAVA-NGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +       E+
Sbjct: 514 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGEKLTEVGVFE 249
              H    +S+   +D   + +G+ D  VK+W L   N+K   K    G  E
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L              +G ++ + S D ++R+W+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 90/214 (42%), Gaps = 48/214 (22%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+   A       P +  Y+         A G  D  ++VW
Sbjct: 509 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDRAVRVW 554

Query: 107 DLMSKTVLL---------NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL------- 150
           D  S+T  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 555 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKS 612

Query: 151 ---VGEVGLYKLR--SHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHT 204
                  G  ++    HKD +  +   Q +++++S SKD  +  WD  +   +     H 
Sbjct: 613 DSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHR 672

Query: 205 GECWSLSVKD--------DLLITTGTDSQVKIWK 230
               S++V +        ++  T   D + +IWK
Sbjct: 673 NSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 85/217 (39%), Gaps = 40/217 (18%)

Query: 39  GQLITSALEN--VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ + +  E+  + IWDI+   ++  L           +G +  +   L+     D L  
Sbjct: 455 GKFLATGAEDRLIRIWDIENRKIVMIL-----------QGHE-QDIYSLDYFPSGDKLVS 502

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD   E G 
Sbjct: 503 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGF 560

Query: 157 YKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDLKTQQ----------- 195
              R          HKD + + ++ +    ++S S D  +KLW+L+              
Sbjct: 561 LVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 620

Query: 196 -CIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIW 229
            C  T+I H     S++    D+ +++   D  V  W
Sbjct: 621 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFW 657

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 126/284 (44%), Gaps = 46/284 (16%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+A   ++  V   H+  I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIV-MVLQGHEQDIYSLDYFPSGDKLVSG 435

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +++A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 479 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                        G C  +   H+D ++SV          S SKD  V +WD +    + 
Sbjct: 539 GDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLL 598

Query: 652 KLYAHQSEVWALAIASN-------GSFVVSSSHDHSIRIWEETE 688
            L  H++ V ++A+A+        G F   S  D   RIW+ T+
Sbjct: 599 MLQGHRNSVISVAVANGFPLGPQYGVFATGSG-DCKARIWKYTK 641

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 102/230 (44%), Gaps = 37/230 (16%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLP-----PGASDARGSKP---------AECTYLE 86
           L T   +   ++ +  G L+A LSD        P  S A   +P         A+    +
Sbjct: 316 LATGCNKTTQVFRVSDGALIARLSDDAASQVAAPAGSPANADEPNNDVNSFVTAKSASSD 375

Query: 87  VH-------EDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISG 139
           ++        D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SG
Sbjct: 376 LYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSG 435

Query: 140 SRDSNIIVWDL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQC 196
           S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   
Sbjct: 436 SGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFL 493

Query: 197 IET-------HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDK 237
           +E           H    +S+   +D   + +G+ D  VK+W  N+  DK
Sbjct: 494 VERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW--NLRGDK 541

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 97/229 (42%), Gaps = 46/229 (20%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+               T      D   +A G  D  ++VW
Sbjct: 441 VRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPGDGKFIAAGSLDRAVRVW 486

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE------ 153
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L G+      
Sbjct: 487 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSS 546

Query: 154 ----VGLYKL--RSHKDCITGIW-CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
                G  ++    HKD +  +   Q + +++S SKD  +  WD ++   +     H   
Sbjct: 547 GKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNS 606

Query: 207 CWSLSVKDDL-------LITTGT-DSQVKIWKLNMENDKM--GEKLTEV 245
             S++V +         +  TG+ D + +IWK    +  +  G K+ EV
Sbjct: 607 VISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSGSKIKEV 655

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 83/214 (38%), Gaps = 26/214 (12%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT +   F+V +  +                    L+
Sbjct: 300 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGAL-----------------IARLS 339

Query: 532 DDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
           DD  S   +P          +N V  F + +      LY     + S+  S D K + T 
Sbjct: 340 DDAASQVAAPAGSPANADEPNNDVNSF-VTAKSASSDLY-----IRSVCFSPDGKFLATG 393

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           + D+ I+IW +        L  H+  I S+ + P      S S D  V+ WD    +C  
Sbjct: 394 AEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL 453

Query: 652 KLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            L              +G F+ + S D ++R+W+
Sbjct: 454 TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD 487

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 127/283 (44%), Gaps = 50/283 (17%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+    ++  ++  H+  I+SLD    G +LV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQ-GHEQDIYSLDYFPSGDKLVSG 499

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 650 IQKLYAHQSEVWALAIASNGS-------FVVSSSHDHSIRIWE 685
           +  L  H++ V ++A+A NGS          + S D   RIW+
Sbjct: 661 LLMLQGHRNSVISVAVA-NGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 83/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+  + +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 450 DGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 509

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +       E+
Sbjct: 510 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 567

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGEKLTEVGVFE 249
              H    +S+   +D   + +G+ D  VK+W L   N+K   K    G  E
Sbjct: 568 GTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCE 619

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 123/278 (44%), Gaps = 37/278 (13%)

Query: 394 VRSIDISDDNKLLATASNGSL-KIWNVKTHKCIRTFECGYA---LSCKFLPGGLLVILGT 449
           +RS+  S D K LAT +   L +IW+++  K +   + G+     S  + P G  ++ G+
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQ-GHEQDIYSLDYFPSGDKLVSGS 500

Query: 450 RTGELQLFDLASS--SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT 507
               ++++DL +   SL  ++ED       S     DGK +  GS D+ V+ WD +    
Sbjct: 501 GDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRAVRVWDSET--- 554

Query: 508 LVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL------- 560
                   L+  L   +++     D + SV  + D   +    LD +VK++ L       
Sbjct: 555 ------GFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKS 608

Query: 561 -----DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
                +S    ++  GHK  VLS+  + + + I++ S D+ +  W    G+    L  H+
Sbjct: 609 DSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHR 668

Query: 616 DSIMSVKFL------PESHNFFSCSKDAVVKYWDGEKF 647
           +S++SV         PE + F + S D   + W  +K 
Sbjct: 669 NSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKI 706

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 91/214 (42%), Gaps = 48/214 (22%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+   A       P +  Y+         A G  D  ++VW
Sbjct: 505 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDRAVRVW 550

Query: 107 DLMSKTVLL---------NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL------- 150
           D  S+T  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 551 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKS 608

Query: 151 ---VGEVGLYKLR--SHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHT 204
                  G  ++    HKD +  +   Q +++++S SKD  +  WD K+   +     H 
Sbjct: 609 DSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHR 668

Query: 205 GECWSLSVKD--------DLLITTGTDSQVKIWK 230
               S++V +        ++  T   D + +IWK
Sbjct: 669 NSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L              +G ++ + S D ++R+W+
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 551

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 64/162 (39%), Gaps = 26/162 (16%)

Query: 92  DLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLV 151
           D L  G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD  
Sbjct: 494 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD-- 551

Query: 152 GEVGLYKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDLKTQQ------ 195
            E G    R          HKD + + ++ +    ++S S D  +KLW+L+         
Sbjct: 552 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSK 611

Query: 196 ------CIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIW 229
                 C  T+I H     S++    D+ +++   D  V  W
Sbjct: 612 APNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFW 653

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 122/261 (46%), Gaps = 43/261 (16%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+ +  ++  ++  H+  I+SLD    G +LV+G
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQ-GHEQDIYSLDYFPSGDKLVSG 507

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +Y+A   
Sbjct: 508 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 550

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 551 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 650 IQKLYAHQSEVWALAIASNGS 670
           +  L  H++ V ++A+A NGS
Sbjct: 669 LLMLQGHRNSVISVAVA-NGS 688

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 81/159 (50%), Gaps = 9/159 (5%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           I SV  SPD ++LA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKFECIQK 652
           D+ ++IW L  G C  +L + +D + +V   P    + +  S D  V+ WD E    +++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 653 L-------YAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
           L         H+  V+++    +G  VVS S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 458 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 517

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +       E+
Sbjct: 518 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 575

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGEKLTEVGVFE 249
              H    +S+   +D   + +G+ D  VK+W L   N+K   K    G  E
Sbjct: 576 GTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 627

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 102/210 (48%), Gaps = 13/210 (6%)

Query: 387 LQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFL-PG-GL 443
           LQG   D+ S+D     +KL++ + + +++IW+++T +C  T      ++   + PG G 
Sbjct: 485 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 544

Query: 444 LVILGTRTGELQLFDLASSSLLDTVED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D++V
Sbjct: 545 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSV 604

Query: 498 KFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+ Q  N       D   P       T +   D +LSV  + +D Y+     D  V  
Sbjct: 605 KLWNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 660

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           +   S    L L GH+  V+S+ ++  S +
Sbjct: 661 WDKKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L              +G ++ + S D ++R+W+
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 82/190 (43%), Gaps = 40/190 (21%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+   A       P +  Y+         A G  D  ++VW
Sbjct: 513 VRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKYI---------AAGSLDRAVRVW 558

Query: 107 DLMSKTVLL---------NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL------- 150
           D  S+T  L         +  GHK ++  + F   G  ++SGS D ++ +W+L       
Sbjct: 559 D--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKS 616

Query: 151 ---VGEVGLYKLR--SHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHT 204
                  G  ++    HKD +  +   Q +++++S SKD  +  WD K+   +     H 
Sbjct: 617 DSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHR 676

Query: 205 GECWSLSVKD 214
               S++V +
Sbjct: 677 NSVISVAVAN 686

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 86/217 (39%), Gaps = 40/217 (18%)

Query: 39  GQLITSALEN--VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ + +  E+  + IWDI+   ++  L           +G +  +   L+     D L  
Sbjct: 459 GKFLATGAEDRLIRIWDIENRKIVMIL-----------QGHE-QDIYSLDYFPSGDKLVS 506

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD   E G 
Sbjct: 507 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGF 564

Query: 157 YKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDLKTQQ----------- 195
              R          HKD + + ++ +  + ++S S D  +KLW+L+              
Sbjct: 565 LVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSG 624

Query: 196 -CIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIW 229
            C  T+I H     S++    D+ +++   D  V  W
Sbjct: 625 TCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFW 661

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 138/316 (43%), Gaps = 48/316 (15%)

Query: 399 ISDDNKLLATASNGSLKIWNVKTHKCIRTFECG--YALSCKFLPGGLLVILGTRTGELQL 456
           +S+D     + ++ S    N K    + T      Y  S  F P G  +  G     +++
Sbjct: 437 LSEDASSAPSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRI 496

Query: 457 FDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKL 516
           +DLA+  ++ T++  H+  I+SLD    G +LV+GS D+TV+ WD +     +       
Sbjct: 497 WDLATRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL------- 548

Query: 517 LPMLKLNHDTTLELNDDILSVRISP-DDRYLAISLLDNTVKV------FFLDSMKFYLSL 569
                     TL + D + +V +SP D + +A   LD TV++      F ++ +     L
Sbjct: 549 ----------TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENEL 598

Query: 570 -YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL------------DFGDCHKSLFAHQD 616
             GHK  V S+  + D   +++ S D+++K+W L            +      +   H+D
Sbjct: 599 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKD 658

Query: 617 SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASN-------G 669
            ++SV          S SKD  V +WD      +  L  H++ V ++A+A++       G
Sbjct: 659 FVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYG 718

Query: 670 SFVVSSSHDHSIRIWE 685
            F   S  D   RIW+
Sbjct: 719 VFATGSG-DCKARIWK 733

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 106/229 (46%), Gaps = 31/229 (13%)

Query: 41  LITSALENVNIWDIKTGDLLATLSD---GLPPGA-----SDARGSKPAECT------YLE 86
           L T   +   ++ + TG+L+A LS+     P GA     S+   + PA  T      Y+ 
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 87  ---VHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDS 143
                 D   LA G  D +I++WDL ++ +++   GH+  I  L +  +G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 144 NIIVWDL-VGEVGLYKLRSHKDCITGIWCQ-GEDWLIST-SKDGMIKLWDLKTQQCIET- 199
            + +WDL  G+  L    S +D +T +    G+  LI+  S D  +++WD +T   +E  
Sbjct: 535 TVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 200 ------HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGE 240
                    H    +S+   +D   + +G+ D  VK+W L   N    E
Sbjct: 593 DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAE 641

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 92/227 (40%), Gaps = 44/227 (19%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+               T      D  L+A G  D  +++W
Sbjct: 536 VRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPGDGKLIAAGSLDRTVRIW 581

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL--- 156
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L    G    
Sbjct: 582 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAE 641

Query: 157 ---------YKLRSHKDCITGIW-CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
                         HKD +  +   Q +++++S SKD  +  WD  +   +     H   
Sbjct: 642 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNS 701

Query: 207 CWSLSVKDD--------LLITTGTDSQVKIWKLNMENDKMGEKLTEV 245
             S++V +D        +  T   D + +IWK + +      KL EV
Sbjct: 702 VISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTSNAEPKLREV 748

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 69/180 (38%), Gaps = 28/180 (15%)

Query: 37  GPGQLITSAL--ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-EDTDL 93
           G G+LI +      V IWD +TG L+  L       + +  G+   +  Y  V   D   
Sbjct: 564 GDGKLIAAGSLDRTVRIWDSETGFLVERLD------SENELGTGHKDSVYSVVFTRDGHG 617

Query: 94  LAVGYADGVIKVWDLMSK------------TVLLNFNGHKAAITLLQFDSTGTRLISGSR 141
           +  G  D  +K+W+L S                + + GHK  +  +        ++SGS+
Sbjct: 618 VVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSK 677

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWL-------ISTSKDGMIKLWDLKTQ 194
           D  ++ WD      L  L+ H++ +  +    +  L        + S D   ++W    Q
Sbjct: 678 DRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQ 737

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 131/295 (44%), Gaps = 40/295 (13%)

Query: 393 DVRSIDISDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRT 451
           D+ S++ SDD++L A     S +K+W++           G +L    +P         + 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLD----------GSSLISNKIPS-------YKR 526

Query: 452 GELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            E++  D A+S+L+      H  +++S   + D + L++GS DKTV+ W       LV  
Sbjct: 527 KEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALV-- 579

Query: 512 TKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  V+ SP   Y A +  D T +++  D +       G
Sbjct: 580 --------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 625

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V ++    +   + T S+DK  ++W +  GD  +  + H   I+S    P+     
Sbjct: 626 HLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLC 685

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           + S D ++  WD    + I+++  H ++ V +L +   G+ ++S   DHS+R+W+
Sbjct: 686 TGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWD 740

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 74/174 (42%), Gaps = 19/174 (10%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL-------------------SLYG 571
           N D+ S+  S D R  A    D+ +K++ LD                         +L G
Sbjct: 482 NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIG 541

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V S   S DS+ +++ S DK +++W LD      S   H   +  VKF P  H F 
Sbjct: 542 HSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFA 601

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           + S D   + W  +    ++    H S+V  ++   NG +V + S D + R+W+
Sbjct: 602 TASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWD 655

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 65/150 (43%), Gaps = 4/150 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VG 152
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+  G
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTG 659

Query: 153 EVGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WS 209
           +   Y        ++ +      WL + S DG+I LWD+ T + I+    H        +
Sbjct: 660 DSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLT 719

Query: 210 LSVKDDLLITTGTDSQVKIWKLNMENDKMG 239
           L+ + ++L++ G D  V++W L    ++ G
Sbjct: 720 LNKEGNVLLSGGADHSVRVWDLKKATNEPG 749

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 71/151 (47%), Gaps = 5/151 (3%)

Query: 387 LQGQRTDVRSIDISDDNKLLAT-ASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGL 443
             G  +DV ++    +   + T +S+ + ++W++ T   +R F       LS    P G 
Sbjct: 623 FAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGR 682

Query: 444 LVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G+  G + L+D+ +   +  +      A+ SL L  +G  L++G AD +V+ WD +
Sbjct: 683 WLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

Query: 504 VENTLVPGTKDKLLPMLKLNHDTTLELNDDI 534
            + T  PG + +  P +    D T  +N D+
Sbjct: 743 -KATNEPGLEPE-QPFIGHIGDVTASINQDV 771

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 65/174 (37%), Gaps = 22/174 (12%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLN-------------------FNGHK 121
           + T LE  +D+ L A G+ D  IK+W L   +++ N                     GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 122 AAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLIST 180
            ++    F      L+SGS D  + +W L     L   + H   +  + +     +  + 
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLN 232
           S D   +LW       +     H  +  ++S   +   + T  +D   ++W ++
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDIS 657

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 46/108 (42%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVI 103
           S+ +   +WDI TGD +        P  S              V  D   L  G  DG+I
Sbjct: 646 SSDKTCRMWDISTGDSVRYFWVHTAPILSTV------------VTPDGRWLCTGSDDGLI 693

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
            +WD+ +   +    GH K A+  L  +  G  L+SG  D ++ VWDL
Sbjct: 694 NLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F  H A I        G  L +GS D  
Sbjct: 633 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGL 692

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK 192
           I +WD+     + ++R H K+ +  +    E + L+S   D  +++WDLK
Sbjct: 693 INLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/143 (20%), Positives = 52/143 (36%), Gaps = 22/143 (15%)

Query: 109 MSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVG------EVGLYK---- 158
           +    +  F+     +T L+F        +G +DS I +W L G      ++  YK    
Sbjct: 470 LPTVCMYTFHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEM 529

Query: 159 ---------LRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW 208
                    L  H   +    +     +L+S S+D  ++LW L T   + ++  H    W
Sbjct: 530 ETTDPATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVW 589

Query: 209 SL--SVKDDLLITTGTDSQVKIW 229
            +  S       T   D   ++W
Sbjct: 590 DVKFSPLGHYFATASHDQTARLW 612

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 104/238 (43%), Gaps = 10/238 (4%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKL---LPMLKLNHDTTLELNDDILSVRISPDDR 544
           L+T S D TVK W        VP   D+    +  +  +  T      DI  + ISP+D 
Sbjct: 471 LITASNDLTVKKWK-------VPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDS 523

Query: 545 YLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF 604
             A +  D T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW LD 
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 605 GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALA 664
               K+L  H +++    F  +     S   D +VK WD    ECI  L  H + +WAL 
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 665 IASNGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLASLEEGNADDAF 722
           +  +G  V+++  D   + W++  ++             +   TL   +  G+  +AF
Sbjct: 644 VIKDGDIVITADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYISSGDWTNAF 701

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 3/159 (1%)

Query: 75  RGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGT 134
           R +   +   L +  +  + A    D   K+WDL +  +    N HK  +  + F     
Sbjct: 506 RRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDK 565

Query: 135 RLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  + +W L     +  L  H + +    +   +  L+ST  DG++KLWD  T
Sbjct: 566 FIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCST 625

Query: 194 QQCIETHIAHTGECWSLSV-KD-DLLITTGTDSQVKIWK 230
            +CI T   H    W+L+V KD D++IT   D   + WK
Sbjct: 626 GECINTLDGHDNRIWALNVIKDGDIVITADADGVFQFWK 664

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 103/241 (42%), Gaps = 28/241 (11%)

Query: 453 ELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
           +++++ ++SS   +    AH+  I  L ++ +     T S DKT K WD +         
Sbjct: 493 DIEIYSISSS---EYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLET-------- 541

Query: 513 KDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572
             +L   L  NH   L        V     D+++A +  D TVK++ LD+     +L GH
Sbjct: 542 -GELKATLN-NHKRGL------WDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGH 593

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V         K ++++ AD  +K+W    G+C  +L  H + I ++  + +     +
Sbjct: 594 SNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIVIT 653

Query: 633 CSKDAVVKYWDGEKFECI------QKLYAHQSEVWALAIAS---NGSFVVSSSHDHSIRI 683
              D V ++W     E        +KL   Q +     I+S     +F+++ + DH  R+
Sbjct: 654 ADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYISSGDWTNAFLLAITLDHPARL 713

Query: 684 W 684
           +
Sbjct: 714 Y 714

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 403 NKLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALSCKFLPGGLLVILGTRTGELQLFDL 459
           +K +ATAS + ++KIW++ T   ++T E        C F      ++     G ++L+D 
Sbjct: 564 DKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDC 623

Query: 460 ASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
           ++   ++T+ D HD  IW+L++  DG  ++T  AD   +FW  + E
Sbjct: 624 STGECINTL-DGHDNRIWALNVIKDGDIVITADADGVFQFWKDRTE 668

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 60/120 (50%), Gaps = 12/120 (10%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF---DSTGTRLI-SGS 140
           LE    + LLA+G  DG + V D+ +  +  +  GH A I+ L+F     T T L+ SG 
Sbjct: 120 LETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGD 179

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQ------GED--WLISTSKDGMIKLWDLK 192
            +  + +WDLV    ++ L+ H   + GI  +       ED   LI+ ++D +I  W+ K
Sbjct: 180 TNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFK 239

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 84  YLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-------DSTGTRL 136
           Y E H +T LL+ G  +G++K+WDL+S+  +     H +A+  + F            +L
Sbjct: 165 YGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQL 224

Query: 137 ISGSRDSNIIVWDL 150
           I+G+RD  I  W+ 
Sbjct: 225 ITGARDDVINHWEF 238

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 531 NDD---ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I ++ ++PD +YL        +K+F L + K   S+     P   ++    S +
Sbjct: 70  NDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLETDPTSTL 128

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ +  ++ G    SL  H  +I S+KF  E H       S   + +VK WD
Sbjct: 129 LAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWD 188

Query: 644 GEKFECIQKLYAHQSEV 660
               + I  L  H S V
Sbjct: 189 LVSRKAIHTLQEHNSAV 205

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 30/176 (17%)

Query: 539 ISPDDRYLAISLLDNTVKVFFL------DSMKFYLSLY-GHKLPVLSIDISFDSKMIITS 591
           + P+   LA++   +T+++  +      +S+     LY GH   + ++D + D   I T+
Sbjct: 364 VGPNFDKLALATNSSTLRIIPISDVDDSNSVSISTELYEGHTDLLNAVDATEDGLWIATA 423

Query: 592 SADKNIKIWGLDFGD---CHKSLF-AHQDSIMSVKFLPESHN------FFSCSKDAVVKY 641
           S D +  +W  +      C  + F  H  S+ SV  LP   N        + S D  VK 
Sbjct: 424 SKDNSAILWRYNPRTTLFCKYAHFQGHVSSVTSVG-LPNVMNKGWPEYLITASNDLTVKK 482

Query: 642 W---------DGEKFECIQKLY---AHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           W         D E +      Y   AH+ ++  L+I+ N S   ++S+D + +IW+
Sbjct: 483 WKVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWD 538

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 8/63 (12%)

Query: 448 GTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDL-------TSDGKRLVTGSADKTVKFW 500
           G   G ++++DL S   + T+++ H++A+  +D        + D  +L+TG+ D  +  W
Sbjct: 178 GDTNGMVKIWDLVSRKAIHTLQE-HNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHW 236

Query: 501 DFQ 503
           +F+
Sbjct: 237 EFK 239

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 132/288 (45%), Gaps = 47/288 (16%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++DL++  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 438

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP + +++A   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD T++V      F ++ +     L  GHK  V S+  + D + +++ S D+++K+W L 
Sbjct: 482 LDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

Query: 604 -------------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
                           C  +   H+D ++SV          S SKD  V +WD +    +
Sbjct: 542 NTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPL 601

Query: 651 QKLYAHQSEVWALAIASN-------GSFVVSSSHDHSIRIWEETEDQV 691
             L  H++ V ++A+A+        G F   S  D   RIW+ ++++ 
Sbjct: 602 LMLQGHRNSVISVAVANGFPLGPDYGVFATGSG-DCKARIWKYSKNKA 648

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 78/155 (50%), Gaps = 14/155 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WDL +K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 389 DGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 448

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQ-GEDWLIST-SKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T +    GE   I+  S D  +++WD +T   +E        
Sbjct: 449 LRTGQCSL--TLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENEL 506

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLN 232
              H    +S+   +D   + +G+ D  VK+W L+
Sbjct: 507 GTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 88/213 (41%), Gaps = 45/213 (21%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+           P E  ++         A G  D  ++VW
Sbjct: 444 VRIWDLRTGQCSLTLSIEDGV-----TTVAVSPGEGKFI---------AAGSLDRTLRVW 489

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L       K 
Sbjct: 490 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKN 549

Query: 160 RS-------------HKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
            S             HKD +  +   Q + +++S SKD  +  WD ++   +     H  
Sbjct: 550 DSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRN 609

Query: 206 ECWSLSVKDDL-------LITTGT-DSQVKIWK 230
              S++V +         +  TG+ D + +IWK
Sbjct: 610 SVISVAVANGFPLGPDYGVFATGSGDCKARIWK 642

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 69/165 (41%), Gaps = 26/165 (15%)

Query: 39  GQLITSALEN--VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ + +  E+  + IWD+ T  ++ TL           +G +  +   L+     D L  
Sbjct: 390 GKFLATGAEDKLIRIWDLSTKRIVMTL-----------QGHE-QDIYSLDYFPSGDKLVS 437

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD   E G 
Sbjct: 438 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWD--SETGF 495

Query: 157 YKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDL 191
              R          HKD + + ++ +    ++S S D  +KLW+L
Sbjct: 496 LVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 71/176 (40%), Gaps = 29/176 (16%)

Query: 37  GPGQLITSAL--ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-EDTDL 93
           G G+ I +      + +WD +TG L+  L       + +  G+   +  Y  V   D   
Sbjct: 472 GEGKFIAAGSLDRTLRVWDSETGFLVERLD------SENELGTGHKDSVYSVVFTRDGQG 525

Query: 94  LAVGYADGVIKVWDL-------------MSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           +  G  D  +K+W+L              + T  + + GHK  +  +        ++SGS
Sbjct: 526 VVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGS 585

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGI-----WCQGEDWLI--STSKDGMIKLW 189
           +D  ++ WD      L  L+ H++ +  +     +  G D+ +  + S D   ++W
Sbjct: 586 KDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 134/315 (42%), Gaps = 83/315 (26%)

Query: 394 VRSIDISDDNKLLATASNGSL-KIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRTG 452
           +RSI  S D + LAT +   L +IWN+K  K +                  +V+ G    
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIV------------------MVLKG---- 381

Query: 453 ELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
                              H+  I+SLD   DG++LV+GS D++++ WD +     +   
Sbjct: 382 -------------------HEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSL--- 419

Query: 513 KDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISLLDNTVKVFFLDSMKFYL---- 567
                         TL + D + +V +SP++ + +A   LD +V+++  DS   +L    
Sbjct: 420 --------------TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW--DSSTGFLVERL 463

Query: 568 -----SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD-----FGDCHKSLFAHQDS 617
                S  GH+  V S+  + D + +++ S D+ +K+W L       G C  +   H+D 
Sbjct: 464 DSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDF 523

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS-------NGS 670
           ++SV    +    FS SKD  V  WD +    I  L  H++ V ++A  +       N  
Sbjct: 524 VLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYK 583

Query: 671 FVVSSSHDHSIRIWE 685
              + S D   RIW+
Sbjct: 584 LFATGSGDCKARIWK 598

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 103/227 (45%), Gaps = 15/227 (6%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            HD+ +  +  + DGK L TG  ++T + +D       V    D +   +        E 
Sbjct: 277 PHDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNET 335

Query: 531 NDD-----ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
                   I S+  SPD  +LA    D  ++++ +   K  + L GH+  + S+D   D 
Sbjct: 336 VTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDG 395

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDG 644
           + +++ S D++I+IW L  G C  +L + +D + +V   P      +  S D  V+ WD 
Sbjct: 396 QKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDS 454

Query: 645 EKFECIQKL-------YAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
                +++L         HQ  V+++A   +G  VVS S D ++++W
Sbjct: 455 STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 78/154 (50%), Gaps = 14/154 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D + LA G  D +I++W++  + +++   GH+  I  L +   G +L+SGS D +I +WD
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQ-GEDWLIST-SKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T +     E  LI+  S D  +++WD  T   +       E+
Sbjct: 412 LKTGQCSL--TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNES 469

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKL 231
              H    +S++  KD   + +G+ D  VK+W L
Sbjct: 470 GNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 30/188 (15%)

Query: 522 LNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-------- 573
           L HD+       +  V+ S D +YLA    + T ++F + + + Y+ L            
Sbjct: 276 LPHDSV------VCCVKFSQDGKYLATGC-NRTTQIFDVATGELYVKLLDDTVNTAIVTT 328

Query: 574 -------------LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 620
                        L + SI  S D + + T + DK I+IW +        L  H+  I S
Sbjct: 329 TTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYS 388

Query: 621 VKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASN-GSFVVSSSHDH 679
           + + P+     S S D  ++ WD +  +C   L + +  V  +A++ N G  + + S D 
Sbjct: 389 LDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDR 447

Query: 680 SIRIWEET 687
           S+RIW+ +
Sbjct: 448 SVRIWDSS 455

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 14/139 (10%)

Query: 39  GQLITSAL--ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTY-LEVHEDTDLLA 95
           G+LI +     +V IWD  TG L+  L       + +  G+   +  Y +   +D   + 
Sbjct: 437 GKLIAAGSLDRSVRIWDSSTGFLVERLD------SDNESGNGHQDSVYSVAFTKDGQHVV 490

Query: 96  VGYADGVIKVWDLM-----SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
            G  D  +K+W+L      +    + + GHK  +  +   +    + SGS+D  +I+WD 
Sbjct: 491 SGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDK 550

Query: 151 VGEVGLYKLRSHKDCITGI 169
                +  L+ H++ +  +
Sbjct: 551 DSGNPILMLQGHRNSVISV 569

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 139/340 (40%), Gaps = 69/340 (20%)

Query: 397 IDISDDNKLLATASNGSLKIWNVKTHKCIRTFE--------------------CG----- 431
           +  S+D + LAT  N + +I+ V   + +  F                      G     
Sbjct: 497 VKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDL 556

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+    ++  V   H+  I+SLD    G +LV+G
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIV-MVLKGHEQDIYSLDYFPSGDKLVSG 615

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +++A   
Sbjct: 616 SGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 658

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 659 LDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                        G C  +   H+D ++SV    +     S SKD  V +WD      + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 652 KLYAHQSEVWALAI------ASNGSFVVSSSHDHSIRIWE 685
            L  H++ V ++A+        N     + S D   RIW+
Sbjct: 779 MLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 99/232 (42%), Gaps = 25/232 (10%)

Query: 41  LITSALENVNIWDIKTGDLLATLSD-----GLPPGASDARGSKPAECT---YLE---VHE 89
           L T   +   I+ +  G+L+A  SD         G  +A     A  T   Y+       
Sbjct: 506 LATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSP 565

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD  T   +E        
Sbjct: 626 LKTGQCTL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENEL 683

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMENDKMGEKLTEVGVFE 249
              H    +S+   +D   + +G+ D  VK+W L   N    +     G  E
Sbjct: 684 GTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCE 735

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 105/230 (45%), Gaps = 19/230 (8%)

Query: 387 LQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFL-PG-GL 443
           L+G   D+ S+D     +KL++ + + +++IW++KT +C  T      ++   + PG G 
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGK 652

Query: 444 LVILGTRTGELQLFDLASSSLLDTVED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG  +V+GS D++V
Sbjct: 653 FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 712

Query: 498 KFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+ +  N      K    P       T     D +LSV  + DD Y+     D  V  
Sbjct: 713 KLWNLRNVNHNNADGK----PTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLF 768

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
           +   S    L L GH+  V+S+ ++    +        N  I+    GDC
Sbjct: 769 WDKVSGNPLLMLQGHRNSVISVAVNHGHPL------GPNYHIFATGSGDC 812

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 81/212 (38%), Gaps = 44/212 (20%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD+KTG    TLS  DG+               T      D   +A G  D  ++VW
Sbjct: 621 VRIWDLKTGQCTLTLSIEDGV--------------TTVAVSPGDGKFIAAGSLDRAVRVW 666

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDL--------- 150
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L         
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNAD 726

Query: 151 ---VGEVGLYKLRSHKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
                         HKD +  +    +D +++S SKD  +  WD  +   +     H   
Sbjct: 727 GKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNS 786

Query: 207 CWSLSVKDD--------LLITTGTDSQVKIWK 230
             S++V           +  T   D + +IWK
Sbjct: 787 VISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/339 (24%), Positives = 145/339 (42%), Gaps = 69/339 (20%)

Query: 397 IDISDDNKLLATASNGSLKIWNVKTHKCIRTFE-------------CG-------YALSC 436
           +  S+D + LAT  N + +I+ V   + I                  G       Y  S 
Sbjct: 334 VKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSV 393

Query: 437 KFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
            F P G  +  G     ++++D+    ++  V   H+  ++SLD   +G++LV+GS D+T
Sbjct: 394 CFSPDGEFLATGAEDKLIRIWDIQERKIV-MVLKGHEQDVYSLDYFPNGEKLVSGSGDRT 452

Query: 497 VKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD-RYLAISLLDNTV 555
           V+ WD +     +                 TL +   + +V +SP+D +++A   LD  V
Sbjct: 453 VRIWDLRTGQCSL-----------------TLSIEYGVTTVAVSPNDGKFIAAGSLDRAV 495

Query: 556 KV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL------ 602
           +V      F ++ +     L  GH+  V S+  + D   +++ S DK +K+W +      
Sbjct: 496 RVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNS 555

Query: 603 -----DFGD----CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL 653
                D G     C  +   H+D ++SV    +     S SKD  + +WD E    +  L
Sbjct: 556 NNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLML 615

Query: 654 YAHQSEVWALAIASNGSFV-------VSSSHDHSIRIWE 685
             H++ V ++A+A NGS +        + S D   RIW+
Sbjct: 616 QGHRNSVISVAVA-NGSALGPKYNVFATGSGDCKARIWK 653

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 105/224 (46%), Gaps = 14/224 (6%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDT---TL 528
           H + +  +  ++DG+ L TG  +KT + +    +  L+    D  +     +  T   T 
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 529 ELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
             +  I SV  SPD  +LA    D  ++++ +   K  + L GH+  V S+D   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 589 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKF 647
           ++ S D+ ++IW L  G C  +L + +  + +V   P    F +  S D  V+ WD    
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 648 ECIQKL-------YAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
             +++L         H+  V+++    +G+ VVS S D ++++W
Sbjct: 504 FLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 101/228 (44%), Gaps = 24/228 (10%)

Query: 34  KGSGPGQ-LITSALENVNIWDIKTGDLLATLSDGL---PPGASDARGSKPAECTYLE--- 86
           K S  GQ L T   +   I+ +  G+L+A LSD     P  +S   GS P+   Y+    
Sbjct: 335 KFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVC 394

Query: 87  VHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNII 146
              D + LA G  D +I++WD+  + +++   GH+  +  L +   G +L+SGS D  + 
Sbjct: 395 FSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVR 454

Query: 147 VWDL-VGEVGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIET------ 199
           +WDL  G+  L     +      +      ++ + S D  +++WD  T   +E       
Sbjct: 455 IWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENE 514

Query: 200 -HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKL-------NMENDK 237
               H    +S+   +D   + +G+ D  VK+W +       N  NDK
Sbjct: 515 LGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDK 562

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 120/271 (44%), Gaps = 58/271 (21%)

Query: 387 LQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFL-PG-GL 443
           L+G   DV S+D   +  KL++ + + +++IW+++T +C  T    Y ++   + P  G 
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGK 484

Query: 444 LVILGTRTGELQLFDLASSSLLDTVED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG  +V+GS DKTV
Sbjct: 485 FIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTV 544

Query: 498 KFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+                  ++ + ++  E ND                     T +V
Sbjct: 545 KLWN------------------MRHSGNSNNESNDK---------------GSASATCEV 571

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
            ++          GHK  VLS+  S D K I++ S D+ I  W  + G+    L  H++S
Sbjct: 572 TYV----------GHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNS 621

Query: 618 IMSVKFL------PESHNFFSCSKDAVVKYW 642
           ++SV         P+ + F + S D   + W
Sbjct: 622 VISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSK 635
           + S+  S D + + T + DK I+IW +        L  H+  + S+ + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAIASN-GSFVVSSSHDHSIRIWEET 687
           D  V+ WD    +C   L + +  V  +A++ N G F+ + S D ++R+W+ T
Sbjct: 450 DRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 55/137 (40%), Gaps = 22/137 (16%)

Query: 49  VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-EDTDLLAVGYADGVIKVWD 107
           V +WD  TG L+  L       + +  G+   +  Y  V   D + +  G  D  +K+W+
Sbjct: 495 VRVWDSTTGFLVERLD------SENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 108 L---------------MSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVG 152
           +                S T  + + GHK  +  +        ++SGS+D  I+ WD   
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 153 EVGLYKLRSHKDCITGI 169
              L  L+ H++ +  +
Sbjct: 609 GNPLLMLQGHRNSVISV 625

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 152/371 (40%), Gaps = 80/371 (21%)

Query: 376 SPAPLKTHTIELQ---GQRTDVRSIDISDDNKLLATASNGSLKIWNVKTHKCI------- 425
           +PA  +T  +EL       + V  +  S D + LAT  N + +++ V T + I       
Sbjct: 425 NPALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDN 484

Query: 426 ------RTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSL 479
                  T    Y  S  F P G  +  G     ++++D+    ++  V   H+  ++SL
Sbjct: 485 VKLDSNSTSTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIV-MVLKGHEQDVYSL 543

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRI 539
           D   DG++LV+GS D+TV+ WD +     +                 TL + D + +V +
Sbjct: 544 DYFPDGQKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAV 586

Query: 540 SP-DDRYLAISLLDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITS 591
           SP D R++A   LD  V+V      F ++ +     L  GH+  V S+  + D   +++ 
Sbjct: 587 SPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSG 646

Query: 592 SADKNIKIWGLDF------------------------------GDCHKSLFAHQDSIMSV 621
           S DK++K+W L                                  C  +   H+D ++SV
Sbjct: 647 SLDKSVKLWNLGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSV 706

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNG-------SFVVS 674
                     S SKD  V +WD +    +  L  H++ V ++A+A NG       +   +
Sbjct: 707 TTSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAVA-NGYPLGPKYNVFAT 765

Query: 675 SSHDHSIRIWE 685
            S D   RIW+
Sbjct: 766 GSGDCKARIWK 776

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 94/208 (45%), Gaps = 25/208 (12%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-----EDTDLLA 95
           L T   +   ++ + TG+L+A LSD       + +    +  T L +       D   LA
Sbjct: 458 LATGCNKTTQVYRVSTGELIAKLSD------DNVKLDSNSTSTDLYIRSVCFSPDGKFLA 511

Query: 96  VGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VGEV 154
            G  D +I++WD+    +++   GH+  +  L +   G +L+SGS D  + +WDL  G+ 
Sbjct: 512 TGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQC 571

Query: 155 GLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIET-------HIAHTG 205
            L    S +D +T +     D  ++ + S D  +++WD  T   +E           H  
Sbjct: 572 SL--TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQD 629

Query: 206 ECWSLS-VKDDLLITTGT-DSQVKIWKL 231
             +S+   +D   + +G+ D  VK+W L
Sbjct: 630 SVYSVVFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 61/142 (42%), Gaps = 8/142 (5%)

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
           L   L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G
Sbjct: 476 LIAKLSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEG 527

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
                L  H+  + S+ + P+     S S D  V+ WD    +C   L            
Sbjct: 528 KIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS 587

Query: 666 ASNGSFVVSSSHDHSIRIWEET 687
             +G F+ + S D ++R+W+ T
Sbjct: 588 PHDGRFIAAGSLDRAVRVWDST 609

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/245 (21%), Positives = 94/245 (38%), Gaps = 62/245 (25%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++TG    TLS  DG+               T      D   +A G  D  ++VW
Sbjct: 561 VRIWDLRTGQCSLTLSIEDGV--------------TTVAVSPHDGRFIAAGSLDRAVRVW 606

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDL--------- 150
           D  +  ++   +       GH+ ++  + F   G  ++SGS D ++ +W+L         
Sbjct: 607 DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNN 666

Query: 151 -------------------VGEVGLYKLR--SHKDCITGIWC-QGEDWLISTSKDGMIKL 188
                               G     ++    HKD +  +   Q +++++S SKD  +  
Sbjct: 667 GNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLF 726

Query: 189 WDLKTQQCIETHIAHTGECWSLSV--------KDDLLITTGTDSQVKIWKLNMENDKMGE 240
           WD K+   +     H     S++V        K ++  T   D + +IWK +       +
Sbjct: 727 WDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWKYSTITSGDVD 786

Query: 241 KLTEV 245
           K+ EV
Sbjct: 787 KIKEV 791

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 124/284 (43%), Gaps = 47/284 (16%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+A   ++  V   H+  I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIV-MVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS-PDDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +S  D +Y+A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 604 FGD-------------CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            G              C  +   H+D ++SV          S SKD  V +WD +    +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 651 QKLYAHQSEVWALAIASNG-------SFVVSSSHDHSIRIWEET 687
             L  H++ V ++A+A NG           + S D   RIW+ T
Sbjct: 660 LMLQGHRNSVISVAVA-NGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 81/165 (49%), Gaps = 9/165 (5%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           I SV  SPD ++LA    D  ++++ +   K  + L GH+  + S+D       +++ S 
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-LPESHNFFSCSKDAVVKYWDGEKFECIQK 652
           D+ ++IW L  G C  +L + +D + +V   L +     + S D  V+ WD E    +++
Sbjct: 499 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 653 L-------YAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQ 690
           L         H+  V+++    +G  VVS S D S+++W  +  Q
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQ 602

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 83/173 (47%), Gaps = 15/173 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 447 DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 506

Query: 150 L-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T +     D  ++ + S D  +++WD +T   +E        
Sbjct: 507 LRTGQCSL--TLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENEL 564

Query: 200 HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNM-ENDKMGEKLTEVGVFE 249
              H    +S+   +D   + +G+ D  VK+W L+  +N+   E     G  E
Sbjct: 565 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKPAPGTCE 617

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW +        L  H+  I S+ + P      S 
Sbjct: 437 LYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L              +G ++ + S D ++R+W+
Sbjct: 497 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWD 548

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 82/224 (36%), Gaps = 41/224 (18%)

Query: 39  GQLITSALEN--VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ + +  E+  + IWDI    ++  L                 +   L+     D L  
Sbjct: 448 GKFLATGAEDRLIRIWDIAQKKIVMVLQ------------GHEQDIYSLDYFPSGDKLVS 495

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD   E G 
Sbjct: 496 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWD--AETGF 553

Query: 157 YKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDLKTQQ----------- 195
              R          HKD + + ++ +    ++S S D  +KLW+L + Q           
Sbjct: 554 LVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQNNTNAETKPAP 613

Query: 196 --CIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIWKLNMEN 235
             C  T+  H     S++    D+ +++   D  V  W     N
Sbjct: 614 GTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 66/166 (39%), Gaps = 27/166 (16%)

Query: 49  VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-EDTDLLAVGYADGVIKVWD 107
           V +WD +TG L+  L       + +  G+   +  Y  V   D   +  G  D  +K+W+
Sbjct: 544 VRVWDAETGFLVERLD------SENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 597

Query: 108 LMSK-------------TVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEV 154
           L S              T  + + GHK  +  +        ++SGS+D  ++ WD     
Sbjct: 598 LSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

Query: 155 GLYKLRSHKDCITGI-----WCQGEDWLI--STSKDGMIKLWDLKT 193
            L  L+ H++ +  +     +  G  + +  + S D   ++W   T
Sbjct: 658 PLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYTT 703

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 135/314 (42%), Gaps = 25/314 (7%)

Query: 380 LKTHTIELQGQRT----DVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRT---FECG 431
           +KT  IEL G +      V  + +S +  L+A AS  G L I N +T + ++       G
Sbjct: 165 MKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMG 224

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVE-DAHDAAIWSLDLTSDGKRLVT 490
                 + P G L+  G   G ++LF   S++L +    + H+  +        G+ + +
Sbjct: 225 KIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIAS 284

Query: 491 GSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550
            S D T + WD + +  L          +L+  H        ++ S+    D   +    
Sbjct: 285 ASFDMTWRLWDVETQEEL----------LLQEGH------GKELYSLGFQCDGSLVCSGG 328

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKS 610
           +D    V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + +++
Sbjct: 329 IDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQT 388

Query: 611 LFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
           + AH+  +  V F    +   S   D  +  +    +  +  L  H  ++  + I+ N S
Sbjct: 389 ILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENAS 448

Query: 671 FVVSSSHDHSIRIW 684
            VVS   D S+++W
Sbjct: 449 SVVSCGWDRSVKLW 462

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 66/147 (44%), Gaps = 3/147 (2%)

Query: 86  EVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNI 145
           + H     +A    D   ++WD+ ++  LL   GH   +  L F   G+ + SG  D   
Sbjct: 274 KFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKG 333

Query: 146 IVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHT 204
           +VWD+        L  H   I  + W      + + S DG I++WDL+  +  +T +AH 
Sbjct: 334 LVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHK 393

Query: 205 GECWSLSVK--DDLLITTGTDSQVKIW 229
                ++ +   + L+++G D  + ++
Sbjct: 394 SIVTKVAFEKNGNCLVSSGYDKSINLY 420

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 85/198 (42%), Gaps = 17/198 (8%)

Query: 39  GQLITSALENV--NIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ I SA  ++   +WD++T + L  L +G              E   L    D  L+  
Sbjct: 279 GRFIASASFDMTWRLWDVETQEEL-LLQEG-----------HGKELYSLGFQCDGSLVCS 326

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D    VWD+ S    ++ +GH   I  L +   G ++ +GS D  I +WDL      
Sbjct: 327 GGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEY 386

Query: 157 YKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE--CWSLSVK 213
             + +HK  +T + + +  + L+S+  D  I L+       + T   H  +  C  +S  
Sbjct: 387 QTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISEN 446

Query: 214 DDLLITTGTDSQVKIWKL 231
              +++ G D  VK+W +
Sbjct: 447 ASSVVSCGWDRSVKLWTM 464

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 13/143 (9%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMS 110
           +WDI++G    +LS    P  S            L+   +   +A G  DG I++WDL  
Sbjct: 335 VWDIRSGKRAMSLSGHTKPIYS------------LDWSPNGYQVATGSGDGTIRIWDLRK 382

Query: 111 KTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI- 169
                    HK+ +T + F+  G  L+S   D +I ++       L  L+ H D I  + 
Sbjct: 383 PEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVD 442

Query: 170 WCQGEDWLISTSKDGMIKLWDLK 192
             +    ++S   D  +KLW ++
Sbjct: 443 ISENASSVVSCGWDRSVKLWTMQ 465

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 46/246 (18%), Positives = 88/246 (35%), Gaps = 56/246 (22%)

Query: 440 PGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G LV   +  G+L + +  +  +L      H   I  +  +  G  +  G  + +VK 
Sbjct: 190 PNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMGKIGGIHWSPTGDLITAGGEEGSVKL 249

Query: 500 WDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           + ++  NTL          M  LN        + +   +  P  R++A +  D T +++ 
Sbjct: 250 FGYK-SNTLEE--------MATLNGH-----ENRVTDSKFHPSGRFIASASFDMTWRLWD 295

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           +++ +  L   GH   + S+    D  ++ +   D    +W +  G              
Sbjct: 296 VETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWDIRSG-------------- 341

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDH 679
                          K A+              L  H   +++L  + NG  V + S D 
Sbjct: 342 ---------------KRAM-------------SLSGHTKPIYSLDWSPNGYQVATGSGDG 373

Query: 680 SIRIWE 685
           +IRIW+
Sbjct: 374 TIRIWD 379

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 102/229 (44%), Gaps = 17/229 (7%)

Query: 458 DLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLL 517
           D  S    +T    H  A++S   + D K L++GS DKTV+ W      TLV        
Sbjct: 571 DKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLV-------- 622

Query: 518 PMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
                   +    N  +  V+ SP   Y A +  D T +++  D +       GH   V 
Sbjct: 623 --------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVD 674

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
            +    +   + T S+DK  ++W +  GD  +    H   ++S    P+     + S+D 
Sbjct: 675 CVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDG 734

Query: 638 VVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           ++  WD    + ++ +  H ++ +++L+ +  G+ +VSS  DHS+R+W+
Sbjct: 735 IINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWD 783

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 78/180 (43%), Gaps = 25/180 (13%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLD--SMKFY---------------------- 566
           N D+ S+  S D R  A    D+ +K++ LD  S+K Y                      
Sbjct: 519 NRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFT 578

Query: 567 -LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
             +L GH   V S   S D+K +I+ S DK +++W LD      S   H   +  VKF P
Sbjct: 579 NTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSP 638

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
             H F + S D   + W  +    ++    H S+V  ++   NG +V + S D + R+W+
Sbjct: 639 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWD 698

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 89/219 (40%), Gaps = 13/219 (5%)

Query: 478 SLDLTSDGKRLVTGSADKTVKFW-----------DFQVENTLVPGTKDKLLPMLKLNHDT 526
           SLD + D +    G  D  +K W           D     +    T DK        + T
Sbjct: 524 SLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKY--SKDFTNTT 581

Query: 527 TLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +  +  + S   SPD++YL     D TV+++ LD+    +S  GH  PV  +  S    
Sbjct: 582 LIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGH 641

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
              T+S D+  ++W  D     +    H   +  V F P     F+ S D   + WD   
Sbjct: 642 YFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 701

Query: 647 FECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            + ++    H + V + A++ +G ++ + S D  I +W+
Sbjct: 702 GDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWD 740

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 68/143 (47%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VG 152
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+  G
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 153 E-VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSL 210
           + V L+   +     T +   G  WL + S+DG+I +WD+ T + ++    H     +SL
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSL 761

Query: 211 SV--KDDLLITTGTDSQVKIWKL 231
           S   + ++L+++G D  V++W L
Sbjct: 762 SYSKEGNVLVSSGADHSVRVWDL 784

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 63/150 (42%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W L + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 597 DNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWS 656

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      S  DC++  +     ++ + S D   ++WD+ T   +   + H
Sbjct: 657 C---DHIYPLRIFAGHLSDVDCVS--FHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGH 711

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKL 231
           T    S +V  D   L T   D  + +W +
Sbjct: 712 TAPVISTAVSPDGRWLSTGSEDGIINVWDI 741

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +        G  L +GS D  
Sbjct: 676 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 735

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L  +R H K+ I  + + +  + L+S+  D  +++WDLK
Sbjct: 736 INVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 61/180 (33%), Gaps = 34/180 (18%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDL----------------------------MSKT 112
           + T L+  ED+ L A G+ D  IK+W L                             + T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 113 VLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WC 171
            L+   GH  A+    F      LISGS D  + +W L     L   + H   +  + + 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 172 QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQVKIW 229
               +  + S D   +LW       +     H    +C S       + T  +D   ++W
Sbjct: 638 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 697

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 127/284 (44%), Gaps = 46/284 (16%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++DL +  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 508

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D + +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV++      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 552 LDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLR 611

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                      +      +   H+D ++SV          S SKD  V +WD      + 
Sbjct: 612 SANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLL 671

Query: 652 KLYAHQSEVWALAIASN-------GSFVVSSSHDHSIRIWEETE 688
            L  H++ V ++A+A++       G F   S  D   RIW+ T+
Sbjct: 672 MLQGHRNSVISVAVANDHPLGPEYGVFATGSG-DCKARIWKYTK 714

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 106/226 (46%), Gaps = 33/226 (14%)

Query: 41  LITSALENVNIWDIKTGDLLATLSD---GLPPGASD--ARGSKPAECT-----------Y 84
           L T   +   ++ + TG+L+A LS+     P G S   A G++ AE T           Y
Sbjct: 391 LATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLY 450

Query: 85  LE---VHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSR 141
           +       D   LA G  D +I++WDL ++ +++   GH+  I  L +  +G +L+SGS 
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 142 DSNIIVWDL-VGEVGLYKLRSHKDCITGIWCQ-GEDWLIST-SKDGMIKLWDLKTQQCIE 198
           D  + +WDL  G+  L    S +D +T +    G+  LI+  S D  +++WD +T   +E
Sbjct: 511 DRTVRIWDLRAGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVE 568

Query: 199 T-------HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMEN 235
                      H    +S+   +D   + +G+ D  VK+W L   N
Sbjct: 569 RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN 614

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 92/227 (40%), Gaps = 47/227 (20%)

Query: 49  VNIWDIKTGDLLATLS--DGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           V IWD++ G    TLS  DG+               T      D  L+A G  D  +++W
Sbjct: 514 VRIWDLRAGQCSLTLSIEDGV--------------TTVAVSPGDGKLIAAGSLDRTVRIW 559

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL--- 156
           D  +  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L    G    
Sbjct: 560 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTE 619

Query: 157 ---------YKLRSHKDCITGIWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
                         HKD +  +   Q +++++S SKD  +  WD  +   +     H   
Sbjct: 620 GKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNS 679

Query: 207 CWSLSVKDD--------LLITTGTDSQVKIWKLNMENDKMGEKLTEV 245
             S++V +D        +  T   D + +IWK   +++    KL EV
Sbjct: 680 VISVAVANDHPLGPEYGVFATGSGDCKARIWKYTKKSEP---KLREV 723

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 60/148 (40%), Gaps = 21/148 (14%)

Query: 37  GPGQLITSAL--ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-EDTDL 93
           G G+LI +      V IWD +TG L+  L       + +  G+   +  Y  V   D   
Sbjct: 542 GDGKLIAAGSLDRTVRIWDSETGFLVERLD------SENELGTGHKDSVYSVVFTRDGHG 595

Query: 94  LAVGYADGVIKVWDLMSK------------TVLLNFNGHKAAITLLQFDSTGTRLISGSR 141
           +  G  D  +K+W+L S                + + GHK  +  +        ++SGS+
Sbjct: 596 VVSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSK 655

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           D  ++ WD      L  L+ H++ +  +
Sbjct: 656 DRGVLFWDTPSGNPLLMLQGHRNSVISV 683

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 128/294 (43%), Gaps = 34/294 (11%)

Query: 410 SNGSLKIWNVKTHK---CIRTFE-CGYALSC-KFLPGGLLVILGTRTGELQLFDLAS--- 461
           S  ++K+ N++T     C+ TF      ++C +F     LV  G +   ++L+ L     
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 462 -SSLLDTVEDA--------HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
            S L    +DA        H   ++S+  + D + LV+ S DKTV+ W       LV   
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV--- 578

Query: 513 KDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572
                        +    N  +  V+ SP   Y A    D T +++  D +       GH
Sbjct: 579 -------------SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 633 CSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            S+D V+  WD    + I+++  H +S V++L+    G+ +VS   D S+R+W+
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 85/175 (48%), Gaps = 14/175 (8%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF-------------YLSLYGHKLPVL 577
           N ++  +R S D R +A    D+ +K++ LD                  ++L GH  PV 
Sbjct: 487 NREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVY 546

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D 
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQ 606

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V  +    NG++V++ S D + R+W+ +T D V
Sbjct: 607 TARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSV 661

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 110/226 (48%), Gaps = 23/226 (10%)

Query: 382 THTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGY---ALSCK 437
           ++T+ L G    V S+  S DN+ L +AS + ++++W++ T+ C+ +++ G+       K
Sbjct: 533 SNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYK-GHNHPVWDVK 591

Query: 438 FLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
           F P G     G+     +L+       L  +   H   +  +    +G  ++TGS+DKT 
Sbjct: 592 FSPLGHYFATGSHDQTARLWSCDHIYPL-RIFAGHLNDVDCVTFHPNGTYVLTGSSDKTC 650

Query: 498 KFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           + WD Q  +++           L L H  +      ++SV +SPD R+L     D  + V
Sbjct: 651 RMWDIQTGDSV----------RLFLGHTAS------VVSVAVSPDGRWLTTGSEDGVIIV 694

Query: 558 FFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           + + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 695 WDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE 153
            A G  D   ++W       L  F GH   +  + F   GT +++GS D    +WD+   
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 154 VGLYKLRSHKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSLS 211
             +     H   +  +    +  WL + S+DG+I +WD+ T + I+    H     +SLS
Sbjct: 659 DSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 212 V--KDDLLITTGTDSQVKIWKL 231
              + ++L++ G D  V++W L
Sbjct: 719 FNKEGNILVSGGADQSVRVWDL 740

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L     D  +++W L + T L+++ GH   +  ++F   G    +GS D    +W 
Sbjct: 553 DNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWS 612

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC+T  +     ++++ S D   ++WD++T   +   + H
Sbjct: 613 C---DHIYPLRIFAGHLNDVDCVT--FHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGH 667

Query: 204 TGECWSLSVKDD-LLITTGT-DSQVKIWKL 231
           T    S++V  D   +TTG+ D  + +W +
Sbjct: 668 TASVVSVAVSPDGRWLTTGSEDGVIIVWDI 697

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 60/139 (43%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G   L  S+ +   +WDI+TGD +            
Sbjct: 621 IFAGHLNDVDCVTFHPN-------GTYVLTGSSDKTCRMWDIQTGDSVRLFL-------- 665

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
                  A    + V  D   L  G  DGVI VWD+ +   +    GH K+A+  L F+ 
Sbjct: 666 ----GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNK 721

Query: 132 TGTRLISGSRDSNIIVWDL 150
            G  L+SG  D ++ VWDL
Sbjct: 722 EGNILVSGGADQSVRVWDL 740

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 2/107 (1%)

Query: 88  HEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A++  +     G  L +GS D  IIV
Sbjct: 635 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 694

Query: 148 WDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK 192
           WD+     + ++R H K  +  +    E + L+S   D  +++WDLK
Sbjct: 695 WDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLVILGTRTGELQLFDLASS 462
           +L  +S+ + ++W+++T   +R F       +S    P G  +  G+  G + ++D+ + 
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 700

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVENTLVP 510
             +  +     +A++SL    +G  LV+G AD++V+ WD   F  E +L P
Sbjct: 701 KRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPSLEP 751

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVG---EVGL-YKLRSHKDCITGI 169
           +  F+     +T L+F      + +G +DS I +W L G   E  L  K +   + +T I
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 170 WCQGE----------DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSL--SVKDDLL 217
              G            +L+S S+D  ++LW L T  C+ ++  H    W +  S      
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 218 ITTGTDSQVKIW 229
            T   D   ++W
Sbjct: 600 ATGSHDQTARLW 611

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 126/295 (42%), Gaps = 39/295 (13%)

Query: 393 DVRSIDISDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRT 451
           D+  ++ SDD +L AT    S +KIW++           G +L    LP         + 
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPS-------YKK 523

Query: 452 GELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            E+      +SSLL      H  A++S   + D K L++GS DKTV+ W      TLV  
Sbjct: 524 EEILTTGDETSSLLI----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLV-- 577

Query: 512 TKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  V+ SP   Y A +  D T +++  D +       G
Sbjct: 578 --------------SYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAG 623

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V ++    +   + T SADK  ++W +  GD  +    H   +++    P+     
Sbjct: 624 HLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC 683

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +  +D V+  WD    + ++++  H ++ + + +    G+ ++S   DHS+R+W+
Sbjct: 684 TGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWD 738

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 73/175 (41%), Gaps = 20/175 (11%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLS--------------------LY 570
           N D+  +  S D R  A    D+ +K++ LD      +                    L 
Sbjct: 479 NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLI 538

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V S   S D+K +++ S DK +++W +D      S   H   +  VKF P  H F
Sbjct: 539 GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYF 598

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            + S D   + W  +    ++    H ++V  ++   NG +V + S D + R+W+
Sbjct: 599 ATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWD 653

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 64/143 (44%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VG 152
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+  G
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTG 657

Query: 153 E-VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---W 208
           + V L+   +     T +   G  WL +  +DG+I +WD+ T + ++    H       +
Sbjct: 658 DSVRLFLGHTAPVLTTAVTPDGR-WLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 209 SLSVKDDLLITTGTDSQVKIWKL 231
           S + + ++LI+ G D  V++W L
Sbjct: 717 SFNKEGNILISGGADHSVRVWDL 739

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 47/108 (43%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVI 103
           SA +   +WDI TGD +        P  + A            V  D   L  G  DGVI
Sbjct: 644 SADKTCRMWDISTGDSVRLFLGHTAPVLTTA------------VTPDGRWLCTGGEDGVI 691

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
            VWD+ +   L    GH K AI    F+  G  LISG  D ++ VWDL
Sbjct: 692 NVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 59/145 (40%), Gaps = 3/145 (2%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 552 DNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWS 611

Query: 150 LVGEVGLYKLRSH-KDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW 208
                 L     H  D  T  +     ++ + S D   ++WD+ T   +   + HT    
Sbjct: 612 CDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVL 671

Query: 209 SLSVKDD--LLITTGTDSQVKIWKL 231
           + +V  D   L T G D  + +W +
Sbjct: 672 TTAVTPDGRWLCTGGEDGVINVWDI 696

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G AD   ++WD+ +   +  F GH A +        G  L +G  D  
Sbjct: 631 VSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGV 690

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ I       E + LIS   D  +++WDLK
Sbjct: 691 INVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 121/282 (42%), Gaps = 46/282 (16%)

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  S  F P G  +  G     ++++D+    ++  V   HD  ++SLD    G +LV+G
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIV-MVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 492 SADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + +V +SP D +++A   
Sbjct: 444 SGDRTVRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 486

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 487 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLR 546

Query: 603 -------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
                            C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 547 DNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNP 606

Query: 650 IQKLYAHQSEVWALAIASNGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A+A+            + S D   RIW+
Sbjct: 607 LLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWK 648

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 119/290 (41%), Gaps = 57/290 (19%)

Query: 394 VRSIDISDDNKLLATASNGSL-KIWNVKTHKCIRTFECGY---ALSCKFLPGGLLVILGT 449
           +RS+  S D K LAT +   L +IW+++  K +   + G+     S  + P G  ++ G+
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGS 444

Query: 450 RTGELQLFDLASS--SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQV--- 504
               ++++DL +   SL  ++ED       S     DGK +  GS D+ V+ WD +    
Sbjct: 445 GDRTVRIWDLKTGQCSLTLSIEDGVTTVAVS---PGDGKFIAAGSLDRAVRVWDSETGFL 501

Query: 505 ------ENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVF 558
                 EN L  G KD                   + SV  + D   +    LD +VK++
Sbjct: 502 VERLDSENELGTGHKDS------------------VYSVVFTKDGNKVVSGSLDRSVKLW 543

Query: 559 FLDSMKFY--------------LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF 604
            L                    ++  GHK  VLS+  + + + I++ S D+ +  W    
Sbjct: 544 NLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKS 603

Query: 605 GDCHKSLFAHQDSIMSVKFL------PESHNFFSCSKDAVVKYWDGEKFE 648
           G+    L  H++S++SV         P+   F + S D   + W   K +
Sbjct: 604 GNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKFSKID 653

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 97/224 (43%), Gaps = 35/224 (15%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGS---KPAECT-------------- 83
           L T   +   I+ + TG+L+A LSD     A  +  +    PA                 
Sbjct: 324 LATGCNKTSQIYKVSTGELIAKLSDDNANSAVSSNNNDQNAPANVNGANANSGNNTNSND 383

Query: 84  -YLE---VHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISG 139
            Y+       D   LA G  D +I++WD+  + +++   GH   +  L +  +G +L+SG
Sbjct: 384 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 140 SRDSNIIVWDL-VGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQC 196
           S D  + +WDL  G+  L    S +D +T +     D  ++ + S D  +++WD +T   
Sbjct: 444 SGDRTVRIWDLKTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFL 501

Query: 197 IET-------HIAHTGECWSLS-VKDDLLITTGT-DSQVKIWKL 231
           +E           H    +S+   KD   + +G+ D  VK+W L
Sbjct: 502 VERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 109/229 (47%), Gaps = 17/229 (7%)

Query: 387 LQGQRTDVRSID-ISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFL-PG-GL 443
           LQG   DV S+D     +KL++ + + +++IW++KT +C  T      ++   + PG G 
Sbjct: 421 LQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGK 480

Query: 444 LVILGTRTGELQLFDLASSSLLDTVED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+    ++++D  +  L++ ++        H  +++S+  T DG ++V+GS D++V
Sbjct: 481 FIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSV 540

Query: 498 KFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKV 557
           K W+ +  +     + +           T +   D +LSV  + +D Y+     D  V  
Sbjct: 541 KLWNLR--DNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLF 598

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDS------KMIITSSADKNIKIW 600
           +   S    L L GH+  V+S+ ++  +      ++  T S D   +IW
Sbjct: 599 WDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIW 647

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + DK I+IW +        L  H   + S+ + P      S 
Sbjct: 384 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D  V+ WD +  +C   L              +G F+ + S D ++R+W+
Sbjct: 444 SGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD 495

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 83/219 (37%), Gaps = 42/219 (19%)

Query: 39  GQLITSALEN--VNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G+ + +  E+  + IWDI+   ++  L                 +   L+     D L  
Sbjct: 395 GKFLATGAEDKLIRIWDIQQRKIVMVLQ------------GHDQDVYSLDYFPSGDKLVS 442

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+      G  + +GS D  + VWD   E G 
Sbjct: 443 GSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SETGF 500

Query: 157 YKLR---------SHKDCI-TGIWCQGEDWLISTSKDGMIKLWDLK-------------- 192
              R          HKD + + ++ +  + ++S S D  +KLW+L+              
Sbjct: 501 LVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKS 560

Query: 193 TQQCIETHIAHTGECWSL--SVKDDLLITTGTDSQVKIW 229
              C  T++ H     S+  +  D+ +++   D  V  W
Sbjct: 561 NATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFW 599

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 63/150 (42%), Gaps = 23/150 (15%)

Query: 37  GPGQLITSAL--ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVH-EDTDL 93
           G G+ I +      V +WD +TG L+  L       + +  G+   +  Y  V  +D + 
Sbjct: 477 GDGKFIAAGSLDRAVRVWDSETGFLVERLD------SENELGTGHKDSVYSVVFTKDGNK 530

Query: 94  LAVGYADGVIKVWDL--------------MSKTVLLNFNGHKAAITLLQFDSTGTRLISG 139
           +  G  D  +K+W+L               + T  + + GHK  +  +   +    ++SG
Sbjct: 531 VVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSG 590

Query: 140 SRDSNIIVWDLVGEVGLYKLRSHKDCITGI 169
           S+D  ++ WD      L  L+ H++ +  +
Sbjct: 591 SKDRGVLFWDTKSGNPLLMLQGHRNSVISV 620

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 100/219 (45%), Gaps = 19/219 (8%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H  AI+S   + D K LV+ S DKT++ W      TLV                T    
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKGH 594

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDSKMII 589
           N  +  V+ SP   Y A +  D T +++  D + F L ++ GH   V  +    +   I 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           T S+DK  ++W +  G+  +    H   I+SV   P+     + S+D V+  WD    + 
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 650 IQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWEET 687
           ++KL  H +S V +L+     + +VS   D+S+RIW+ T
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 80/198 (40%), Gaps = 36/198 (18%)

Query: 526 TTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF-------------------- 565
           T L  N+++LS+  S D R  A    D+ +KV+ LD                        
Sbjct: 470 TFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKATKIQPSKSQAALRAGL 529

Query: 566 ----------------YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609
                            + L GH   + S   S D+K+++++S DK I++W +D      
Sbjct: 530 DNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV 589

Query: 610 SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNG 669
           +   H   +  V+F P  H F + S D   + W  +    ++    H S+V  +    NG
Sbjct: 590 TYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNG 649

Query: 670 SFVVSSSHDHSIRIWEET 687
            ++ + S D + R+W+ T
Sbjct: 650 CYIFTGSSDKTCRMWDIT 667

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 102/262 (38%), Gaps = 59/262 (22%)

Query: 384 TIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALSCKFLPGG 442
           T++L G    + S   S DNKLL +AS + ++++W++ T   + T++             
Sbjct: 546 TVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYK------------- 592

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                                        H+  +W +  +  G    T S D+T + W  
Sbjct: 593 ----------------------------GHNHPVWDVQFSPVGHYFATASHDQTARLW-- 622

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
                    + D + P+   +   +     D+  V   P+  Y+     D T +++ + +
Sbjct: 623 ---------SCDHIFPLRIFSGHIS-----DVDCVTFHPNGCYIFTGSSDKTCRMWDITT 668

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
            +      GH  P+LS+ ++ D   + T S D  I IW +  G   K L  H + ++ S+
Sbjct: 669 GESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSL 728

Query: 622 KFLPESHNFFSCSKDAVVKYWD 643
            +  ES+   S   D  V+ WD
Sbjct: 729 SYNKESNILVSGGSDNSVRIWD 750

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 65/147 (44%), Gaps = 7/147 (4%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D  LL     D  I++W + ++T L+ + GH   +  +QF   G    + S D    +W 
Sbjct: 564 DNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWS 623

Query: 150 LVGEVGLYKLRSH---KDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
                 L     H    DC+T  +     ++ + S D   ++WD+ T + +   I HT  
Sbjct: 624 CDHIFPLRIFSGHISDVDCVT--FHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAP 681

Query: 207 CWSLSV-KDDLLITTGT-DSQVKIWKL 231
             S++V  D L + TG+ D  + IW +
Sbjct: 682 ILSVAVAPDGLRLATGSEDGVIHIWDI 708

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 66/144 (45%), Gaps = 4/144 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE 153
            A    D   ++W       L  F+GH + +  + F   G  + +GS D    +WD+   
Sbjct: 610 FATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTG 669

Query: 154 VGLYKLRSHKDCITGIWCQGEDWLIST-SKDGMIKLWDLKTQQCIETHIAHTGEC---WS 209
             +     H   I  +    +   ++T S+DG+I +WD+ T + ++  I H        S
Sbjct: 670 ESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLS 729

Query: 210 LSVKDDLLITTGTDSQVKIWKLNM 233
            + + ++L++ G+D+ V+IW L +
Sbjct: 730 YNKESNILVSGGSDNSVRIWDLTV 753

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 2/106 (1%)

Query: 88  HEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A I  +     G RL +GS D  I +
Sbjct: 646 HPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHI 705

Query: 148 WDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDL 191
           WD+     L KL  H K  +  + + +  + L+S   D  +++WDL
Sbjct: 706 WDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 2/102 (1%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLVILGTRTGELQLFDLASS 462
           +   +S+ + ++W++ T + +R F       LS    P GL +  G+  G + ++D+ + 
Sbjct: 652 IFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTG 711

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQV 504
             L  +     +A+ SL    +   LV+G +D +V+ WD  V
Sbjct: 712 KSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 60/162 (37%), Gaps = 29/162 (17%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISG- 139
           E   L    D  L A G+ D  IKVW L   T+       ++  T +Q   +   L +G 
Sbjct: 477 EMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------ESKATKIQPSKSQAALRAGL 529

Query: 140 ---------SRDSNIIVWDLVGEVG-LYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLW 189
                    S+++ I    LVG  G +Y      D            L+S S+D  I+LW
Sbjct: 530 DNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPD---------NKLLVSASEDKTIRLW 580

Query: 190 DLKTQQCIETHIAHTGECW--SLSVKDDLLITTGTDSQVKIW 229
            + T+  + T+  H    W    S       T   D   ++W
Sbjct: 581 SMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLW 622

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 138/323 (42%), Gaps = 40/323 (12%)

Query: 377 PAPLKTH-TIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKTHKCIRTFECGYALS 435
           P P KT   I+L+ QR       I  DN  LA  S       N  T++ + + E  ++  
Sbjct: 452 PLPPKTTLDIKLEVQRVKESRDAIKLDNLQLALPSVCMYTFHN--TNRDMTSLE--FSDD 507

Query: 436 CKFLPGGLLVILGTRTGELQLFDLASSSL-----LDTVEDA-------HDAAIWSLDLTS 483
           C+      L   G +  +++LF L  S L      D  EDA       H   ++S   + 
Sbjct: 508 CR------LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSP 561

Query: 484 DGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD 543
           D + LV+ S DKTV+ W     + LV                +    N  +  V+ SP  
Sbjct: 562 DNRYLVSSSEDKTVRLWSLDTHSALV----------------SYKGHNHPVWDVKFSPLG 605

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
            Y A +  D+T +++  D +       GH   V  +    +   + T S+DK  ++W + 
Sbjct: 606 HYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIA 665

Query: 604 FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWA 662
            GDC +        ++S    P+     + S+D ++  WD    + ++++  H ++ +++
Sbjct: 666 TGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYS 725

Query: 663 LAIASNGSFVVSSSHDHSIRIWE 685
           LA    G+ ++S   DHS+R+W+
Sbjct: 726 LAYCKEGNALISGGADHSVRVWD 748

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 83/207 (40%), Gaps = 18/207 (8%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLV-G 152
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +WD+  G
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATG 667

Query: 153 EVGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSLS 211
           +     L      I+        WL + S+DG+I +WD+ T + ++    H     +SL+
Sbjct: 668 DCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLA 727

Query: 212 V--KDDLLITTGTDSQVKIWKLNMENDKMGEKLTEV---------GVFEKQSKQRGLKVE 260
              + + LI+ G D  V++W L     + G +  +          G   +  K+ G +  
Sbjct: 728 YCKEGNALISGGADHSVRVWDLKKATTESGPEPEQAFVGYLGDVTGSINQDIKEYGRRRT 787

Query: 261 FITNASDGVSFFYIQNADKTIETFRIR 287
            I   +D V+ FY     K    F+++
Sbjct: 788 VIP-TNDLVASFYT----KKTPVFKVK 809

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   L  G +D   ++WD+ +   +  F G  A +        G  L +GS D  
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGI 700

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ I  + +C+  + LIS   D  +++WDLK
Sbjct: 701 INVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L     D  +++W L + + L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 562 DNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWS 621

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC++  +     +L + S D   ++WD+ T  C+   +  
Sbjct: 622 C---DHIYPLRIFAGHLNDVDCVS--FHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGL 676

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKL 231
           T    S  V  D   L T   D  + +W +
Sbjct: 677 TAPVISTCVSPDGRWLSTGSEDGIINVWDI 706

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 60/171 (35%), Gaps = 24/171 (14%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVW-----------------DLMSKTVLLNFNGHKAA 123
           + T LE  +D  L A G+ D  IK++                 D  SKT++    GH   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLV----GHSGT 553

Query: 124 ITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSK 182
           +    F      L+S S D  + +W L     L   + H   +  + +     +  + S 
Sbjct: 554 VYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASH 613

Query: 183 DGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQVKIWKL 231
           D   +LW       +     H    +C S       L T  +D   ++W +
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 131/298 (43%), Gaps = 37/298 (12%)

Query: 393 DVRSIDISDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALSCKFLPGG--LLVILGT 449
           D+ S++ SDD +L +T    S +KIW++           G +L+ KF         I  T
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLD----------GTSLNTKFTQANKDRNRITIT 506

Query: 450 RTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLV 509
                 + +  S++L+      H   ++S   + D + L++GS DKTV+ W       LV
Sbjct: 507 DRSLTHMDNELSATLI-----GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALV 561

Query: 510 PGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                           +    N  I  V+ SP   Y A +  D T +++  D + F L +
Sbjct: 562 ----------------SYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHI-FPLRI 604

Query: 570 Y-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESH 628
           + GH   V  +    +   + T S+DK  ++W +  GD  +    H  +++S    P+  
Sbjct: 605 FAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGR 664

Query: 629 NFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
              + S D  +  WD    + ++ L  H ++ V++L  +  G+ +VSS  D S+R+W+
Sbjct: 665 WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWD 722

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 28/183 (15%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLD----SMKFY-------------------- 566
           N D+ S+  S D R  +    D+ +K++ LD    + KF                     
Sbjct: 455 NQDMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMD 514

Query: 567 ----LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVK 622
                +L GH   V S   S D++ +I+ S DK +++W LD      S   H   I  V+
Sbjct: 515 NELSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQ 574

Query: 623 FLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIR 682
           F P  H F + S D   + W  +    ++    H ++V  ++   NG +V + S D + R
Sbjct: 575 FSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCR 634

Query: 683 IWE 685
           +W+
Sbjct: 635 MWD 637

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 102/221 (46%), Gaps = 23/221 (10%)

Query: 387 LQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALS---CKFLPGG 442
           L G    V S   S DN+ L + S + ++++W++ TH  + +++ G+       +F P G
Sbjct: 521 LIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLG 579

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                 +     +L+       L  +   H   +  +    +G  + TGS+DKT + WD 
Sbjct: 580 HYFATASHDQTARLWSCDHIFPL-RIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
              +++           L L H +       ++S  +SPD R+L     D T+ V+ + S
Sbjct: 639 STGDSV----------RLFLGHTSA------VVSTAVSPDGRWLTTGSDDGTINVWDIGS 682

Query: 563 MKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            K   SL GH K  V S+  S +  ++++S AD+++++W L
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 7/147 (4%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W L + T L+++ GH   I  +QF   G    + S D    +W 
Sbjct: 536 DNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWS 595

Query: 150 LVGEVGLYKLRSH---KDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
                 L     H    DC++  +     ++ + S D   ++WD+ T   +   + HT  
Sbjct: 596 CDHIFPLRIFAGHLNDVDCVS--FHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSA 653

Query: 207 CWSLSVKDD-LLITTGT-DSQVKIWKL 231
             S +V  D   +TTG+ D  + +W +
Sbjct: 654 VVSTAVSPDGRWLTTGSDDGTINVWDI 680

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 63/143 (44%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 154 VGLYKLRSHKDCI--TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSL 210
             +     H   +  T +   G  WL + S DG I +WD+ + + +++   H     +SL
Sbjct: 642 DSVRLFLGHTSAVVSTAVSPDGR-WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSL 700

Query: 211 --SVKDDLLITTGTDSQVKIWKL 231
             S + +LL+++G D  V++W L
Sbjct: 701 TYSKEGNLLVSSGADQSVRVWDL 723

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 2/133 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH +A+        G  L +GS D  
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIA 202
           I VWD+     L  LR H K+ +  + + +  + L+S+  D  +++WDL        +  
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDLFKPSANANNNP 734

Query: 203 HTGECWSLSVKDD 215
            +G   S    DD
Sbjct: 735 SSGTTNSNPTTDD 747

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 59/182 (32%), Gaps = 31/182 (17%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN---------------------- 118
           + T LE  +D  L + G+ D  IK+W L   ++   F                       
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMDNE 516

Query: 119 ------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WC 171
                 GH   +    F      LISGS D  + +W L     L   + H   I  + + 
Sbjct: 517 LSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFS 576

Query: 172 QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQVKIW 229
               +  + S D   +LW       +     H    +C S       + T  +D   ++W
Sbjct: 577 PLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMW 636

Query: 230 KL 231
            +
Sbjct: 637 DI 638

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 86/175 (49%), Gaps = 14/175 (8%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF-------------YLSLYGHKLPVL 577
           N D+ S++ S D R +A    D+ +K++ LD                   +L GH  PV 
Sbjct: 472 NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVY 531

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D 
Sbjct: 532 SVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQ 591

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V  +A   NG++V++ S D + R+W+ +T D V
Sbjct: 592 TARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSV 646

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   ++S+  + D + LV+ S DKTV+ W       LV                +    
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV----------------SYKGH 568

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V+ SP   Y A    D T +++  D +       GH   V  +    +   ++T
Sbjct: 569 NHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLT 628

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H  S++SV   P+     + S+D V+  WD    + I
Sbjct: 629 GSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI 688

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H +S V +L+    G+ +VS   D S+R+W+
Sbjct: 689 KQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 113/241 (46%), Gaps = 30/241 (12%)

Query: 367 IPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCI 425
           +P + +EA+       +T  L G    V S+  S DN+ L +AS + ++++W++ T  C+
Sbjct: 510 LPSKSKEAS-------NTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCL 562

Query: 426 RTFECGY---ALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLT 482
            +++ G+       KF P G      +     +L+       L  +   H   +  +   
Sbjct: 563 VSYK-GHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPL-RIFAGHLNDVDCVAFH 620

Query: 483 SDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPD 542
            +G  ++TGS+DKT + WD Q  +++           L L H  +      ++SV +SPD
Sbjct: 621 PNGTYVLTGSSDKTCRMWDIQTGDSV----------RLFLGHTAS------VVSVAVSPD 664

Query: 543 DRYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWG 601
            R+L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W 
Sbjct: 665 GRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

Query: 602 L 602
           L
Sbjct: 725 L 725

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 4/136 (2%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D   ++W       L  F GH   +  + F   GT +++GS D    +WD+     +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 160 RSHKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WSLSVKDD 215
             H   +  +    +  WL + S+DG+I +WD+ T + I+    H        S + + +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 216 LLITTGTDSQVKIWKL 231
           +L++ G D  V++W L
Sbjct: 710 ILVSGGADQSVRVWDL 725

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 60/139 (43%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G   L  S+ +   +WDI+TGD +            
Sbjct: 606 IFAGHLNDVDCVAFHPN-------GTYVLTGSSDKTCRMWDIQTGDSVRLFL-------- 650

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
                  A    + V  D   L  G  DGVI VWD+ +   +    GH K+A+  L F+ 
Sbjct: 651 ----GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNK 706

Query: 132 TGTRLISGSRDSNIIVWDL 150
            G  L+SG  D ++ VWDL
Sbjct: 707 EGNILVSGGADQSVRVWDL 725

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 80/183 (43%), Gaps = 20/183 (10%)

Query: 41  LITSALENVNIWDIK---TGDLLATLS----------DGLPPGASDARGSKPAECTYLEV 87
           L++    N  +WD+K    G   AT+S          D + P    A      +C  +  
Sbjct: 562 LVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDC--VAF 619

Query: 88  HEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A++  +     G  L +GS D  IIV
Sbjct: 620 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 679

Query: 148 WDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK---TQQCIETHIA 202
           WD+     + ++R H K  +  +    E + L+S   D  +++WDLK    +  +E    
Sbjct: 680 WDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEPEQP 739

Query: 203 HTG 205
           ++G
Sbjct: 740 YSG 742

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 65/148 (43%), Gaps = 9/148 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L     D  +++W L + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 538 DNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDCITGIWC----QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                 +Y LR     +  + C        ++++ S D   ++WD++T   +   + HT 
Sbjct: 598 C---DHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTA 654

Query: 206 ECWSLSVKDD-LLITTGT-DSQVKIWKL 231
              S++V  D   +TTG+ D  + +W +
Sbjct: 655 SVVSVAVSPDGRWLTTGSEDGVIIVWDI 682

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLVILGTRTGELQLFDLASS 462
           +L  +S+ + ++W+++T   +R F       +S    P G  +  G+  G + ++D+ + 
Sbjct: 626 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 685

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVENTLVP 510
             +  +     +A+ SL    +G  LV+G AD++V+ WD   F  E  L P
Sbjct: 686 KRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEP 736

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 53/132 (40%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRS------------ 161
           +  F+     +T LQF      + +G +DS+I +W L G     KL S            
Sbjct: 465 MYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI 524

Query: 162 -HKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSL--SVKDDLL 217
            H   +  + +     +L+S S+D  ++LW L T  C+ ++  H    W +  S      
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYF 584

Query: 218 ITTGTDSQVKIW 229
            T   D   ++W
Sbjct: 585 ATVSHDQTARLW 596

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 125/297 (42%), Gaps = 45/297 (15%)

Query: 393 DVRSIDISDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRT 451
           D+ S++ SDD +L A     S +KIW+                    L G  L+     +
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWS--------------------LDGSSLINPKYSS 514

Query: 452 GELQLF--DLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLV 509
            +   F  D   S+L+      H   ++S   + D   LV+GS DKTVK W       LV
Sbjct: 515 SQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALV 569

Query: 510 PGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                        N+      N  +  V+ SP   Y A +  D T +++  D +      
Sbjct: 570 -------------NYKGH---NHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIF 613

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   V ++    +   + T S+DK  ++W +  GD  +    H   ++S +  P+   
Sbjct: 614 AGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRW 673

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
             + S+D V+  WD    + I+++  H ++ V +L+    G+ ++S   DHS+R+W+
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD 730

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 18/173 (10%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF----YLS--------------LYGH 572
           N D+ S+  S D R  A    D+ +K++ LD        Y S              L GH
Sbjct: 473 NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGH 532

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V S   S D+  +++ S DK +K+W +D      +   H   +  VKF P  H F S
Sbjct: 533 SGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFAS 592

Query: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            S D   + W  +    ++    H ++V  ++   NG +V + S D + R+W+
Sbjct: 593 ASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWD 645

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 100/262 (38%), Gaps = 65/262 (24%)

Query: 387 LQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLV 445
           L G    V S   S DN  L + S + ++K+W++ TH  +  ++                
Sbjct: 529 LVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYK---------------- 572

Query: 446 ILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                                     H+  +W +  +  G    + S D+T + W     
Sbjct: 573 -------------------------GHNHPVWDVKFSPLGHYFASASHDQTARLW----- 602

Query: 506 NTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL---DS 562
                   D + P+      T     +D+ +V   P+  Y+     D T +++ +   DS
Sbjct: 603 ------ACDHIYPLRIFAGHT-----NDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 651

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
           ++ +L   GH  PVLS  +S D + + T S D  I +W +  G   K +  H ++++ S+
Sbjct: 652 VRLFL---GHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSL 708

Query: 622 KFLPESHNFFSCSKDAVVKYWD 643
            F  E +   S   D  V+ WD
Sbjct: 709 SFNKEGNVLISGGADHSVRVWD 730

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 63/151 (41%), Gaps = 6/151 (3%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 154 VGLYKLRSHKDCI--TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---W 208
             +     H   +  T +   G  WL + S+DG+I LWD+ T + I+    H        
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGR-WLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSL 708

Query: 209 SLSVKDDLLITTGTDSQVKIWKLNMENDKMG 239
           S + + ++LI+ G D  V++W +     + G
Sbjct: 709 SFNKEGNVLISGGADHSVRVWDVKHGTTEQG 739

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 3/145 (2%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +K+W + + T L+N+ GH   +  ++F   G    S S D    +W 
Sbjct: 544 DNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWA 603

Query: 150 LVGEVGLYKLRSH-KDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW 208
                 L     H  D  T  +     ++ + S D   ++WD+ T   +   + HT    
Sbjct: 604 CDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVL 663

Query: 209 SLSVKDD--LLITTGTDSQVKIWKL 231
           S  V  D   L T   D  + +W +
Sbjct: 664 STQVSPDGRWLATGSEDGVICLWDI 688

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVI 103
           S+ +   +WD+ TGD +        P  S             +V  D   LA G  DGVI
Sbjct: 636 SSDKTCRMWDVSTGDSVRLFLGHTAPVLS------------TQVSPDGRWLATGSEDGVI 683

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
            +WD+ +   +    GH K A+  L F+  G  LISG  D ++ VWD+
Sbjct: 684 CLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 5/151 (3%)

Query: 387 LQGQRTDVRSIDISDDNKLLAT-ASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGL 443
             G   DV ++    +   + T +S+ + ++W+V T   +R F       LS +  P G 
Sbjct: 613 FAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGR 672

Query: 444 LVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G+  G + L+D+ +   +  +      A+ SL    +G  L++G AD +V+ WD  
Sbjct: 673 WLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD-- 730

Query: 504 VENTLVPGTKDKLLPMLKLNHDTTLELNDDI 534
           V++       +   P      D T  +N DI
Sbjct: 731 VKHGTTEQGPEPEQPFNAHVGDITASINQDI 761

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +   Q    G  L +GS D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK---TQQCIET 199
           I +WD+     + ++R H K+ +  +    E + LIS   D  +++WD+K   T+Q  E 
Sbjct: 683 ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEP 742

Query: 200 HI---AHTGECWSLSVKDDL 216
                AH G+  + S+  D+
Sbjct: 743 EQPFNAHVGDI-TASINQDI 761

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 64/173 (36%), Gaps = 21/173 (12%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDL---------MSKTVLLNFN---------GHKA 122
           + T LE  +D  L A G+ D  IK+W L          S +    F+         GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 123 AITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTS 181
            +    F      L+SGS D  + +W +     L   + H   +  + +     +  S S
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 182 KDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLN 232
            D   +LW       +     HT +  ++S   +   + T  +D   ++W ++
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVS 647

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 132/285 (46%), Gaps = 29/285 (10%)

Query: 345 TVTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNK 404
           T+T+ K +L+    +  ++ Y I       T+P P+ +     +G R +V S+   +DN+
Sbjct: 39  TITNDK-KLLAAAGHQNVKLYDI-----NTTNPNPVAS----FEGHRGNVTSLSFQNDNR 88

Query: 405 LLATAS-NGSLKIWNVKTHKCIRTFECGYALS-CKFLPGGLLVILGTRTGELQLFDLASS 462
            + T+S +G++K+W+V++    RT++    ++     P    +I   R G ++++DL  +
Sbjct: 89  WMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGEN 148

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPML 520
                +    D  + SL L +DG  LV  ++      W+       +P   D   L P+ 
Sbjct: 149 QCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWE-------MPNRTDASNLKPVT 201

Query: 521 KLN-HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLD-SMKFYLSLYGHKLPVLS 578
           K   HD        I  + +S D ++LA    D+T +++ +D +   + +L GH+  V  
Sbjct: 202 KFRAHDAY------ITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWD 255

Query: 579 IDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
              S DS  +IT+S+D  +++W L   +  +    H    + V  
Sbjct: 256 CAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 123/290 (42%), Gaps = 28/290 (9%)

Query: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442
           +Q   + V  + I++D KLLA A + ++K++++ T     + +FE   G   S  F    
Sbjct: 28  IQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDN 87

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+  T +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSVPRTYK--HNAPVNEVAIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560
             EN              +  H  T E +  + S+ ++ D   L  +       V+ +  
Sbjct: 146 G-EN--------------QCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPN 190

Query: 561 ----DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                ++K       H   +  I +S D K + T SAD   +IW +D   + H +L  HQ
Sbjct: 191 RTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
             +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 251 RWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 123/293 (41%), Gaps = 31/293 (10%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALSCKFLPGG---LLVILGTRTGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +   ++L+D+ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQ--NVKLYDINT 62

Query: 462 SSLLDTVE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPML 520
           ++       + H   + SL   +D + +VT S D T+K WD  V +  VP T     P  
Sbjct: 63  TNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWD--VRSPSVPRTYKHNAP-- 118

Query: 521 KLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSI 579
                        +  V I P+   L     D  ++++ L   +    L      PV S+
Sbjct: 119 -------------VNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSL 165

Query: 580 DISFDSKMIITSSADKNIKIWGLDFGDCHKSL-----FAHQDSIMSVKFLPESHNFFS-C 633
            ++ D  M++ +++  N  +W +       +L     F   D+ ++   L     F + C
Sbjct: 166 SLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATC 225

Query: 634 SKDAVVKYWD-GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D   + W   + F     L  HQ  VW  A +++ ++++++S DH +R+W+
Sbjct: 226 SADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWD 278

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 86/217 (39%), Gaps = 23/217 (10%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDL--MSKTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   L +  D  LLA      V K++D+   +   + +F GH+  +T L F +    ++
Sbjct: 33  SQVNRLTITNDKKLLAAAGHQNV-KLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMV 91

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQ 194
           + S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   
Sbjct: 92  TSSEDGTIKVWD-VRSPSVPRTYKHNAPVNEVAIHPNQGE--LISCDRDGNIRIWDLGEN 148

Query: 195 QCIETHIAHTG---ECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQ 251
           QC            +  SL+    +L+   +     +W+  M N      L  V  F   
Sbjct: 149 QCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWE--MPNRTDASNLKPVTKFRAH 206

Query: 252 SKQRGLKVEFITNA--SDGVSFFYIQNADKTIETFRI 286
                    +IT    S  V F    +AD T   + I
Sbjct: 207 DA-------YITRILLSSDVKFLATCSADHTARIWSI 236

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKY 641
           + K ++ ++  +N+K++ ++  + +   S   H+ ++ S+ F  ++    + S+D  +K 
Sbjct: 42  NDKKLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKV 101

Query: 642 WDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           WD  +   + + Y H + V  +AI  N   ++S   D +IRIW+  E+Q 
Sbjct: 102 WD-VRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 84/244 (34%), Gaps = 64/244 (26%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L  +  +NV ++DI T +         P   +   G +    T L    D   +     D
Sbjct: 47  LAAAGHQNVKLYDINTTN---------PNPVASFEGHR-GNVTSLSFQNDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL---------- 150
           G IKVWD+ S +V   +  H A +  +        LIS  RD NI +WDL          
Sbjct: 97  GTIKVWDVRSPSVPRTYK-HNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 151 -----------------------------VGEVG----------LYKLRSHKDCITGIWC 171
                                        V E+           + K R+H   IT I  
Sbjct: 156 PEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLWDLKTQQCIETHI-AHTGECWSLSVKDD--LLITTGTDSQVK 227
             +  +L + S D   ++W +     + T +  H    W  +   D   LIT  +D  V+
Sbjct: 216 SSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVR 275

Query: 228 IWKL 231
           +W L
Sbjct: 276 LWDL 279

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 134/300 (44%), Gaps = 28/300 (9%)

Query: 394 VRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGY---ALSCKFLPGGLLVILGT 449
           V  + IS D+ ++AT S  G LKI + +T + I+ F+  +        + P G  ++ G 
Sbjct: 185 VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGA 244

Query: 450 RTGELQLFDLA--SSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF--QVE 505
             GE+++++L   S S   T+   H+  +  +     GK + + S D T + WD   Q+E
Sbjct: 245 ANGEIRIWNLNNDSESPAGTLT-GHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIE 303

Query: 506 NTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF 565
             L  G                     ++  V    D   L  + LD+   V+ L S K 
Sbjct: 304 LQLQEGHA------------------KEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKS 345

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-L 624
            ++L GH  P+  +D S +   I T SAD  I++W +       +L AH   +  VKF  
Sbjct: 346 IMALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDK 405

Query: 625 PESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
              H   S S D  +  + G+ +  +  +  H  ++ ++ I+++GS + SS  D S++ W
Sbjct: 406 ANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 113/255 (44%), Gaps = 32/255 (12%)

Query: 353 LVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-N 411
           LV   +N  I  +++     ++ SPA        L G    V  +      K +A+AS +
Sbjct: 240 LVTGAANGEIRIWNL---NNDSESPAGT------LTGHENRVARVRFHPSGKYVASASFD 290

Query: 412 GSLKIWNVKTHKCIRTFECGYALSCKFLP----GGLLVILGTRTGELQLFDLASSSLLDT 467
            + ++W+V+    ++  E G+A     +     G LL   G  +  L ++DL S   +  
Sbjct: 291 MTWRLWDVEKQIELQLQE-GHAKEVYCVAFQKDGSLLCSTGLDSVGL-VWDLRSGKSIMA 348

Query: 468 VEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTT 527
           +E  H   I+ LD + +G  + TGSAD T++ WD +         K  +L  L  ++   
Sbjct: 349 LE-GHIKPIYGLDWSPNGYDIATGSADGTIRLWDVR---------KVGILGALPAHNSIV 398

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
            E+  D        +  YL  S  D T+ ++  D+      + GH   +LS+DIS D   
Sbjct: 399 SEVKFD------KANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSH 452

Query: 588 IITSSADKNIKIWGL 602
           + +S  D+++K W L
Sbjct: 453 LFSSGWDRSLKQWSL 467

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 69/152 (45%), Gaps = 3/152 (1%)

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADK 595
           V IS DD  +A       +K+   ++++   +    H   +  +D + D   ++T +A+ 
Sbjct: 188 VAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANG 247

Query: 596 NIKIWGL--DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL 653
            I+IW L  D      +L  H++ +  V+F P      S S D   + WD EK   +Q  
Sbjct: 248 EIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQ 307

Query: 654 YAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
             H  EV+ +A   +GS + S+  D    +W+
Sbjct: 308 EGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWD 339

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 70/158 (44%), Gaps = 6/158 (3%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E   +   +D  LL     D V  VWDL S   ++   GH   I  L +   G  + +GS
Sbjct: 313 EVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGS 372

Query: 141 RDSNIIVWDLVGEVG-LYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCI 197
            D  I +WD V +VG L  L +H   ++ +     +  +L+S+S D  + ++       +
Sbjct: 373 ADGTIRLWD-VRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKL 431

Query: 198 ETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLNM 233
                HT +  S+ +  D   L ++G D  +K W L +
Sbjct: 432 SVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKI 469

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 76/205 (37%), Gaps = 26/205 (12%)

Query: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60
           ++K++     S I GV        W P  +    G+  G+        + IW++      
Sbjct: 216 IIKAFDTAHDSKIGGVD-------WNPDGTALVTGAANGE--------IRIWNLNN---- 256

Query: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
                  P G      ++ A   +   H     +A    D   ++WD+  +  L    GH
Sbjct: 257 ---DSESPAGTLTGHENRVARVRF---HPSGKYVASASFDMTWRLWDVEKQIELQLQEGH 310

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLIS 179
              +  + F   G+ L S   DS  +VWDL     +  L  H   I G+ W      + +
Sbjct: 311 AKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIAT 370

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHT 204
            S DG I+LWD++    +    AH 
Sbjct: 371 GSADGTIRLWDVRKVGILGALPAHN 395

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 77/161 (47%), Gaps = 8/161 (4%)

Query: 77  SKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN-GHKAAITLLQFDSTGTR 135
           S+P   + + +  D  ++A     G +K+    +  ++  F+  H + I  + ++  GT 
Sbjct: 182 SRP--VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTA 239

Query: 136 LISGSRDSNIIVWDLVG--EVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           L++G+ +  I +W+L    E     L  H++ +  + +     ++ S S D   +LWD++
Sbjct: 240 LVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVE 299

Query: 193 TQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKL 231
            Q  ++    H  E + ++ + D  LL +TG DS   +W L
Sbjct: 300 KQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDL 340

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 60/124 (48%), Gaps = 5/124 (4%)

Query: 385 IELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYAL--SCKF-LP 440
           + L+G    +  +D S +   +AT S +G++++W+V+    +       ++    KF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 441 GGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            G  ++  +    L ++   + + L  ++  H   I S+D+++DG  L +   D+++K W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQ-GHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

Query: 501 DFQV 504
             ++
Sbjct: 466 SLKI 469

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 130/295 (44%), Gaps = 39/295 (13%)

Query: 393 DVRSIDISDDNKLLATA-SNGSLKIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTRT 451
           D+ S++ SDD +L A    +  +KI+++           G +L+ K      L     +T
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LTESNKKT 541

Query: 452 GELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            +L   D ++S+L+      H   ++S   + D + LV+GS DKTV+ W      +LV  
Sbjct: 542 NKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLV-- 594

Query: 512 TKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  V  SP   Y A +  D+T +++  D +       G
Sbjct: 595 --------------SYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAG 640

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V  +    +   + T S+DK  ++W +  GD  +        +MS    P+     
Sbjct: 641 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLS 700

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           + S+D V+  WD    + ++++  H ++ +++L+    G+ ++S   DHS+R+W+
Sbjct: 701 TGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 20/175 (11%)

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLD--SMKFYLS------------------LYGH 572
           D+ S+  S D R  A    D+ +K+F LD  S+   L+                  L GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V S   S D++ +++ S DK +++W +D      S   H   +  V+F P  H F +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEET 687
            S D   + W  +    ++    H ++V  ++   NG ++ + S D + R+W+ T
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIT 672

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/268 (21%), Positives = 104/268 (38%), Gaps = 65/268 (24%)

Query: 384 TIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALSCKFLPGG 442
           T  L G    V S   S DN+ L + S + ++++W++ TH  + +++             
Sbjct: 551 TSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYK------------- 597

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                                        H+  +W ++ +  G    T S D T + W  
Sbjct: 598 ----------------------------GHNHPVWDVEFSPLGHYFATASHDHTARLW-- 627

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL-- 560
                    + D + P+          LN D+  V   P+  YL     D T +++ +  
Sbjct: 628 ---------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYLFTGSSDKTCRMWDITT 673

Query: 561 -DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSI 618
            DS++ +L L     PV+S  +S D + + T S D  I +W +  G   K +  H +++I
Sbjct: 674 GDSVRLFLGLTA---PVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAI 730

Query: 619 MSVKFLPESHNFFSCSKDAVVKYWDGEK 646
            S+ +  E +   S   D  V+ WD +K
Sbjct: 731 YSLSYNKEGNVLISGGADHSVRVWDLKK 758

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 68/156 (43%), Gaps = 6/156 (3%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLV-- 151
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +WD+   
Sbjct: 615 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTG 674

Query: 152 GEVGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSL 210
             V L+   +     T +   G  WL + S+DG+I +WD+ T + ++    H     +SL
Sbjct: 675 DSVRLFLGLTAPVMSTSVSPDGR-WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSL 733

Query: 211 SV--KDDLLITTGTDSQVKIWKLNMENDKMGEKLTE 244
           S   + ++LI+ G D  V++W L     + G +  E
Sbjct: 734 SYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEE 769

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 62/150 (41%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 569 DNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWS 628

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC++  +     +L + S D   ++WD+ T   +   +  
Sbjct: 629 C---DHIYPLRIFAGHLNDVDCVS--FHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGL 683

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKL 231
           T    S SV  D   L T   D  + +W +
Sbjct: 684 TAPVMSTSVSPDGRWLSTGSEDGVINVWDI 713

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   L  G +D   ++WD+ +   +  F G  A +        G  L +GS D  
Sbjct: 648 VSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGV 707

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ I  +    E + LIS   D  +++WDLK
Sbjct: 708 INVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 62/174 (35%), Gaps = 23/174 (13%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTV-------------LLNFN-------GH 120
           + T LE  +D  L A G+ D  IK++ L   ++             LLN +       GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLIS 179
              +    F      L+SGS D  + +W +     L   + H   +  + +     +  +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQVKIWKL 231
            S D   +LW       +     H    +C S       L T  +D   ++W +
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 91/203 (44%), Gaps = 18/203 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHDTTLELNDDILSVR----------ISPDDRYLAISLLDNTV 555
           N L+ G++DK L   KL  D   +    + S R          ++PD  Y   +  D TV
Sbjct: 31  NLLLSGSRDKSLITWKLTGDDQ-QYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTV 89

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
           +++ L S K      GHK  VLS+ I   +  I+++S DK +K+W    G+C  +L  H 
Sbjct: 90  RLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGECMVTLLGHN 148

Query: 616 DSIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNG 669
           D +  V+  P      E+    S   D VVK W+   F+       H + V  +  + +G
Sbjct: 149 DWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDG 208

Query: 670 SFVVSSSHDHSIRIWEETEDQVF 692
           + V S+  D  I +W  TE +  
Sbjct: 209 TLVASAGKDGQIMLWNLTEKEAL 231

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++W+L S   +  F GHK+ +  +  D   ++++S SRD  + VW+ +GE  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 160 RSHKDCITGIWCQGED-------WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +     +        +IS   D ++K+W+L + Q     I H     +++ 
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D Q+ +W L
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDIS-FDSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK++  W L      +G   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSI 681
              P+     S S D  V+ W+    +CIQ+   H+S+V ++ I    S +VS+S D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 15/125 (12%)

Query: 117 FNGHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-----VGLYKLRSH----KDCI 166
             GH   +T L        L+ SGSRD ++I W L G+     V +   R H    +DC 
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 167 TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDS 224
             +   GE + +S S D  ++LW+L + +CI+  + H  +  S+++  +   +++   D 
Sbjct: 73  --VTPDGE-YALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDK 129

Query: 225 QVKIW 229
            VK+W
Sbjct: 130 TVKVW 134

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 98/227 (43%), Gaps = 25/227 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   +    +T DG+  ++ S DKTV+ W+             K +    + H +    
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLWEL---------ASGKCIQRF-VGHKS---- 108

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD------ 584
             D+LSV I      +  +  D TVKV+     +  ++L GH   V  + ++ +      
Sbjct: 109 --DVLSVTIDRRASQIVSASRDKTVKVWNTLG-ECMVTLLGHNDWVSQVRVAPNETPEDE 165

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
           +  +I++  DK +K+W L           H + + +V   P+     S  KD  +  W+ 
Sbjct: 166 TVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNL 225

Query: 645 EKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
            + E +  L A Q EV+A+A + N  + ++++    I+I+   E +V
Sbjct: 226 TEKEALYTLNA-QDEVFAVAFSPN-RYWLTAATSSGIKIFNLEERKV 270

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D V+KVW+L S  +  +F GH   +  +     GT + S  +D  I++W+L  +  LY L
Sbjct: 175 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTL 234

Query: 160 RSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +     +     WL + +  G IK+++L+ ++ ++
Sbjct: 235 NAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 12/128 (9%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G    V ++  S D  L+A+A  +G + +WN+   + + T        +  F P    + 
Sbjct: 194 GHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEVFAVAFSPNRYWLT 253

Query: 447 LGTRTGELQLFDLASSSLLDTVED--------AHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T +G +++F+L    ++D ++         A   AI SL  ++DG+ L  G  D  ++
Sbjct: 254 AATSSG-IKIFNLEERKVVDELKPEFAGYTKAAEPHAI-SLAWSADGQTLFAGYTDNVIR 311

Query: 499 FWDFQVEN 506
            W     N
Sbjct: 312 VWQVMTAN 319

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 68/165 (41%), Gaps = 18/165 (10%)

Query: 92  DLLAVGYADGVIKVWDLMS-----KTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNII 146
           +LL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVR 90

Query: 147 VWDLVGEVGLYKLRSHK-DCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           +W+L     + +   HK D ++    +    ++S S+D  +K+W+    +C+ T + H  
Sbjct: 91  LWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGHND 149

Query: 206 ECWSLSVKDD--------LLITTGTDSQVKIWKLN---MENDKMG 239
               + V  +         +I+ G D  VK+W L+   +E D +G
Sbjct: 150 WVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIG 194

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 96/216 (44%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   ++S   + D K L++GS DKTV+ W       LV                +    
Sbjct: 525 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 568

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFT 628

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   ++S+   P+     + S+D ++  WD    + +
Sbjct: 629 GSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRL 688

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H ++ +++L+ +  G+ ++S   DHS+R+W+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 19/173 (10%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFY-------------------LSLYG 571
           N D+  +  S D R  A    D+ +K++ LD                         +L G
Sbjct: 466 NKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVG 525

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V S   S D+K +++ S DK +++W +D      S   H   +  V F P  H F 
Sbjct: 526 HSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
           + S D   + W  +    ++    H ++V  ++   NG ++ + S D + R+W
Sbjct: 586 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMW 638

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 58/139 (41%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G      S+ +   +W++ TGD +        P  S
Sbjct: 606 IFAGHLNDVDCVSFHPN-------GCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVIS 658

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
                       + V  D   L+ G  DG+I VWD+ +   L    GH K AI  L +  
Sbjct: 659 ------------IAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSK 706

Query: 132 TGTRLISGSRDSNIIVWDL 150
            G  LISG  D ++ VWDL
Sbjct: 707 EGNVLISGGADHSVRVWDL 725

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 63/150 (42%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 538 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 597

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC++  +     +L + S D   ++W++ T   +   + H
Sbjct: 598 C---DHIYPLRIFAGHLNDVDCVS--FHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGH 652

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKL 231
           T    S++V  D   L T   D  + +W +
Sbjct: 653 TAPVISIAVSPDGRWLSTGSEDGIINVWDI 682

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   L  G +D   ++W++ +   +  F GH A +  +     G  L +GS D  
Sbjct: 617 VSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ I  + + +  + LIS   D  +++WDLK
Sbjct: 677 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/186 (19%), Positives = 63/186 (33%), Gaps = 33/186 (17%)

Query: 79  PAECTY-----------LEVHEDTDLLAVGYADGVIKVWDL-----MSKTVLLN------ 116
           P+ C Y           L+  +D  + A G+ D  IK+W L      +  ++LN      
Sbjct: 455 PSVCMYTFQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYK 514

Query: 117 --------FNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITG 168
                     GH   +    F      L+SGS D  + +W +     L   + H   +  
Sbjct: 515 DDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWD 574

Query: 169 I-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQ 225
           + +     +  + S D   +LW       +     H    +C S       L T  +D  
Sbjct: 575 VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 634

Query: 226 VKIWKL 231
            ++W +
Sbjct: 635 CRMWNV 640

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 96/216 (44%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   ++S   + D K L++GS DKTV+ W       LV                +    
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 566

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 567 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   ++S+   P+     + S+D ++  WD    + +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H ++ +++L+ +  G+ ++S   DH++R+W+
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 72/172 (41%), Gaps = 17/172 (9%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL-----------------SLYGHK 573
           N D+  +  S D R  A    D+ +K++ LD                       +L GH 
Sbjct: 466 NKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHS 525

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
             V S   S D+K +++ S DK +++W +D      S   H   +  V F P  H F + 
Sbjct: 526 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATA 585

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           S D   + W  +    ++    H ++V  ++   NG +V + S D + R+W+
Sbjct: 586 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 637

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLVILGTRTGELQLFDLASS 462
           +   +S+ + ++W+V T   +R F       +S    P G  +  G+  G + ++D+ + 
Sbjct: 624 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
             L  +      AI+SL  + +G  L++G AD TV+ WD +   T      D+  P +  
Sbjct: 684 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDE--PFIGY 741

Query: 523 NHDTTLELNDDI 534
             D T  +N DI
Sbjct: 742 LGDVTASINQDI 753

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 57/139 (41%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G      S+ +   +WD+ TGD +        P  S
Sbjct: 604 IFAGHLNDVDCVSFHPN-------GCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIS 656

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
                       + V  D   L+ G  DG+I VWD+ +   L    GH K AI  L +  
Sbjct: 657 ------------IAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSK 704

Query: 132 TGTRLISGSRDSNIIVWDL 150
            G  LISG  D  + VWDL
Sbjct: 705 EGNVLISGGADHTVRVWDL 723

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 67/188 (35%), Gaps = 46/188 (24%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 536 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 595

Query: 150 ---------LVGEV-----------GLYKLRSHKDCITGIW------------------- 170
                      G +           G Y      D    +W                   
Sbjct: 596 CDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVI 655

Query: 171 ----CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WSLSVKDDLLITTGTD 223
               C    WL + S+DG+I +WD+ T + ++    H        S S + ++LI+ G D
Sbjct: 656 SIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGAD 715

Query: 224 SQVKIWKL 231
             V++W L
Sbjct: 716 HTVRVWDL 723

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS D  
Sbjct: 615 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGI 674

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ I  + + +  + LIS   D  +++WDLK
Sbjct: 675 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/182 (18%), Positives = 59/182 (32%), Gaps = 31/182 (17%)

Query: 79  PAECTY-----------LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN--------- 118
           P+ C Y           L+  +D  + A G+ D  IK+W L   ++              
Sbjct: 455 PSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDE 514

Query: 119 --------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI- 169
                   GH   +    F      L+SGS D  + +W +     L   + H   +  + 
Sbjct: 515 DPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVS 574

Query: 170 WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQVK 227
           +     +  + S D   +LW       +     H    +C S       + T  +D   +
Sbjct: 575 FSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCR 634

Query: 228 IW 229
           +W
Sbjct: 635 MW 636

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 123/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410
           +L+    +  +  Y I       T+P P+ +     +G R +V S+    DNK +AT+S 
Sbjct: 45  KLLAAAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNKWMATSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469
           +G++K+W+V+     R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527
              D  + SL L SDG  LV  +       W+       +P   D   L P+ K     T
Sbjct: 156 PEDDTPLQSLSLASDGSMLVAANNKGNCYVWE-------MPNRTDASNLKPVTKFRSHNT 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLD-SMKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D + K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/291 (18%), Positives = 121/291 (41%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALSCKF-LPGGLLVILGTRTGELQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +  +     ++       ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 464 LLDTVE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
                  + H   + S+    D K + T S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRA-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSIDI 581
           N+    +LN  +  V I P+   L     D  ++++ L   +    L      P+ S+ +
Sbjct: 112 NY----KLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSL 167

Query: 582 SFDSKMIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M++ ++   N  +W +       +L       +H   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           D   + W   + F+    L  HQ  VW  A +++ ++++++S DH +R+W+
Sbjct: 228 DHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWD 278

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 74/180 (41%), Gaps = 12/180 (6%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      + 
Sbjct: 33  SQVNRLEITNDKKLLAAAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMA 91

Query: 138 SGSRDSNIIVWDLVGE--VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           + S D  I VWD+        YKL +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  TSSEDGTIKVWDVRAPSIPRNYKLNAPVNEVVIHPNQGE--LISCDRDGHIRIWDLGENQ 149

Query: 196 CIETHIAHTG---ECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQS 252
           C            +  SL+    +L+         +W+  M N      L  V  F   +
Sbjct: 150 CTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWE--MPNRTDASNLKPVTKFRSHN 207

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 59/118 (50%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++  ++  +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLL-AAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y   + V  + I  N   ++S   D  IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQC 150

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 126/301 (41%), Gaps = 39/301 (12%)

Query: 387 LQGQRTDVRSIDISDDNKLLATASNGS-LKIWNVKTHKCIRTFECGYALSCKFLPGGLLV 445
            Q    D+  ++ SDD ++ A     S +KIW++           G +L+         +
Sbjct: 463 FQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLD----------GSSLNNPN------I 506

Query: 446 ILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
           +L +     +  D    +L+      H   ++S   + D K L++GS DKTV+ W     
Sbjct: 507 MLNSANNNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTH 561

Query: 506 NTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF 565
             LV                +    N  +  V  SP   Y A +  D T +++  D +  
Sbjct: 562 TALV----------------SYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYP 605

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
                GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++ +   P
Sbjct: 606 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSP 665

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIW 684
           +     + S+D ++  WD    + ++++  H ++ +++L+ +  G+ ++S   DHS+R+W
Sbjct: 666 DGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 725

Query: 685 E 685
           +
Sbjct: 726 D 726

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 59/139 (42%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G      S+ +   +WD+ TGD +            
Sbjct: 608 IFAGHLNDVDCVSFHPN-------GCYVFTGSSDKTCRMWDVSTGDSVRLF--------- 651

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
               + P  C  + V  D   L+ G  DG+I +WD+ +   L    GH K AI  L +  
Sbjct: 652 -LGHTAPVIC--IAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSK 708

Query: 132 TGTRLISGSRDSNIIVWDL 150
            G  LISG  D ++ VWDL
Sbjct: 709 EGNVLISGGADHSVRVWDL 727

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 540 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 599

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC++  +     ++ + S D   ++WD+ T   +   + H
Sbjct: 600 C---DHIYPLRIFAGHLNDVDCVS--FHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGH 654

Query: 204 TGE--CWSLSVKDDLLITTGTDSQVKIWKL 231
           T    C ++S     L T   D  + IW +
Sbjct: 655 TAPVICIAVSPDGRWLSTGSEDGIINIWDI 684

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS D  
Sbjct: 619 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 678

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I +WD+     L ++R H K+ I  + + +  + LIS   D  +++WDLK
Sbjct: 679 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/185 (18%), Positives = 61/185 (32%), Gaps = 34/185 (18%)

Query: 79  PAECTY-----------LEVHEDTDLLAVGYADGVIKVWDL-----MSKTVLLN------ 116
           P+ C Y           L   +D  + A G+ D  IK+W L      +  ++LN      
Sbjct: 456 PSVCMYTFQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNY 515

Query: 117 ---------FNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCIT 167
                      GH   +    F      L+SGS D  + +W +     L   + H   + 
Sbjct: 516 RDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVW 575

Query: 168 GI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDS 224
            + +     +  + S D   +LW       +     H    +C S       + T  +D 
Sbjct: 576 DVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDK 635

Query: 225 QVKIW 229
             ++W
Sbjct: 636 TCRMW 640

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 114/269 (42%), Gaps = 26/269 (9%)

Query: 442 GLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501
           G  +  G   G +++    +  +  +++ AH+  I  LD   DG  L++G  D  VK WD
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 502 F------QVENTLVPGTKDKLLPMLKLNHDTTLEL-------------------NDDILS 536
                  ++       ++ K+ P  +L    + +L                   +  + +
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKN 596
           +    D   LA + LD    ++ L S +  + L GH   +  +D S +   + T+ AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 597 IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF-SCSKDAVVKYWDGEKFECIQKLYA 655
           +++W +       +L AHQ + + VKF   +  F  SC  D +V  ++ + ++ +  L  
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 656 HQSEVWALAIASNGSFVVSSSHDHSIRIW 684
           H   V+ + I  +GS + S   D S++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 74/183 (40%), Gaps = 7/183 (3%)

Query: 57  GDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLN 116
           GD L  L D       + RG      + ++VH    L A    D    +WDL  K  L  
Sbjct: 235 GDNLVKLWDMTSNSFEELRG-HAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQL 293

Query: 117 FNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGED 175
             GH  A+  + F S G  L S   D+   +WDL     + KL  H   I+G+ W     
Sbjct: 294 QEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGY 353

Query: 176 WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDD---LLITTGTDSQVKIWKLN 232
            L +   DG +++WD++        +AH      +  K +    L++ G D  V I   N
Sbjct: 354 QLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNI--FN 411

Query: 233 MEN 235
            +N
Sbjct: 412 ADN 414

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 69/150 (46%), Gaps = 4/150 (2%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           L+ H D + L  G  D ++K+WD+ S +      GH   ++ ++   +G    S S D  
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSGRLAASASFDLT 279

Query: 145 IIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLISTSK-DGMIKLWDLKTQQCIETHIAH 203
            I+WDL  +V L     H   +  I  Q +  L++++  D +  +WDL++ + I     H
Sbjct: 280 WILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH 339

Query: 204 TGECWSL--SVKDDLLITTGTDSQVKIWKL 231
            G    +  S     L T G D  V++W +
Sbjct: 340 AGAISGVDWSPNGYQLATAGADGTVRVWDI 369

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 106/273 (38%), Gaps = 34/273 (12%)

Query: 425 IRTFECGYALSCKFLPG---------GLLVILGTRTGE---LQLFDLASSSLLDTVEDAH 472
           +R F  GY+L C              G+   L  R  E   L  F+L  S L   V D H
Sbjct: 118 VRKFLVGYSLDCAARRLAAQRARQGLGVKAYLQQRRAEGKRLATFELVGSQL---VADKH 174

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELND 532
              +  + +  DG++L TG    ++K         +V      +   +   H+       
Sbjct: 175 ---VSQVAVHRDGQQLATGCWGGSIK---------VVSCETLGIAKSIDAAHEGK----- 217

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
            I  +   PD  +L     DN VK++ + S  F   L GH   V  + +    ++  ++S
Sbjct: 218 -IGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFE-ELRGHAGRVSRVKVHPSGRLAASAS 275

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQK 652
            D    +W L+     +    H  ++ ++ F  +     S   DAV   WD    E I K
Sbjct: 276 FDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMK 335

Query: 653 LYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           L  H   +  +  + NG  + ++  D ++R+W+
Sbjct: 336 LEGHAGAISGVDWSPNGYQLATAGADGTVRVWD 368

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 65/144 (45%), Gaps = 4/144 (2%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D  LLA    D V  +WDL S   ++   GH  AI+ + +   G +L +   D  + VWD
Sbjct: 309 DGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWD 368

Query: 150 LVGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
           +        L +H+     +  +  +  +L+S   D ++ +++    Q + +   HT   
Sbjct: 369 IRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEGHTDRV 428

Query: 208 WSLSVKDD--LLITTGTDSQVKIW 229
           +++ + +D   + + G D  +K W
Sbjct: 429 FTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 5/153 (3%)

Query: 83  TYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNG-HKAAITLLQFDSTGTRLISGSR 141
           + + VH D   LA G   G IKV    +  +  + +  H+  I  L +   G  L+SG  
Sbjct: 176 SQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGG 235

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWL-ISTSKDGMIKLWDLKTQQCIETH 200
           D+ + +WD+       +LR H   ++ +       L  S S D    LWDL+ +  ++  
Sbjct: 236 DNLVKLWDMTSN-SFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQ 294

Query: 201 IAHTGECWSLSVKDD--LLITTGTDSQVKIWKL 231
             H+   ++++ + D  LL + G D+   IW L
Sbjct: 295 EGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL 327

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 110/245 (44%), Gaps = 13/245 (5%)

Query: 440 PGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G  +  G+  G++++    S  ++ +++ AHD  I  +  +SD + L TG AD  VK 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 500 WDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           W+ Q +      +  +   ++   H+        +  V+  P DR++A +  D T +++ 
Sbjct: 252 WNPQAQ------SHSEASRVVLRGHEAR------VSKVKFHPSDRFVASASFDMTWRLWD 299

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++         GH   V  +D   D  ++ ++  D    +W +  G     L  H   I 
Sbjct: 300 VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI-ASNGSFVVSSSHD 678
            V + P  H+  + S D  V+ WD  K      + AH S V  +     NG+F+VSSS+D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 679 HSIRI 683
            +I +
Sbjct: 420 RTIGV 424

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 127/300 (42%), Gaps = 60/300 (20%)

Query: 325 VLHP--FQTIRSFY-----KVKSASWTTVTSSKLELVLTTSNNTIEYYSIPYEKREATSP 377
           +LHP   + +RS       K+   +W++   S+L L    ++N ++ ++   +     S 
Sbjct: 208 ILHPQSLEVVRSLDGAHDDKIGGVAWSS--DSQL-LATGGADNLVKIWNPQAQSHSEAS- 263

Query: 378 APLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHK------------- 423
                  + L+G    V  +     ++ +A+AS + + ++W+V+                
Sbjct: 264 ------RVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVY 317

Query: 424 CIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTS 483
           C+  F+C  +L C      +  +   RTG          SL+  V + H   I+ +  + 
Sbjct: 318 CL-DFQCDGSLLCSAGLDSVGHVWDMRTGR---------SLM--VLEGHAKPIYGVSWSP 365

Query: 484 DGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTL-ELNDDILSVRISPD 542
           +G  + TGS D TV+ WD +  N           P   L H++ + E+N +        +
Sbjct: 366 NGHHVATGSGDGTVQVWDIRKANK----------PSSILAHNSIVSEVNFE------KEN 409

Query: 543 DRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
             +L  S  D T+ VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 410 GNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 79/190 (41%), Gaps = 13/190 (6%)

Query: 509 VPGTKDKLLPMLKLN--------HDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFL 560
           V   +D +    KLN        H + +  +  +  V  SPD   LA    +  VK+   
Sbjct: 152 VQNVRDIIQKRRKLNIDHSSYELHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHP 211

Query: 561 DSMKFYLSLYG-HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKS----LFAHQ 615
            S++   SL G H   +  +  S DS+++ T  AD  +KIW        ++    L  H+
Sbjct: 212 QSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHE 271

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSS 675
             +  VKF P      S S D   + WD E+   +Q    H  EV+ L    +GS + S+
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 676 SHDHSIRIWE 685
             D    +W+
Sbjct: 332 GLDSVGHVWD 341

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 102/252 (40%), Gaps = 27/252 (10%)

Query: 400 SDDNKLLATASNGSL-KIWN--VKTHK-----CIRTFECGYALSCKFLPGGLLVILGTRT 451
           S D++LLAT    +L KIWN   ++H       +R  E   +   KF P    V   +  
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVS-KVKFHPSDRFVASASFD 292

Query: 452 GELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
              +L+D+   + L  +++ H   ++ LD   DG  L +   D     WD +   +L   
Sbjct: 293 MTWRLWDVERETEL-QLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSL--- 348

Query: 512 TKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                  M+   H         I  V  SP+  ++A    D TV+V+ +       S+  
Sbjct: 349 -------MVLEGHAKP------IYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILA 395

Query: 572 HKLPVLSIDISFDS-KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           H   V  ++   ++   +++SS D+ I ++         SL  H D I+SV       N 
Sbjct: 396 HNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILSVDISRGGANL 455

Query: 631 FSCSKDAVVKYW 642
           +S   D  VK W
Sbjct: 456 WSSGWDRSVKIW 467

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 54/126 (42%), Gaps = 1/126 (0%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISG 139
           A  + ++ H     +A    D   ++WD+  +T L    GH   +  L F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 140 SRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
             DS   VWD+     L  L  H   I G+ W      + + S DG +++WD++      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 199 THIAHT 204
           + +AH 
Sbjct: 392 SILAHN 397

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 71/159 (44%), Gaps = 4/159 (2%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E   L+   D  LL     D V  VWD+ +   L+   GH   I  + +   G  + +GS
Sbjct: 315 EVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGS 374

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCIE 198
            D  + VWD+        + +H   ++ +  + E+  +L+S+S D  I ++   +   + 
Sbjct: 375 GDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLA 434

Query: 199 THIAHTGECWSLSVKDDL--LITTGTDSQVKIWKLNMEN 235
           +   HT +  S+ +      L ++G D  VKIW L + +
Sbjct: 435 SLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 11/155 (7%)

Query: 90  DTDLLAVGYADGVIKVWDLM----SKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNI 145
           D+ LLA G AD ++K+W+      S+   +   GH+A ++ ++F  +   + S S D   
Sbjct: 236 DSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTW 295

Query: 146 IVWDLVGEVGLYKLRSHKD---CITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIA 202
            +WD+  E  L     H     C+    C G   L S   D +  +WD++T + +     
Sbjct: 296 RLWDVERETELQLQEGHAKEVYCLD-FQCDGS-LLCSAGLDSVGHVWDMRTGRSLMVLEG 353

Query: 203 HTGECWSLS-VKDDLLITTGT-DSQVKIWKLNMEN 235
           H    + +S   +   + TG+ D  V++W +   N
Sbjct: 354 HAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKAN 388

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 69/157 (43%), Gaps = 16/157 (10%)

Query: 39  GQLITSA-LENV-NIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G L+ SA L++V ++WD++TG  L  L     P               +    +   +A 
Sbjct: 325 GSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKP------------IYGVSWSPNGHHVAT 372

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFD-STGTRLISGSRDSNIIVWDLVGEVG 155
           G  DG ++VWD+       +   H + ++ + F+   G  L+S S D  I V+     + 
Sbjct: 373 GSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIK 432

Query: 156 LYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDL 191
           L  L+ H D I  +   +G   L S+  D  +K+W L
Sbjct: 433 LASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 116/284 (40%), Gaps = 38/284 (13%)

Query: 424 CIRTFEC--GYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDA---------- 471
           C+ TF    G   S +F     LV  G +   ++L+ L  SSL    E +          
Sbjct: 479 CMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMN 538

Query: 472 ---------HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
                    H  A++S   + D + L++GS DKTV+ W      +LV             
Sbjct: 539 DNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLV------------- 585

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS 582
              +    N  +  V+ SP   Y A +  D T +++  D +       GH   V  +   
Sbjct: 586 ---SYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFH 642

Query: 583 FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
            +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+D ++  W
Sbjct: 643 PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 643 DGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           D    + ++ +  H ++ + +L+    G+ +VS   DHS+R+W+
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 68/156 (43%), Gaps = 6/156 (3%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VG 152
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+  G
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTG 665

Query: 153 E-VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---W 208
           + V L+   +     T +   G  WL + S+DG+I LWD+ T + ++    H        
Sbjct: 666 DSVRLFLGHTAPVLCTAVSPDGR-WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSL 724

Query: 209 SLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTE 244
           S   + ++L++ G D  V++W L     + G +  E
Sbjct: 725 SYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEE 760

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +        G  L +GS D  
Sbjct: 639 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGI 698

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I +WD+     L  +R H K+ I  + +C+  + L+S   D  +++WDLK
Sbjct: 699 INLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 62/150 (41%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W   + T L+++ GH   +  +QF   G    + S D    +W 
Sbjct: 560 DNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWS 619

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      S  DC++  +     ++ + S D   ++WD+ T   +   + H
Sbjct: 620 C---DHIYPLRIFAGHLSDVDCVS--FHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGH 674

Query: 204 TGE--CWSLSVKDDLLITTGTDSQVKIWKL 231
           T    C ++S     L T   D  + +W +
Sbjct: 675 TAPVLCTAVSPDGRWLATGSEDGIINLWDI 704

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 4/126 (3%)

Query: 389 GQRTDVRSIDISDDNKLLAT-ASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLV 445
           G  +DV  +    +   + T +S+ + ++W++ T   +R F       L     P G  +
Sbjct: 631 GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWL 690

Query: 446 ILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
             G+  G + L+D+ ++  L  +      AI SL    +G  LV+G AD +V+ WD + +
Sbjct: 691 ATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK-K 749

Query: 506 NTLVPG 511
           +T  PG
Sbjct: 750 STAEPG 755

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 59/172 (34%), Gaps = 23/172 (13%)

Query: 83  TYLEVHEDTDLLAVGYADGVIKVWDL--------------------MSKTVLLNFNGHKA 122
           T L+  ED+ L+A G+ D  IK+W L                    M+        GH  
Sbjct: 491 TSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSG 550

Query: 123 AITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTS 181
           A+    F      L+SGS D  + +W       L   + H   +  + +     +  + S
Sbjct: 551 AVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATAS 610

Query: 182 KDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTDSQVKIWKL 231
            D   +LW       +     H    +C S       + T  +D   ++W +
Sbjct: 611 HDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDI 662

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 125/277 (45%), Gaps = 26/277 (9%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469
           +G++K+W+V++    R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527
              D ++ SL + SDG  L   ++      W+       +P   D   L P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWE-------MPNRTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 124/290 (42%), Gaps = 28/290 (9%)

Query: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442
           +Q   + V  ++I++D KLLATA + ++++++++T     + +FE   G   S  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + S+ ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 RTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
             +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + ++S+   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 10/179 (5%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQ 194
           + S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   
Sbjct: 92  TSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148

Query: 195 QCIETHIAHTG-ECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQS 252
           QC             SLS+  D  +    +S+   +   M N      L  V  F   S
Sbjct: 149 QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHS 207

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 87/246 (35%), Gaps = 66/246 (26%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   +D   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNI--------------- 145
           G IKVWD+ S ++  N+  H A +  +        LIS  RD NI               
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 146 ----------------------------IVWDLVGEVG------LYKLRSHKDCITGIWC 171
                                        VW++           + K R+H   IT I  
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQV 226
             +   L + S D   ++W    D K +  ++ H     +C + S     L+T  +D  V
Sbjct: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAYLVTASSDHYV 274

Query: 227 KIWKLN 232
           ++W L+
Sbjct: 275 RLWDLS 280

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   ++S   + D K L++ S DKTV+ W     ++LV                +    
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLV----------------SYKGH 517

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 518 NHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFT 577

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S DK  ++W +  GD  +    H   ++S    P+     + S+D ++  WD    + +
Sbjct: 578 GSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 637

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H ++ V++L+ +  G+ +VS   DHS+R+W+
Sbjct: 638 KQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 92/211 (43%), Gaps = 11/211 (5%)

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTK-DKLLPML---KLNHDTTLELNDDI 534
           L+ + D      G  D  +K W          GT  D  LP     K+N+ T +  +  +
Sbjct: 427 LEFSDDATLAAAGFQDSYIKLWSLD-------GTPLDSKLPSKQREKINNTTLIGHSGTV 479

Query: 535 LSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSAD 594
            S   SPD++YL  +  D TV+++ +D+    +S  GH  PV  +  S       T+S D
Sbjct: 480 YSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHD 539

Query: 595 KNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLY 654
           +  ++W  D     +    H + +  V F P     F+ S D   + WD    + ++   
Sbjct: 540 QTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFL 599

Query: 655 AHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            H + V + A++ +G ++ + S D  I +W+
Sbjct: 600 GHTAPVISTAVSPDGRWLSTGSEDGIINVWD 630

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 74/164 (45%), Gaps = 4/164 (2%)

Query: 526 TTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKF----YLSLYGHKLPVLSIDI 581
           T LE +DD         D Y+ +  LD T     L S +       +L GH   V S   
Sbjct: 425 TCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSF 484

Query: 582 SFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKY 641
           S D+K ++++S DK +++W +D      S   H   +  V F P  H F + S D   + 
Sbjct: 485 SPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARL 544

Query: 642 WDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           W  +    ++    H ++V  ++   NG++V + S D + R+W+
Sbjct: 545 WSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWD 588

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VG 152
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+  G
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 153 E-VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSL 210
           + V L+   +     T +   G  WL + S+DG+I +WD+ T + ++    H     +SL
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSL 651

Query: 211 SVKDD--LLITTGTDSQVKIWKL 231
           S   +  +L++ G D  V++W L
Sbjct: 652 SYSKEGTVLVSGGADHSVRVWDL 674

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 69/151 (45%), Gaps = 5/151 (3%)

Query: 387 LQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGL 443
             G   DV  +    +   + T S + + ++W++ T   +R F       +S    P G 
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 444 LVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G+  G + ++D+ +   L  +      A++SL  + +G  LV+G AD +V+ WD +
Sbjct: 616 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

Query: 504 VENTLVPGTKDKLLPMLKLNHDTTLELNDDI 534
             +T  P T+ +  P      D T  +N+DI
Sbjct: 676 -RSTAEPNTEPE-QPFTSYFGDATTSVNNDI 704

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 58/139 (41%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G      S  +   +WDI TGD +        P  S
Sbjct: 555 IFAGHLNDVDCVSFHPN-------GTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVIS 607

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
            A            V  D   L+ G  DG+I VWD+ +   L    GH K A+  L +  
Sbjct: 608 TA------------VSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSK 655

Query: 132 TGTRLISGSRDSNIIVWDL 150
            GT L+SG  D ++ VWDL
Sbjct: 656 EGTVLVSGGADHSVRVWDL 674

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G  D   ++WD+ +   +  F GH A +        G  L +GS D  
Sbjct: 566 VSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 625

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ +  + + +    L+S   D  +++WDLK
Sbjct: 626 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 61/150 (40%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L     D  +++W + + + L+++ GH   +  + F   G    + S D    +W 
Sbjct: 487 DNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 546

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC++  +     ++ + S D   ++WD+ T   +   + H
Sbjct: 547 C---DHIYPLRIFAGHLNDVDCVS--FHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGH 601

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKL 231
           T    S +V  D   L T   D  + +W +
Sbjct: 602 TAPVISTAVSPDGRWLSTGSEDGIINVWDI 631

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHK----DCITGI 169
           +  F+     +T L+F    T   +G +DS I +W L G     KL S +    +  T I
Sbjct: 414 MYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI 473

Query: 170 WCQG----------EDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW--SLSVKDDLL 217
              G            +L+S S+D  ++LW + T   + ++  H    W  S S      
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 218 ITTGTDSQVKIW 229
            T   D   ++W
Sbjct: 534 ATASHDQTARLW 545

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 127/283 (44%), Gaps = 27/283 (9%)

Query: 346 VTSSKLELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKL 405
           +TS K +L+    +  +  Y I       T+P P+ +     +G R +V SI    DNK 
Sbjct: 40  ITSDK-KLLAAAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSISFQQDNKW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSS 463
           + ++S +G++K+W+V+     R ++    ++   + P    +I   R G ++++DL  + 
Sbjct: 90  MVSSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 464 LLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLK 521
               +    D  + SL L SDG  LV  ++      W+       +P   D   L P+ K
Sbjct: 150 CTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWE-------MPNRTDASNLKPVTK 202

Query: 522 LNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSID 580
                T      I  + +S D ++LA    D+T +V+ +D+  +   +L GH+  V    
Sbjct: 203 FRSHATY-----ITRILLSSDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVAL 300

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/291 (19%), Positives = 121/291 (41%), Gaps = 27/291 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALSCKF-LPGGLLVILGTRTGELQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +  +     ++       ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDIRTTN 64

Query: 464 LLDTVE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
                  + H   + S+    D K +V+ S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRA-------------PSVPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L      P+ S+ +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLSL 167

Query: 582 SFDSKMIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M++ +++  N  +W +       +L       +H   I  +    +  +  +CS 
Sbjct: 168 ASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           D   + W     FE    L  HQ  VW  A +++ +++V++S DH +R+W+
Sbjct: 228 DHTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 75/180 (41%), Gaps = 12/180 (6%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITSDKKLLAAAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSISFQQDNKWMV 91

Query: 138 SGSRDSNIIVWDLVGE--VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           S S D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  SSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 CIETHIAHTG---ECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQS 252
           C            +  SL+    +L+   +     +W+  M N      L  V  F   +
Sbjct: 150 CTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWE--MPNRTDASNLKPVTKFRSHA 207

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 85/247 (34%), Gaps = 64/247 (25%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L  +  +NV ++DI+T +         P   +   G +    T +   +D   +     D
Sbjct: 47  LAAAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSISFQQDNKWMVSSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVW------------ 148
           G IKVWD+ + +V  N+  H A +  +        LIS  RD NI +W            
Sbjct: 97  GTIKVWDVRAPSVPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 149 -------------------------------------DLVGEVGLYKLRSHKDCITGIWC 171
                                                D      + K RSH   IT I  
Sbjct: 156 PEDDTPLQSLSLASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLWDLKTQQCIETHI-AHTGECWSLSVKDD--LLITTGTDSQVK 227
             +   L + S D   ++W +     +ET +  H    W  +   D   L+T  +D  V+
Sbjct: 216 SSDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVR 275

Query: 228 IWKLNME 234
           +W L+ +
Sbjct: 276 LWDLSTK 282

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 125/277 (45%), Gaps = 26/277 (9%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469
           +G++K+W+V++    R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527
              D ++ SL + SDG  L   ++      W+       +P   D   L P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFL-DSMKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ + D  K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 125/291 (42%), Gaps = 30/291 (10%)

Query: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442
           +Q   + V  ++I++D KLLATA + ++++++++T     + +FE   G   S  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + S+ ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL--DFGDCHKSLFAH 614
                 +K       H   +  I +S D K + T SAD   ++W +  DF     +L  H
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF-KLETTLDGH 249

Query: 615 QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
           Q  +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + ++S+   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDD 239

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 10/179 (5%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQ 194
           + S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   
Sbjct: 92  TSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148

Query: 195 QCIETHIAHTG-ECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQS 252
           QC             SLS+  D  +    +S+   +   M N      L  V  F   S
Sbjct: 149 QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHS 207

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 87/246 (35%), Gaps = 66/246 (26%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   +D   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNI--------------- 145
           G IKVWD+ S ++  N+  H A +  +        LIS  RD NI               
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 146 ----------------------------IVWDLVGEVG------LYKLRSHKDCITGIWC 171
                                        VW++           + K R+H   IT I  
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQV 226
             +   L + S D   ++W    D K +  ++ H     +C + S     L+T  +D  V
Sbjct: 216 SSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDC-AFSADSAYLVTASSDHYV 274

Query: 227 KIWKLN 232
           ++W L+
Sbjct: 275 RLWDLS 280

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 105/252 (41%), Gaps = 17/252 (6%)

Query: 435 SCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSAD 494
           S KF P    + +G+  G ++     S ++  +VE+AH   +  +D  S G  L TG  D
Sbjct: 183 SVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGED 242

Query: 495 KTVKFWDFQVENTLVPGTKDKLLPMLKL-NHDTTLELNDDILSVRISPDDRYLAISLLDN 553
             VK +  Q           +L  +  L  H+        +   R  P  RY+A +  DN
Sbjct: 243 GLVKLFTVQ---------SGELRQVADLQGHERR------VAGCRFHPFGRYIASASFDN 287

Query: 554 TVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFA 613
           T +++  ++    L   GH   V  +    D  ++ ++  D    IW +  G+C   L  
Sbjct: 288 TWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSG 347

Query: 614 HQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS-NGSFV 672
           H   I SV + P      + S D  V  WD  K    Q L AH S V  +     NG F+
Sbjct: 348 HTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFL 407

Query: 673 VSSSHDHSIRIW 684
           +S  +D +I ++
Sbjct: 408 MSCGYDKNINVY 419

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 70/155 (45%), Gaps = 3/155 (1%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSS 592
           I SV+ SPDD++LA+   D  +K     S+    S+   H   V  +D +    ++ T  
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 593 ADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            D  +K++ +  G+  +   L  H+  +   +F P      S S D   + WD E    +
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 651 QKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
                H  EV+ LA  S+GS + S+  D +  IW+
Sbjct: 301 LLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWD 335

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 94/222 (42%), Gaps = 21/222 (9%)

Query: 386 ELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKT-HKCIRTFECGYALSC-KFLPGG 442
           +LQG    V         + +A+AS + + ++W+ +T H+ +     G  + C  F   G
Sbjct: 260 DLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDG 319

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
            L+          ++D+ S +    V   H   I+S+D +  G  + T S D TV  WD 
Sbjct: 320 SLLCSAGLDCTGMIWDIRSGNCA-MVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDI 378

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISP-DDRYLAISLLDNTVKVFFLD 561
           +  N           P + L H++ +        +R    + ++L     D  + V+  D
Sbjct: 379 RKTNQ----------PQVLLAHNSIVS------GIRFEKHNGKFLMSCGYDKNINVYSGD 422

Query: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           S      L GH   +L++D+      ++++  D+++K W +D
Sbjct: 423 SWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 102/256 (39%), Gaps = 23/256 (8%)

Query: 394 VRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GY---ALSCKFLPGGLLVILG 448
           V  +D +    LLAT   +G +K++ V++ +  +  +  G+      C+F P G  +   
Sbjct: 224 VGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASA 283

Query: 449 TRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTL 508
           +     +L+D  ++  L  +++ H   ++ L   SDG  L +   D T   WD +  N  
Sbjct: 284 SFDNTWRLWDAETNHEL-LLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNC- 341

Query: 509 VPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLS 568
                     M+   H         I SV  SP    +A +  D TV ++ +        
Sbjct: 342 ---------AMVLSGHTKP------IYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQV 386

Query: 569 LYGHKLPVLSIDIS-FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           L  H   V  I     + K +++   DKNI ++  D  +    L  H D I+++      
Sbjct: 387 LLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTHD 446

Query: 628 HNFFSCSKDAVVKYWD 643
            +  S   D  VK W+
Sbjct: 447 GSVVSAGWDRSVKSWN 462

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 83/211 (39%), Gaps = 26/211 (12%)

Query: 42  ITSALENVNIWDI------KTGDLLATLS-DGLPP----------GASDARG--SKPAEC 82
           I S++EN +   +       +GDLLAT   DGL              +D +G   + A C
Sbjct: 212 IKSSVENAHTGKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGC 271

Query: 83  TYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRD 142
            +   H     +A    D   ++WD  +   LL   GH   +  L F S G+ L S   D
Sbjct: 272 RF---HPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLD 328

Query: 143 SNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHI 201
              ++WD+        L  H   I  + W      + + S DG + +WD++     +  +
Sbjct: 329 CTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLL 388

Query: 202 AHTGECWSLSVK---DDLLITTGTDSQVKIW 229
           AH      +  +      L++ G D  + ++
Sbjct: 389 AHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 9/151 (5%)

Query: 92  DLLAVGYADGVIKVWDLMSKTV--LLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           DLLA G  DG++K++ + S  +  + +  GH+  +   +F   G  + S S D+   +WD
Sbjct: 234 DLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWD 293

Query: 150 LVGEVGLYKLRSHKDCITGIWCQGEDWLISTSK---DGMIKLWDLKTQQCIETHIAHTGE 206
                 L     H   +  +  Q +  L+ ++     GMI  WD+++  C      HT  
Sbjct: 294 AETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMI--WDIRSGNCAMVLSGHTKP 351

Query: 207 CWSL--SVKDDLLITTGTDSQVKIWKLNMEN 235
            +S+  S +   + T   D  V IW +   N
Sbjct: 352 IYSVDWSPRGFEVATASGDGTVNIWDIRKTN 382

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 80/175 (45%), Gaps = 14/175 (8%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFY-------------LSLYGHKLPVL 577
           N ++  V  S D R  A    D+T+KV++LD                   +L GH  PV 
Sbjct: 498 NGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVY 557

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C      H   +  VKF P  H F + S D 
Sbjct: 558 SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V       NG +V + S D + R+W+ +T D V
Sbjct: 618 TARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSV 672

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 96/210 (45%), Gaps = 9/210 (4%)

Query: 479 LDLTSDGKRLVTGSADKTVKFW--DFQVENTLVPG-TKDKLLPMLKLNHDTTLELNDDIL 535
           ++ + D +    G  D T+K W  D     +++P   KD+       N  T +  +  + 
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQS------NSATLVGHSGPVY 557

Query: 536 SVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADK 595
           SV  SPD+RYL  +  D TV+++ LD+    +   GH  PV  +  S      IT+S D+
Sbjct: 558 SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 596 NIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYA 655
             ++W  D     +    H + +    F P     F+ S D   + WD +  + ++    
Sbjct: 618 TARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLG 677

Query: 656 HQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           H S V AL ++ +G ++ + S D +I +W+
Sbjct: 678 HTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/327 (20%), Positives = 131/327 (40%), Gaps = 48/327 (14%)

Query: 377 PAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKTHK---CIRTFEC--G 431
           P P+KT T++L+ +   VR              S  S+++ N++T     C+ TF    G
Sbjct: 454 PLPVKT-TLDLKMEIQKVRE-------------SRDSIQLKNLQTSAPSVCMYTFHNTNG 499

Query: 432 YALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVED------------AHDAAIWSL 479
                +F     L   G +   ++++ L  S L   +               H   ++S+
Sbjct: 500 NMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV 559

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRI 539
             + D + L++ S DKTV+ W       LV              H      N  +  V+ 
Sbjct: 560 AFSPDNRYLLSASEDKTVRLWSLDTFTCLV----------CYKGH------NHPVWYVKF 603

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP   Y   +  D T +++  D +       GH   V       +   + T S+DK  ++
Sbjct: 604 SPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRM 663

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QS 658
           W +  GD  +    H   + +++  P+     + S+D  +  WD    + I+++  H ++
Sbjct: 664 WDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKN 723

Query: 659 EVWALAIASNGSFVVSSSHDHSIRIWE 685
            ++++     G+ +V+   D S+R+W+
Sbjct: 724 PIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 106/227 (46%), Gaps = 23/227 (10%)

Query: 381 KTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYALSC--- 436
           ++++  L G    V S+  S DN+ L +AS + ++++W++ T  C+  ++ G+       
Sbjct: 543 QSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-GHNHPVWYV 601

Query: 437 KFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
           KF P G   I  +     +L+       L  +   H   +       +G  + TGS+DKT
Sbjct: 602 KFSPLGHYFITASHDQTARLWSCDHIYPL-RIFSGHLNDVDCSTFHPNGCYVFTGSSDKT 660

Query: 497 VKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVK 556
            + WD Q  +++           L L H +       + ++ +SPD R+L     D T+ 
Sbjct: 661 CRMWDIQTGDSV----------RLFLGHTSP------VTALEVSPDGRWLTTGSEDGTII 704

Query: 557 VFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           V+ + + K    + GH K P+ SI  + +   ++T  AD+++++W +
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 88  HEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH + +T L+    G  L +GS D  IIV
Sbjct: 646 HPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIV 705

Query: 148 WDLVGEVGLYKLRSH-KDCITGIWCQGE-DWLISTSKDGMIKLWDLK 192
           WD+     + +++ H K+ I  I    E + L++   D  +++WD+K
Sbjct: 706 WDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 63/144 (43%), Gaps = 4/144 (2%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D   ++W       L  F+GH   +    F   G  + +GS D    +WD+     +   
Sbjct: 616 DQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLF 675

Query: 160 RSHKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSLSV--KDD 215
             H   +T +    +  WL + S+DG I +WD+ T + I+    H     +S++   + +
Sbjct: 676 LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGN 735

Query: 216 LLITTGTDSQVKIWKLNMENDKMG 239
            L+T G D  V++W +    ++ G
Sbjct: 736 CLVTGGADQSVRVWDIKRFTNEPG 759

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 44  SALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVI 103
           S+ +   +WDI+TGD +        P             T LEV  D   L  G  DG I
Sbjct: 656 SSDKTCRMWDIQTGDSVRLFLGHTSP------------VTALEVSPDGRWLTTGSEDGTI 703

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
            VWD+ +   +    GH K  I  + F+  G  L++G  D ++ VWD+
Sbjct: 704 IVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 63/148 (42%), Gaps = 9/148 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L     D  +++W L + T L+ + GH   +  ++F   G   I+ S D    +W 
Sbjct: 564 DNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS 623

Query: 150 LVGEVGLYKLRSHKDCITGIWCQ----GEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                 +Y LR     +  + C        ++ + S D   ++WD++T   +   + HT 
Sbjct: 624 C---DHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTS 680

Query: 206 ECWSLSVKDD-LLITTGT-DSQVKIWKL 231
              +L V  D   +TTG+ D  + +W +
Sbjct: 681 PVTALEVSPDGRWLTTGSEDGTIIVWDI 708

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 65/135 (48%), Gaps = 10/135 (7%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLVILGTRTGELQLFDLASS 462
           +   +S+ + ++W+++T   +R F        + +  P G  +  G+  G + ++D+ + 
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTG 711

Query: 463 SLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
             +  ++      I+S+    +G  LVTG AD++V+ WD +   T  PG    + P  + 
Sbjct: 712 KRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK-RFTNEPG----MEPEQQF 766

Query: 523 N---HDTTLELNDDI 534
           N    D  L +N+DI
Sbjct: 767 NTYSGDMELSVNNDI 781

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 50/132 (37%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVG----EVGLYKLRSHKDCITGI 169
           +  F+     +T ++F        +G +DS I VW L G     +   K +   +  T +
Sbjct: 491 MYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLV 550

Query: 170 WCQG----------EDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW--SLSVKDDLL 217
              G            +L+S S+D  ++LW L T  C+  +  H    W    S      
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 218 ITTGTDSQVKIW 229
           IT   D   ++W
Sbjct: 611 ITASHDQTARLW 622

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 109/245 (44%), Gaps = 16/245 (6%)

Query: 440 PGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P    V  G+  G++++ D  +  +L + +  HD  I  LD +SD   LVTG AD+ VK 
Sbjct: 192 PNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKV 251

Query: 500 WDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFF 559
           W         P + +    +LK  H+        ++ V+  P DRY+A +  D T +++ 
Sbjct: 252 WK--------PSSPNDSTAVLK-GHEGR------VVKVKFHPSDRYVASASFDMTWRLWD 296

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++         GH   V  +D   D  ++ ++  D   +IW +  G     L  H   I 
Sbjct: 297 VERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIY 356

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIAS-NGSFVVSSSHD 678
            V + P  H+  + S D  VK WD  K      + AH + V  +     +G  +VSSS+D
Sbjct: 357 GVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYD 416

Query: 679 HSIRI 683
            ++ +
Sbjct: 417 KTVSV 421

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 111/237 (46%), Gaps = 25/237 (10%)

Query: 377 PAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA-- 433
           P+     T  L+G    V  +     ++ +A+AS + + ++W+V+    ++  E G+A  
Sbjct: 254 PSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQE-GHAKE 312

Query: 434 LSC-KFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGS 492
           + C  F   G L+         +++D+ S   L  +E  H   I+ +  + +G  + TGS
Sbjct: 313 VYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILE-GHAKPIYGVSWSPNGHHVATGS 371

Query: 493 ADKTVKFWDFQ-VENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLL 551
           AD TVK WD + V N           P   L H+  +    D+   ++S   R L  S  
Sbjct: 372 ADGTVKVWDIRKVGN-----------PFSILAHNNIVS---DVKFDKVS--GRTLVSSSY 415

Query: 552 DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCH 608
           D TV VF  DS     SL GH   V+SIDIS D   + +S  D+++K+W L  G C+
Sbjct: 416 DKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL--GVCN 470

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 2/159 (1%)

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG-HKLPVLSIDISFDSKMIITSS 592
           +  V +SP+ + +A       VK+   ++++   S    H   +  +D S DS +++T  
Sbjct: 185 VSGVLLSPNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGG 244

Query: 593 ADKNIKIWGLDF-GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           AD+ +K+W      D    L  H+  ++ VKF P      S S D   + WD E+   +Q
Sbjct: 245 ADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQ 304

Query: 652 KLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQ 690
               H  EV+ L    +GS + S+  D   RIW+    Q
Sbjct: 305 LQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQ 343

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 104/256 (40%), Gaps = 26/256 (10%)

Query: 394 VRSIDISDDNKLLATA-SNGSLKIWNVKTHK---CIRTFECGYALSCKFLPGGLLVILGT 449
           +  +D S D+ LL T  ++  +K+W   +      +     G  +  KF P    V   +
Sbjct: 228 IGGLDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASAS 287

Query: 450 RTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLV 509
                +L+D+     L  +++ H   ++ LD   DG  L +   D   + WD +   +L 
Sbjct: 288 FDMTWRLWDVERQVEL-QLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSL- 345

Query: 510 PGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                    M+   H         I  V  SP+  ++A    D TVKV+ +  +    S+
Sbjct: 346 ---------MILEGHAKP------IYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSI 390

Query: 570 YGHKLPVLSIDISFD---SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE 626
             H   V   D+ FD    + +++SS DK + ++  D      SL  H D +MS+    +
Sbjct: 391 LAHNNIV--SDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHD 448

Query: 627 SHNFFSCSKDAVVKYW 642
             + +S   D  VK W
Sbjct: 449 FSHLYSSGWDRSVKLW 464

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 73/160 (45%), Gaps = 6/160 (3%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E   L+   D  LL     D + ++WD+ S   L+   GH   I  + +   G  + +GS
Sbjct: 312 EVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS 371

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGI---WCQGEDWLISTSKDGMIKLWDLKTQQCI 197
            D  + VWD+      + + +H + ++ +      G   L+S+S D  + ++   +   +
Sbjct: 372 ADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRT-LVSSSYDKTVSVFASDSWLRL 430

Query: 198 ETHIAHTGECWSLSVKDDL--LITTGTDSQVKIWKLNMEN 235
            +   HT +  S+ +  D   L ++G D  VK+WKL + N
Sbjct: 431 ASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKLGVCN 470

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 1/109 (0%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           ++ H     +A    D   ++WD+  +  L    GH   +  L F   G+ L S   DS 
Sbjct: 274 VKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSI 333

Query: 145 IIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
             +WD+     L  L  H   I G+ W      + + S DG +K+WD++
Sbjct: 334 GRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIR 382

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 67/155 (43%), Gaps = 12/155 (7%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMS---KTVLLNFNGHKAAITLLQFDSTGTRLISGSR 141
           L+   D+ LL  G AD ++KVW   S    T +L   GH+  +  ++F  +   + S S 
Sbjct: 231 LDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVL--KGHEGRVVKVKFHPSDRYVASASF 288

Query: 142 DSNIIVWDLVGEVGLYKLRSHKD---CITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
           D    +WD+  +V L     H     C+    C G   L S   D + ++WD+++ Q + 
Sbjct: 289 DMTWRLWDVERQVELQLQEGHAKEVYCLD-FQCDGS-LLCSAGLDSIGRIWDMRSGQSLM 346

Query: 199 THIAHTGECW--SLSVKDDLLITTGTDSQVKIWKL 231
               H    +  S S     + T   D  VK+W +
Sbjct: 347 ILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDI 381

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 124/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469
           +G++K+W+V++    R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527
              D ++ SL + SDG  L   +       W+       +P   D   L P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 124/290 (42%), Gaps = 28/290 (9%)

Query: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442
           +Q   + V  ++I++D KLLATA + ++++++++T     + +FE   G   S  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + S+ ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
             +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + ++S+   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 75/181 (41%), Gaps = 14/181 (7%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQ 194
           + S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   
Sbjct: 92  TSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148

Query: 195 QCIETHIAHTG-ECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQ 251
           QC             SLS+  D  +L    T     +W+  M N      L  V  F   
Sbjct: 149 QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE--MPNHTDASHLKPVTKFRAH 206

Query: 252 S 252
           S
Sbjct: 207 S 207

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 87/246 (35%), Gaps = 66/246 (26%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   +D   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNI--------------- 145
           G IKVWD+ S ++  N+  H A +  +        LIS  RD NI               
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 146 ----------------------------IVWDLVGEVG------LYKLRSHKDCITGIWC 171
                                        VW++           + K R+H   IT I  
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQV 226
             +   L + S D   ++W    D K +  ++ H     +C + S     L+T  +D  V
Sbjct: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAYLVTASSDHYV 274

Query: 227 KIWKLN 232
           ++W L+
Sbjct: 275 RLWDLS 280

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 124/277 (44%), Gaps = 26/277 (9%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410
           +L+ T  +  +  Y I       T+P P+ +     +G R +V S+    DN+ + T+S 
Sbjct: 45  KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469
           +G++K+W+V++    R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527
              D ++ SL + SDG  L   +       W+       +P   D   L P+ K    +T
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWE-------MPNHTDASHLKPVTKFRAHST 208

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
                 I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V     S DS 
Sbjct: 209 Y-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 124/290 (42%), Gaps = 28/290 (9%)

Query: 387 LQGQRTDVRSIDISDDNKLLATASNGSLKIWNVKT--HKCIRTFEC--GYALSCKFLPGG 442
           +Q   + V  ++I++D KLLATA + ++++++++T     + +FE   G   S  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  +  G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + S+ ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
             +    F  +S    + S D  V+ WD    E +++   H      +A+
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ SV    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + ++S+   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 75/181 (41%), Gaps = 14/181 (7%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQ 194
           + S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   
Sbjct: 92  TSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148

Query: 195 QCIETHIAHTG-ECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQ 251
           QC             SLS+  D  +L    T     +W+  M N      L  V  F   
Sbjct: 149 QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE--MPNHTDASHLKPVTKFRAH 206

Query: 252 S 252
           S
Sbjct: 207 S 207

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           S+D  +K WD  +   I + Y H + V  + I  N   ++S   D +IRIW+  E+Q 
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 87/246 (35%), Gaps = 66/246 (26%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   +D   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNI--------------- 145
           G IKVWD+ S ++  N+  H A +  +        LIS  RD NI               
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 146 ----------------------------IVWDLVGEVG------LYKLRSHKDCITGIWC 171
                                        VW++           + K R+H   IT I  
Sbjct: 156 PEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQV 226
             +   L + S D   ++W    D K +  ++ H     +C + S     L+T  +D  V
Sbjct: 216 SSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAYLVTASSDHYV 274

Query: 227 KIWKLN 232
           ++W L+
Sbjct: 275 RLWDLS 280

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 95/216 (43%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   +++   + D K L++GS DKTV+ W       LV                +    
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKGH 568

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 569 NHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   ++ +   P+     + S+D ++  WD    + +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H ++ +++L+ +  G+ ++S   DHS+R+W+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 72/176 (40%), Gaps = 21/176 (11%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYL---------------------SL 569
           N D+  +  S D R  A    D+ +K++ LD                           +L
Sbjct: 464 NKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTL 523

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   V +   S D+K +++ S DK +++W +D      S   H   +  V F P  H 
Sbjct: 524 VGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHY 583

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           F + S D   + W  +    ++    H ++V  ++   NG +V + S D + R+W+
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWD 639

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 59/139 (42%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    ++ +CV   P+       G      S+ +   +WD+ TGD +            
Sbjct: 606 IFAGHLNDVDCVSFHPN-------GCYVFTGSSDKTCRMWDVSTGDSVRLF--------- 649

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
               + P  C  + V  D   L+ G  DG+I +WD+ +   L    GH K AI  L +  
Sbjct: 650 -LGHTAPVIC--IAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSK 706

Query: 132 TGTRLISGSRDSNIIVWDL 150
            G  LISG  D ++ VWDL
Sbjct: 707 EGNVLISGGADHSVRVWDL 725

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 538 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 597

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      +  DC++  +     ++ + S D   ++WD+ T   +   + H
Sbjct: 598 C---DHIYPLRIFAGHLNDVDCVS--FHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGH 652

Query: 204 TGE--CWSLSVKDDLLITTGTDSQVKIWKL 231
           T    C ++S     L T   D  + IW +
Sbjct: 653 TAPVICIAVSPDGRWLSTGSEDGIINIWDI 682

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS D  
Sbjct: 617 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDLK 192
           I +WD+     L ++R H K+ I  + + +  + LIS   D  +++WDLK
Sbjct: 677 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 59/186 (31%), Gaps = 35/186 (18%)

Query: 79  PAECTY-----------LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN--------- 118
           P+ C Y           L+  +D  + A G+ D  IK+W L   ++              
Sbjct: 453 PSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDH 512

Query: 119 ------------GHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI 166
                       GH   +    F      L+SGS D  + +W +     L   + H   +
Sbjct: 513 KDADDPTCKTLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPV 572

Query: 167 TGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWSLSVKDDLLITTGTD 223
             + +     +  + S D   +LW       +     H    +C S       + T  +D
Sbjct: 573 WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSD 632

Query: 224 SQVKIW 229
              ++W
Sbjct: 633 KTCRMW 638

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 98/216 (45%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H  A++S   + D K L++GS DKTV+ W    ++TLV                +    
Sbjct: 561 GHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLV----------------SYKGH 604

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 605 NHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFT 664

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  G+  +    H   ++S+   P+     S S+D ++  WD    + +
Sbjct: 665 GSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRL 724

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H ++ V ++  +  G+ ++S   D+S+R+W+
Sbjct: 725 KQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD 760

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 91/227 (40%), Gaps = 17/227 (7%)

Query: 476 IWSLDLTSDGKRLVTGSADKTVKFWD----------------FQVENTLVPGTKDKLLPM 519
           + SLD + D +    G  D  +K W                 F  +NT       K    
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQ 550

Query: 520 LKLNHDTTLELNDD-ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLS 578
             +N +T L  +   + S   SPD++ L     D TV+++ +D+    +S  GH  PV  
Sbjct: 551 EHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWD 610

Query: 579 IDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAV 638
           +  S       T+S D+  ++W  D     +    H   +  V F P     F+ S D  
Sbjct: 611 VAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKT 670

Query: 639 VKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            + WD    E ++    H + V +L ++ +G ++ S S D  I +W+
Sbjct: 671 CRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWD 717

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 60/139 (43%), Gaps = 20/139 (14%)

Query: 13  IFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLLATLSDGLPPGAS 72
           IF    S+ +CV   P+       G      S+ +   +WD+ TG+ +        P  S
Sbjct: 642 IFAGHLSDVDCVTFHPN-------GCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVS 694

Query: 73  DARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH-KAAITLLQFDS 131
                       L V  D   LA G  DG+I VWD+ S   L    GH + A+  + F  
Sbjct: 695 ------------LGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQ 742

Query: 132 TGTRLISGSRDSNIIVWDL 150
            GT +ISG  D+++ VWD+
Sbjct: 743 EGTVIISGGTDNSVRVWDM 761

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 69/149 (46%), Gaps = 6/149 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL-VG 152
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+  G
Sbjct: 620 FATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTG 679

Query: 153 E-VGLYKLRSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWS-- 209
           E V L+   +      G+   G  WL S S+DG+I +WD+ + + ++    H     +  
Sbjct: 680 ETVRLFLGHTAPVVSLGVSPDGR-WLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSI 738

Query: 210 -LSVKDDLLITTGTDSQVKIWKLNMENDK 237
             S +  ++I+ GTD+ V++W +   N++
Sbjct: 739 VFSQEGTVIISGGTDNSVRVWDMYKSNNE 767

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 65/150 (43%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWD 149
           D  LL  G  D  +++W + +++ L+++ GH   +  + F   G    + S D    +W 
Sbjct: 574 DNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWS 633

Query: 150 LVGEVGLYKLR------SHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      S  DC+T  +     ++ + S D   ++WD+ T + +   + H
Sbjct: 634 C---DHIYSLRIFAGHLSDVDCVT--FHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGH 688

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKL 231
           T    SL V  D   L +   D  + +W +
Sbjct: 689 TAPVVSLGVSPDGRWLASGSEDGLINVWDI 718

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 97/222 (43%), Gaps = 23/222 (10%)

Query: 386 ELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGY---ALSCKFLPG 441
           +L G    V S   S DNKLL + S + ++++W + T   + +++ G+        F P 
Sbjct: 558 KLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYK-GHNHPVWDVAFSPM 616

Query: 442 GLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501
           G      +     +L+       L  +   H + +  +    +G  + TGS+DKT + WD
Sbjct: 617 GHYFATASHDQTARLWSCDHIYSL-RIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWD 675

Query: 502 FQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLD 561
                T+           L L H         ++S+ +SPD R+LA    D  + V+ + 
Sbjct: 676 VSTGETV----------RLFLGHTAP------VVSLGVSPDGRWLASGSEDGLINVWDIG 719

Query: 562 SMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           S K    + GH +  V SI  S +  +II+   D ++++W +
Sbjct: 720 SGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 2/106 (1%)

Query: 88  HEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A +  L     G  L SGS D  I V
Sbjct: 656 HPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINV 715

Query: 148 WDLVGEVGLYKLRSH-KDCITGI-WCQGEDWLISTSKDGMIKLWDL 191
           WD+     L ++R H ++ +  I + Q    +IS   D  +++WD+
Sbjct: 716 WDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 121/296 (40%), Gaps = 46/296 (15%)

Query: 392 TDVRSIDISDDNKLLATASNGSL-KIWNVKTHKCIRTFECGYALSCKFLPGGLLVILGTR 450
           +++ S++ SDD +L A     S+ KIW               +L  + L   L    G R
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIW---------------SLDGEPLKNKLPSKQGER 472

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
           T    L               H   ++S   + D + L++ S DKTV+ W      +LV 
Sbjct: 473 TNNETLV-------------GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLV- 518

Query: 511 GTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                       N+      N  I  V  SP   Y A +  D T +++  D +       
Sbjct: 519 ------------NYKGH---NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFA 563

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++    +   + T S+DK  ++W +  GD  +    H   + S    P+    
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL 623

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
            + S+D V+  WD    + ++++  H ++ V++L+ +  G  ++S   DHS+R+W+
Sbjct: 624 STGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 13/170 (7%)

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDS--MKFYL-----------SLYGHKLPVL 577
           N ++ S+  S D R  A    D+ +K++ LD   +K  L           +L GH   V 
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVY 486

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S   S D++ ++++S DK +++W  D      +   H   I  V F P  H F + S D 
Sbjct: 487 STSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQ 546

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEET 687
             + W  +    ++    H ++V  ++   NG++V + S D + R+W+ T
Sbjct: 547 TARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDIT 596

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 4/150 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSG 598

Query: 154 VGLYKLRSHKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSLS 211
             +     H   +T      +  WL + S+DG+I +WD+ T + ++    H     +SLS
Sbjct: 599 DSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 212 VKDD--LLITTGTDSQVKIWKLNMENDKMG 239
              +  +LI+ G D  V++W +     + G
Sbjct: 659 YSKEGHVLISGGADHSVRVWDVKKSTAEPG 688

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ S   +  F GH A +T       G  L +GS D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGV 631

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGIWCQGEDW-LISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ +  +    E   LIS   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMS 110
           +WDI +GD +        P  S A            V  D   L+ G  DGVI VWD+ +
Sbjct: 592 MWDITSGDSVRLFLGHTAPVTSTA------------VSPDGRWLSTGSEDGVINVWDIGT 639

Query: 111 KTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
              L    GH K A+  L +   G  LISG  D ++ VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 60/168 (35%), Gaps = 16/168 (9%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDL-------------MSKTVLLNFNGHKAAITL 126
           +E T LE  +D  L A G+ D +IK+W L               +T      GH   +  
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYS 487

Query: 127 LQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGM 185
             F      L+S S D  + +W       L   + H   I  + +     +  + S D  
Sbjct: 488 TSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 186 IKLWDLKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKL 231
            +LW       +     H  +  ++S   +   + T  +D   ++W +
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL------RSHKDCIT 167
           +  F+   + +T L+F        +G +DS I +W L GE    KL      R++ + + 
Sbjct: 420 MYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV 479

Query: 168 G--------IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW--SLSVKDDLL 217
           G         +     +L+S S+D  ++LW   T   +  +  H    W  + S      
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 218 ITTGTDSQVKIW 229
            T   D   ++W
Sbjct: 540 ATASHDQTARLW 551

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 91/194 (46%), Gaps = 16/194 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N LV  ++DK L   KL  D         + + +  I+  V ++PD  Y   +  D T++
Sbjct: 31  NLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + +    GHK  V+S+ I   + MII+ S DK+IK+W +  G C  +L  H D
Sbjct: 91  LWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
            +  V+  P      E+    S   D +VK W+  +F+       H   V  +  + +GS
Sbjct: 150 WVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGS 209

Query: 671 FVVSSSHDHSIRIW 684
            + S+  D  I +W
Sbjct: 210 LIASAGKDGEIMLW 223

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++W++ +      F GHK+ +  +  D   + +ISGSRD +I VW + G+  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWCQGED-------WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +     D        +IS   D M+K W+L   Q     + H G   +++ 
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D ++ +W L
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 8/124 (6%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGLDFGDCHK------SLFAHQDSIMS 620
           +L GH   V S+  S     +++++S DK +  W L  GD  K      S   H   +  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLT-GDDQKVGVPVRSFKGHSHIVQD 70

Query: 621 VKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHS 680
           V   P+     S S D  ++ W+    E  Q+   H+S+V ++AI    S ++S S D S
Sbjct: 71  VTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKS 130

Query: 681 IRIW 684
           I++W
Sbjct: 131 IKVW 134

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     G+ + S  +D  I++W+L  +V +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTL 234

Query: 160 RSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +     +     WL + +  G IK++ L  Q  I+
Sbjct: 235 NAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 85/212 (40%), Gaps = 24/212 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   +  + LT DG   ++ S DKT++ W+     T       K               
Sbjct: 63  GHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHK--------------- 107

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK---- 586
             D++SV I      +     D ++KV+ +   +   +L GH   V  + ++ + K    
Sbjct: 108 -SDVMSVAIDRKASMIISGSRDKSIKVWTIKG-QCLATLLGHNDWVSQVRVAPNDKDDDE 165

Query: 587 --MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
              +I++  DK +K W L+          H  ++ ++   P+     S  KD  +  W+ 
Sbjct: 166 TVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNL 225

Query: 645 EKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
                +  L A Q EV+ALA + N  ++ +++
Sbjct: 226 ADKVPMYTLNA-QDEVFALAFSPNRYWLAAAT 256

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 13/137 (9%)

Query: 116 NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHK-DCITGIWCQGE 174
           +F GH   +  +     G   +S S D  + +W++       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV----KDD----LLITTGTDSQV 226
             +IS S+D  IK+W +K  QC+ T + H      + V    KDD     +I+ G D  V
Sbjct: 120 SMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMV 178

Query: 227 KIWKLN---MENDKMGE 240
           K W LN   +E D +G 
Sbjct: 179 KAWNLNQFQIEADFVGH 195

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 119 GHKAAITLLQFDSTGTRL-ISGSRDSNIIVWDLVGE-----VGLYKLRSHKDCITGIWCQ 172
           GH   +T L   +    L +S SRD  +I W L G+     V +   + H   +  +   
Sbjct: 15  GHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLT 74

Query: 173 GED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQVKIW 229
            +  + +S S D  ++LW++ T +  +  + H  +  S+++  K  ++I+   D  +K+W
Sbjct: 75  PDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVW 134

Query: 230 KL 231
            +
Sbjct: 135 TI 136

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G   +V +I  S D  L+A+A  +G + +WN+     + T        +  F P    + 
Sbjct: 194 GHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLA 253

Query: 447 LGTRTGELQLFDLASSSLLDTVED-------AHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T +G +++F L   +L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 91/201 (45%), Gaps = 15/201 (7%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+ G++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+ I   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLPESHN-----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSF 671
            +  V+  P   N       S   D +VK W+  +F+       H   V A+  + +G+ 
Sbjct: 150 WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTL 209

Query: 672 VVSSSHDHSIRIWEETEDQVF 692
           + S+  D  I +W   E +  
Sbjct: 210 IASAGKDGEIMLWNLAEKKAM 230

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWCQGEDW------LISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK 213
             H D ++ +     D       +IS   D M+K W+L   Q     + H G   +++  
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 DD--LLITTGTDSQVKIWKL 231
            D  L+ + G D ++ +W L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 111/273 (40%), Gaps = 45/273 (16%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT--- 507
           TG+ Q F +   S        H   +    LT DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQR 102

Query: 508 -------------------LVPGTKDKLLPMLKLNHD---TTLELNDDILSVRISP---- 541
                              ++ G++DK + +  +      T L  ND +  VRI+P    
Sbjct: 103 FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQN 162

Query: 542 DDRYLAISLL-DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           DD    IS   D  VK + L+  +      GH   V ++  S D  +I ++  D  I +W
Sbjct: 163 DDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLW 222

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------Y 654
            L       +L A QD + S+ F P  + + + +  + +K +  +    I  L      Y
Sbjct: 223 NLAEKKAMYTLSA-QDEVFSLAFSPNRY-WLAAATASGIKIFCLDPQSLIDDLRPEFAGY 280

Query: 655 AHQSEVWALAIA--SNGSFVVSSSHDHSIRIWE 685
              +E  A+++A  ++G  + +   D  IR+W+
Sbjct: 281 NKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQ 313

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ SGSRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
              Q   + +S S D  ++LWD+ T +  +  + H  +  S+++  K  ++I+   D  +
Sbjct: 74  --TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 19/150 (12%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     GT + S  +D  I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCI--------------ETHIAHTG 205
            +  +  +  +     WL + +  G IK++ L  Q  I              E H     
Sbjct: 234 SAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLIDDLRPEFAGYNKSAEPHAVSL- 291

Query: 206 ECWSLSVKDDLLITTGTDSQVKIWKLNMEN 235
              + S     L    TDS +++W++   N
Sbjct: 292 ---AWSADGQTLFAGYTDSVIRVWQVMTAN 318

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 69/167 (41%), Gaps = 21/167 (12%)

Query: 92  DLLAVGYADGVIKVWDLMS-----KTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNII 146
           +LL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHK-DCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           +WD+       +   HK D ++    +    +IS S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWSLSVK-------DDL--LITTGTDSQVKIWKLN---MENDKMGE 240
             W   V+       DD   +I+ G D  VK W LN   +E D +G 
Sbjct: 150 --WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGH 194

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G   +V ++  S D  L+A+A  +G + +WN+   K + T        S  F P    + 
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLA 252

Query: 447 LGTRTGELQLFDLASSSLLDTV--------EDAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T +G +++F L   SL+D +        + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLIDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 499 FWDFQVEN 506
            W     N
Sbjct: 311 VWQVMTAN 318

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 99/215 (46%), Gaps = 7/215 (3%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE--NTLVPGTKDKLLPMLKLNHDTTLEL 530
           ++ + SL+ + D +    G  D  VK W    E  ++ +P  +D+     + N+ T +  
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDE-----RSNNATLVGH 481

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           +  + S   SPD+RYL  +  D TV+++  D+    +S  GH  P+  +  S       T
Sbjct: 482 SGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFAT 541

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
           +S D+  ++W  D     +    H + + +V F P     F+ S D   + WD    + +
Sbjct: 542 ASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSV 601

Query: 651 QKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +    H + V A A++ +G ++ + S D  I +W+
Sbjct: 602 RLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWD 636

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H   ++S   + D + L++ S DKTV+ W      +LV                +    
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLV----------------SYKGH 523

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           N  I  V  SP   Y A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 524 NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            S+DK  ++W +  GD  +    H   + +    P+     + S+D ++  WD    + +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 651 QKLYAH-QSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           +++  H ++ V++L+ +  G  +VS   DHS+R+W+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 117/275 (42%), Gaps = 40/275 (14%)

Query: 392 TDVRSIDISDDNKLLATASNGSL-KIWNV---------------KTHKCIRTFECGYALS 435
           +++ S++ SDD +L +     S+ KIW++               +++        G   S
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 436 CKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADK 495
             F P    ++  +    ++L+   + + L + +  H+  IW +  +  G    T S D+
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYK-GHNHPIWDVAFSPLGHYFATASHDQ 546

Query: 496 TVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTV 555
           T + W           + D + P+          LND + +V   P+  Y+     D T 
Sbjct: 547 TARLW-----------SCDHIYPLRIF----AGHLND-VDTVSFHPNGTYVFTGSSDKTC 590

Query: 556 KVFFL---DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLF 612
           +++ +   DS++ +L   GH  PV +  +S D + + T S D  I +W +  G   K + 
Sbjct: 591 RMWDMSTGDSVRLFL---GHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMR 647

Query: 613 AH-QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
            H ++++ S+ +  E H   S   D  ++ WD +K
Sbjct: 648 GHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVKK 682

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 65/152 (42%), Gaps = 4/152 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTG 598

Query: 154 VGLYKLRSHKDCITGIWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWSLS 211
             +     H   +T      +  WL + S+DG+I +WD+ T + ++    H     +SLS
Sbjct: 599 DSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 212 VKDD--LLITTGTDSQVKIWKLNMENDKMGEK 241
              +  +L++ G D  +++W +     + G +
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDVKKSTAEPGSE 690

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 72/149 (48%), Gaps = 5/149 (3%)

Query: 389 GQRTDVRSIDISDDNKLLAT-ASNGSLKIWNVKTHKCIRTF--ECGYALSCKFLPGGLLV 445
           G   DV ++    +   + T +S+ + ++W++ T   +R F        +    P G  +
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWL 623

Query: 446 ILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
             G+  G + ++D+ +   L  +      A++SL  + +G  LV+G AD +++ WD + +
Sbjct: 624 STGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK-K 682

Query: 506 NTLVPGTKDKLLPMLKLNHDTTLELNDDI 534
           +T  PG++ +  P    + D T  +N DI
Sbjct: 683 STAEPGSEPE-QPFTSFSGDVTTSVNQDI 710

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +T       G  L +GS D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGI 631

Query: 145 IIVWDLVGEVGLYKLRSH-KDCITGIWCQGEDW-LISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+ +  +    E   L+S   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 51  IWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMS 110
           +WD+ TGD +        P             T   V  D   L+ G  DG+I VWD+ +
Sbjct: 592 MWDMSTGDSVRLFLGHTAP------------VTATAVSPDGRWLSTGSEDGIINVWDIGT 639

Query: 111 KTVLLNFNGH-KAAITLLQFDSTGTRLISGSRDSNIIVWDL 150
              L    GH K A+  L +   G  L+SG  D ++ VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/169 (18%), Positives = 61/169 (36%), Gaps = 16/169 (9%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------------GHKAAITL 126
           +E T LE  +D  L + G+ D ++K+W L  + +                  GH   +  
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 127 LQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGM 185
             F      L+S S D  + +W       L   + H   I  + +     +  + S D  
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 186 IKLWDLKTQQCIETHIAHTGECWSLSVKDD--LLITTGTDSQVKIWKLN 232
            +LW       +     H  +  ++S   +   + T  +D   ++W ++
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMS 596

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 18/133 (13%)

Query: 114 LLNFNGHKAAITLLQFDSTGTRLIS-GSRDSNIIVWDLVGEVGLYKLRSHKD-------- 164
           +  F+   + +T L+F S   RL S G +DS + +W L GE    KL S +D        
Sbjct: 420 MYTFHNTNSEMTSLEF-SDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATL 478

Query: 165 ------CITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW--SLSVKDDL 216
                   +  +     +L+S S+D  ++LW   T   + ++  H    W  + S     
Sbjct: 479 VGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHY 538

Query: 217 LITTGTDSQVKIW 229
             T   D   ++W
Sbjct: 539 FATASHDQTARLW 551

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 120/274 (43%), Gaps = 30/274 (10%)

Query: 440 PGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G     G+  G++ +F+  + + + T  + H   I  +D +SD + LV+G  D  VK 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 500 WDF-----QVENTLVPG----TKDKLLPMLKL----NHDTTLELND-------------- 532
           ++F     QV  + +      T  K  P  K     + DTT  L D              
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 533 -DILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
            +I S+    D   +A +  D    ++ L S K  LSL GH  P+   D S +       
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQ-XXX 369

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF-SCSKDAVVKYWDGEKFECI 650
           S D  IKIW L   D  +++ AH++ +  +KF  E+  F  S S D  +  +  + +  I
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 651 QKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIW 684
             L  H  ++ ++ I+S+   +VS   D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 74/172 (43%), Gaps = 14/172 (8%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISG 139
           A  T ++ H     +     D   ++WD+++ + LL   GH   I  L F + G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 140 SRDSNIIVWDLVGEVGLYKLRSH-KDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
             D   I+WDL     +  L  H K      W Q   +    S DG IK+WDL+    +E
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQN-GYQXXXSGDGTIKIWDLRKVDDVE 387

Query: 199 THIAHTGECWSLSVKDD---LLITT---------GTDSQVKIWKLNMENDKM 238
           T +AH      L  + +    LI++          +DS VKI  L   NDK+
Sbjct: 388 TILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKI 439

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 117/254 (46%), Gaps = 39/254 (15%)

Query: 381 KTHTIELQGQRTDVRSIDISDDNK-LLATASNGSLKIWNVKTHKC-IRTFECGY---ALS 435
           +TH+ ++ G       ID S D++ L++   +G +K++N  ++   + T   G+     +
Sbjct: 221 ETHSGKISG-------IDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTN 273

Query: 436 CKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADK 495
            KF P    +   +     +L+D+ ++S L  +++ H   I+SL   +DG  + T  ADK
Sbjct: 274 VKFHPSQKYIGSASFDTTWRLWDIVTNSEL-LLQEGHSKEIYSLSFQTDGSLIATAGADK 332

Query: 496 TVKFWDFQVEN---TLVPGTKD---------------------KLLPMLKLNH-DTTLEL 530
               WD +      +LV   K                      K+  + K++  +T L  
Sbjct: 333 VGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAH 392

Query: 531 NDDILSVRISPDD-RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMII 589
            + +  ++   ++ ++L  S  D  + VF  DS     +L GH   +LSIDIS D + I+
Sbjct: 393 KNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIV 452

Query: 590 TSSADKNIKIWGLD 603
           +   D+++K+W ++
Sbjct: 453 SGGWDRSVKLWSME 466

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 87/187 (46%), Gaps = 11/187 (5%)

Query: 57  GDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLL- 115
           GD+    +  L P  + +R +   + + ++   D+  L  G  DG++K+++  S ++ + 
Sbjct: 203 GDISIFNTKTLAPVIT-SRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVA 261

Query: 116 -NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE 174
            +F GH A +T ++F  +   + S S D+   +WD+V    L     H   I  +  Q +
Sbjct: 262 TSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTD 321

Query: 175 DWLISTS-KDGMIKLWDLKTQQCIETHIAHTGEC----WSLSVKDDLLITTGTDSQVKIW 229
             LI+T+  D +  +WDL++ + I + + H        WS   ++        D  +KIW
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWS---QNGYQXXXSGDGTIKIW 378

Query: 230 KLNMEND 236
            L   +D
Sbjct: 379 DLRKVDD 385

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 72/170 (42%), Gaps = 10/170 (5%)

Query: 526 TTLELN-DDILSVR------ISPDDRYLAISLLDNTVKVFFLDSMKFYL-SLYGHKLPVL 577
           TT++LN   ++S R      ISP+    A       + +F   ++   + S   H   + 
Sbjct: 169 TTVQLNGSQVISSRPISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKIS 228

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCH--KSLFAHQDSIMSVKFLPESHNFFSCSK 635
            ID S DS+ +++   D  +K++  D        S   H   + +VKF P      S S 
Sbjct: 229 GIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASF 288

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           D   + WD      +     H  E+++L+  ++GS + ++  D    IW+
Sbjct: 289 DTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 27/163 (16%)

Query: 39  GQLI-TSALENVNI-WDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAV 96
           G LI T+  + V I WD+++G  + +L             +KP  C+        D    
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSL----------VGHAKPIYCS--------DWSQN 363

Query: 97  GY-----ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTR-LISGSRDSNIIVWDL 150
           GY      DG IK+WDL     +     HK  +T L+F+   ++ LIS S D +I V+  
Sbjct: 364 GYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSS 423

Query: 151 VGEVGLYKLRSHKDCITGIWCQGE-DWLISTSKDGMIKLWDLK 192
              V ++ L+ H D I  I    +   ++S   D  +KLW ++
Sbjct: 424 DSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 31/183 (16%)

Query: 343 WTTVTSSKLELVLTTSNNTIEYYSIPYEKRE---ATSPAP-------LKT--HTIELQGQ 390
           W  VT+S+L   L    ++ E YS+ ++      AT+ A        L++  + + L G 
Sbjct: 295 WDIVTNSEL---LLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGH 351

Query: 391 RTDVRSIDISDDNKLLATASNGSLKIWNVK---------THKCIRTFECGYALSCKFLPG 441
              +   D S +      + +G++KIW+++          HK + T       + KFL  
Sbjct: 352 AKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFL-- 409

Query: 442 GLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501
               I  +   ++ +F   S   + T++  H+  I S+D++SD + +V+G  D++VK W 
Sbjct: 410 ----ISSSYDKDINVFSSDSWVKIHTLQ-GHNDKILSIDISSDYQTIVSGGWDRSVKLWS 464

Query: 502 FQV 504
            + 
Sbjct: 465 MEA 467

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 125/277 (45%), Gaps = 26/277 (9%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS- 410
           +L+    +  +  Y I       T+P P+ +     +G + +V S+    DNK + ++S 
Sbjct: 45  KLLAAAGHQNVRLYDI-----RTTNPNPVAS----FEGHKGNVTSLSFQQDNKWMVSSSE 95

Query: 411 NGSLKIWNVKTHKCIRTFECGYALSCKFL-PGGLLVILGTRTGELQLFDLASSSLLDTVE 469
           +G++K+W+V++    R ++    ++   + P    +I   R G ++++DL  +     + 
Sbjct: 96  DGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KLLPMLKLNHDTT 527
              D  + S+ + SDG  LV  +       W+       +P   D   L P+ K      
Sbjct: 156 PEDDIPLQSISVASDGSMLVAANTKGNCFVWE-------MPNHTDASNLKPVTKFK---- 204

Query: 528 LELNDDILSVRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSIDISFDSK 586
              ND I  + +S D ++LA    D+T +V+ +D+  K   +L GH+  V     S DS 
Sbjct: 205 -AHNDYITRILLSSDVKHLATCSADHTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSA 263

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            ++T+S+D  +++W L   +  +    H   ++ V  
Sbjct: 264 YLVTASSDHYVRLWDLSTREVVRQYGGHHKGVVCVAL 300

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/297 (20%), Positives = 125/297 (42%), Gaps = 27/297 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALSCKF-LPGGLLVILGTRTGELQLFDLASSS 463
           L++   + +++ W   T  C RT +   +   +  +     ++       ++L+D+ +++
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 464 LLDTVE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKL 522
                  + H   + SL    D K +V+ S D T+K WD +              P +  
Sbjct: 65  PNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRS-------------PSIPR 111

Query: 523 NHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSIDI 581
           N+     +N+    V I P+   L     D  ++++ L   +    L     +P+ SI +
Sbjct: 112 NYKHNAPVNE----VVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISV 167

Query: 582 SFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSCSK 635
           + D  M++ ++   N  +W + +  D           AH D I  +    +  +  +CS 
Sbjct: 168 ASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCSA 227

Query: 636 DAVVKYWD-GEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEETEDQV 691
           D   + W     F+    L  HQ  VW  A +++ +++V++S DH +R+W+ +  +V
Sbjct: 228 DHTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREV 284

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 89/217 (41%), Gaps = 23/217 (10%)

Query: 80  AECTYLEVHEDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDSTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GHK  +T L F      ++
Sbjct: 33  SQVNRLEITNDKKLLAAAGHQNV-RLYDIRTTNPNPVASFEGHKGNVTSLSFQQDNKWMV 91

Query: 138 SGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWC---QGEDWLISTSKDGMIKLWDLKTQ 194
           S S D  I VWD V    + +   H   +  +     QGE  LIS  +DG I++WDL   
Sbjct: 92  SSSEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGEN 148

Query: 195 QCIETHIAHTG-ECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQ 251
           QC             S+SV  D  +L+   T     +W+  M N      L  V  F+  
Sbjct: 149 QCTHQLTPEDDIPLQSISVASDGSMLVAANTKGNCFVWE--MPNHTDASNLKPVTKFKAH 206

Query: 252 SKQRGLKVEFITNA--SDGVSFFYIQNADKTIETFRI 286
           +       ++IT    S  V      +AD T   + I
Sbjct: 207 N-------DYITRILLSSDVKHLATCSADHTTRVWSI 236

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 88/245 (35%), Gaps = 66/245 (26%)

Query: 41  LITSALENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYAD 100
           L  +  +NV ++DI+T +         P   +   G K    T L   +D   +     D
Sbjct: 47  LAAAGHQNVRLYDIRTTN---------PNPVASFEGHK-GNVTSLSFQQDNKWMVSSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDL---------- 150
           G IKVWD+ S ++  N+  H A +  +        LIS  RD NI +WDL          
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 151 -----------VGEVG----------------------------LYKLRSHKDCITGIWC 171
                      V   G                            + K ++H D IT I  
Sbjct: 156 PEDDIPLQSISVASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILL 215

Query: 172 QGE-DWLISTSKDGMIKLW----DLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQV 226
             +   L + S D   ++W    + K +  ++ H     +C + S     L+T  +D  V
Sbjct: 216 SSDVKHLATCSADHTTRVWSIDNNFKLESTLDGHQRWVWDC-AFSADSAYLVTASSDHYV 274

Query: 227 KIWKL 231
           ++W L
Sbjct: 275 RLWDL 279

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 92/194 (47%), Gaps = 16/194 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N LV  ++DK L   KL  D         + + ++ I+    ++ D  Y   +  D T++
Sbjct: 30  NLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLR 89

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+ I   + MII+ S DK IK+W +  GDC  +L  H D
Sbjct: 90  LWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIK-GDCLATLLGHND 148

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
            +  V+  P      ++    S   D +VK W+  +F+       H + + ++  + +GS
Sbjct: 149 WVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITASPDGS 208

Query: 671 FVVSSSHDHSIRIW 684
            V S+  D  I +W
Sbjct: 209 LVASAGKDGDIMLW 222

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++W++ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDC-LATL 143

Query: 160 RSHKDCITGIWC-----QGED--WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +       Q +D   LIS   D M+K W++   Q     + H     S++ 
Sbjct: 144 LGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITA 203

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D  + +W L
Sbjct: 204 SPDGSLVASAGKDGDIMLWNL 224

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 89/212 (41%), Gaps = 24/212 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLEL 530
            H+  +    LT+DG   ++ S DKT++ W+     T    T  K               
Sbjct: 62  GHNHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHK--------------- 106

Query: 531 NDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM--- 587
             D++SV I      +     D T+KV+ +       +L GH   V  + ++ + K    
Sbjct: 107 -SDVMSVAIDRKASMIISGSRDKTIKVWSIKG-DCLATLLGHNDWVSQVRVAPNEKQEDD 164

Query: 588 ---IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
              +I++ +DK +K W ++          H + I S+   P+     S  KD  +  W+ 
Sbjct: 165 NVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNL 224

Query: 645 EKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
           ++   +  L A Q EV+ALA + N  ++ +++
Sbjct: 225 KQKTPLYTLSA-QDEVFALAFSPNRYWLTAAT 255

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 88/199 (44%), Gaps = 18/199 (9%)

Query: 47  ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           + + +W IK GD LATL      G +D            +  ++  L++ G +D ++K W
Sbjct: 128 KTIKVWSIK-GDCLATL-----LGHNDWVSQVRVAPNEKQEDDNVTLISAG-SDKMVKAW 180

Query: 107 DLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI 166
           ++    +  +F GH   I  +     G+ + S  +D +I++W+L  +  LY L +  +  
Sbjct: 181 NINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVF 240

Query: 167 TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE------THIAHTGECWSLSVK----DDL 216
              +     WL + +  G IK++ L+ +  I+      T      E  ++S+        
Sbjct: 241 ALAFSPNRYWLTAATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQT 299

Query: 217 LITTGTDSQVKIWKLNMEN 235
           L    TDS +++W++   N
Sbjct: 300 LFAGYTDSIIRVWQVMTSN 318

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 63/138 (45%), Gaps = 18/138 (13%)

Query: 109 MSKTVLL---NFNGHKAAITLLQFDSTGTRL-ISGSRDSNIIVWDLVGE-----VGLYKL 159
           MS  VL+      GH   +T L   +    L +S SRD  +I W L G+     V +   
Sbjct: 1   MSTEVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSF 60

Query: 160 RSH----KDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--K 213
           + H    +DC   +   G  + +S S D  ++LW++ T +  +    H  +  S+++  K
Sbjct: 61  KGHNHIVQDC--ALTADGA-YALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRK 117

Query: 214 DDLLITTGTDSQVKIWKL 231
             ++I+   D  +K+W +
Sbjct: 118 ASMIISGSRDKTIKVWSI 135

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G    + SI  S D  L+A+A  +G + +WN+K    + T        +  F P    + 
Sbjct: 193 GHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALAFSPNRYWLT 252

Query: 447 LGTRTGELQLFDLASSSLLDTVE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T TG ++++ L    L+D ++        A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 253 AATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRV 311

Query: 500 WDFQVEN 506
           W     N
Sbjct: 312 WQVMTSN 318

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 16/195 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+  ++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+DI   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
            +  V+ +P      +S    S   D +VK W+  +F+       H S +  L  + +G+
Sbjct: 150 WVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGT 209

Query: 671 FVVSSSHDHSIRIWE 685
            + S+  D  I +W 
Sbjct: 210 LIASAGKDGEIMLWN 224

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWC----QGED---WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +      + +D    +IS   D M+K W+L   Q     I H     +L+ 
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D ++ +W L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 93/232 (40%), Gaps = 29/232 (12%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
           TG+ Q F +   S        H   +    LT+DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGET--- 99

Query: 511 GTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                        +   +    D++SV I      +     D T+KV+ +   +   +L 
Sbjct: 100 -------------YQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLL 145

Query: 571 GHKLPVLSIDI------SFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFL 624
           GH   V  + +        DS  II++  DK +K W L+          H  +I ++   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTAS 205

Query: 625 PESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
           P+     S  KD  +  W+    + +  L A Q EV++LA + N  ++ +++
Sbjct: 206 PDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYWLAAAT 256

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 69/152 (45%), Gaps = 8/152 (5%)

Query: 47  ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           + + +W IK G  LATL  G     S  R   P E    +  +D+  +     D ++K W
Sbjct: 129 KTIKVWTIK-GQCLATLL-GHNDWVSQVR-VVPNE----KADDDSVTIISAGNDKMVKAW 181

Query: 107 DLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI 166
           +L    +  +F GH + I  L     GT + S  +D  I++W+L  +  +Y L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 167 TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
           +  +     WL + +  G IK++ L  Q  ++
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ S SRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
                  + +S S D  ++LWD+ T +  +  + H  +  S+ +  K  ++I+   D  +
Sbjct: 74  --TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 116 NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHK-DCITGIWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN---MENDKMGE 240
            VK W LN   +E D +G 
Sbjct: 177 MVKAWNLNQFQIEADFIGH 195

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        S  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRTGELQLFDLASSSLLDTVE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T TG +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 16/195 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+  ++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+DI   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
            +  V+ +P      +S    S   D +VK W+  +F+       H S +  L  + +G+
Sbjct: 150 WVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGT 209

Query: 671 FVVSSSHDHSIRIWE 685
            + S+  D  I +W 
Sbjct: 210 LIASAGKDGEIMLWN 224

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWC----QGED---WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +      + +D    +IS   D M+K W+L   Q     I H     +L+ 
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D ++ +W L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 93/232 (40%), Gaps = 29/232 (12%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
           TG+ Q F +   S        H   +    LT+DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGET--- 99

Query: 511 GTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                        +   +    D++SV I      +     D T+KV+ +   +   +L 
Sbjct: 100 -------------YQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLL 145

Query: 571 GHKLPVLSIDI------SFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFL 624
           GH   V  + +        DS  II++  DK +K W L+          H  +I ++   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTAS 205

Query: 625 PESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
           P+     S  KD  +  W+    + +  L A Q EV++LA + N  ++ +++
Sbjct: 206 PDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYWLAAAT 256

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 69/152 (45%), Gaps = 8/152 (5%)

Query: 47  ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           + + +W IK G  LATL  G     S  R   P E    +  +D+  +     D ++K W
Sbjct: 129 KTIKVWTIK-GQCLATLL-GHNDWVSQVR-VVPNE----KADDDSVTIISAGNDKMVKAW 181

Query: 107 DLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI 166
           +L    +  +F GH + I  L     GT + S  +D  I++W+L  +  +Y L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 167 TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
           +  +     WL + +  G IK++ L  Q  ++
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ S SRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
                  + +S S D  ++LWD+ T +  +  + H  +  S+ +  K  ++I+   D  +
Sbjct: 74  --TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 116 NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHK-DCITGIWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN---MENDKMGE 240
            VK W LN   +E D +G 
Sbjct: 177 MVKAWNLNQFQIEADFIGH 195

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        S  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRTGELQLFDLASSSLLDTVE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T TG +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 16/195 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+  ++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+DI   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
            +  V+ +P      +S    S   D +VK W+  +F+       H S +  L  + +G+
Sbjct: 150 WVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGT 209

Query: 671 FVVSSSHDHSIRIWE 685
            + S+  D  I +W 
Sbjct: 210 LIASAGKDGEIMLWN 224

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWC----QGED---WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +      + +D    +IS   D M+K W+L   Q     I H     +L+ 
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D ++ +W L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 93/232 (40%), Gaps = 29/232 (12%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
           TG+ Q F +   S        H   +    LT+DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGET--- 99

Query: 511 GTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                        +   +    D++SV I      +     D T+KV+ +   +   +L 
Sbjct: 100 -------------YQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLL 145

Query: 571 GHKLPVLSIDI------SFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFL 624
           GH   V  + +        DS  II++  DK +K W L+          H  +I ++   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTAS 205

Query: 625 PESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
           P+     S  KD  +  W+    + +  L A Q EV++LA + N  ++ +++
Sbjct: 206 PDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYWLAAAT 256

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 69/152 (45%), Gaps = 8/152 (5%)

Query: 47  ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           + + +W IK G  LATL  G     S  R   P E    +  +D+  +     D ++K W
Sbjct: 129 KTIKVWTIK-GQCLATLL-GHNDWVSQVR-VVPNE----KADDDSVTIISAGNDKMVKAW 181

Query: 107 DLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI 166
           +L    +  +F GH + I  L     GT + S  +D  I++W+L  +  +Y L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 167 TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
           +  +     WL + +  G IK++ L  Q  ++
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ S SRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
                  + +S S D  ++LWD+ T +  +  + H  +  S+ +  K  ++I+   D  +
Sbjct: 74  --TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 116 NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHK-DCITGIWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN---MENDKMGE 240
            VK W LN   +E D +G 
Sbjct: 177 MVKAWNLNQFQIEADFIGH 195

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        S  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRTGELQLFDLASSSLLDTVE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T TG +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 16/195 (8%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+  ++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+DI   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGS 670
            +  V+ +P      +S    S   D +VK W+  +F+       H S +  L  + +G+
Sbjct: 150 WVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGT 209

Query: 671 FVVSSSHDHSIRIWE 685
            + S+  D  I +W 
Sbjct: 210 LIASAGKDGEIMLWN 224

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWC----QGED---WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV 212
             H D ++ +      + +D    +IS   D M+K W+L   Q     I H     +L+ 
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 213 KDD--LLITTGTDSQVKIWKL 231
             D  L+ + G D ++ +W L
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 93/232 (40%), Gaps = 29/232 (12%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
           TG+ Q F +   S        H   +    LT+DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGET--- 99

Query: 511 GTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                        +   +    D++SV I      +     D T+KV+ +   +   +L 
Sbjct: 100 -------------YQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKG-QCLATLL 145

Query: 571 GHKLPVLSIDI------SFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFL 624
           GH   V  + +        DS  II++  DK +K W L+          H  +I ++   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTAS 205

Query: 625 PESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
           P+     S  KD  +  W+    + +  L A Q EV++LA + N  ++ +++
Sbjct: 206 PDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYWLAAAT 256

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 69/152 (45%), Gaps = 8/152 (5%)

Query: 47  ENVNIWDIKTGDLLATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVW 106
           + + +W IK G  LATL  G     S  R   P E    +  +D+  +     D ++K W
Sbjct: 129 KTIKVWTIK-GQCLATLL-GHNDWVSQVR-VVPNE----KADDDSVTIISAGNDKMVKAW 181

Query: 107 DLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCI 166
           +L    +  +F GH + I  L     GT + S  +D  I++W+L  +  +Y L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 167 TGIWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
           +  +     WL + +  G IK++ L  Q  ++
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ S SRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
                  + +S S D  ++LWD+ T +  +  + H  +  S+ +  K  ++I+   D  +
Sbjct: 74  --TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 116 NFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHK-DCITGIWCQGE 174
           +F GH   +      + G   +S S D  + +WD+       +   HK D ++    +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKIWKLN---MENDKMGE 240
            VK W LN   +E D +G 
Sbjct: 177 MVKAWNLNQFQIEADFIGH 195

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        S  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRTGELQLFDLASSSLLDTVE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T TG +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 115/274 (41%), Gaps = 31/274 (11%)

Query: 444 LVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
           L   G+  G++++ D  +  ++  +E+ HD  I  L   S    LV+G+ D  VK   F 
Sbjct: 200 LCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFD 259

Query: 504 VENTLV-------------------PGTK-------DKLLPMLKLNHDTTLELND----D 533
            +  ++                   P  +       D    +  +  +T L+  +    +
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKE 319

Query: 534 ILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           + S+    D   L    LDN   V+ + + K  ++L GH  P+ S+D S D   I T   
Sbjct: 320 VYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGG 379

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES-HNFFSCSKDAVVKYWDGEKFECIQK 652
           D  I IW +        L AH + +  V+F   + H   SC  D  ++ +  + +  ++ 
Sbjct: 380 DGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKT 439

Query: 653 LYAHQSEVWALAIASNGSFVVSSSHDHSIRIWEE 686
           L  H  ++  + I+ +   +VSS  D S+++W++
Sbjct: 440 LEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 103/219 (47%), Gaps = 23/219 (10%)

Query: 387 LQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFECGYA---LSCKFLPGG 442
           LQG    V ++D     + +A+AS + + ++W++++   ++ F+ G+     S  F   G
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQ-FQEGHGKEVYSLSFQNDG 329

Query: 443 LLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
            L+  G       ++D+ +   +  ++  H   I+S+D + DG  + TG  D  +  WD 
Sbjct: 330 ALLCSGGLDNAAIVWDVRTGKSIMNLQ-GHAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

Query: 503 QVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISL-LDNTVKVFFLD 561
           +           K     +L     L  N+ +  VR      +  +S   D  ++++  D
Sbjct: 389 R-----------KTTETTRL-----LAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

Query: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           +     +L GH   +L +DIS D+++I++S  D+++K+W
Sbjct: 433 NWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 4/154 (2%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E   L    D  LL  G  D    VWD+ +   ++N  GH   I  + +   G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 141 RDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGE--DWLISTSKDGMIKLWDLKTQQCIE 198
            D  I +WD+       +L +H + +TG+  Q      L+S   D  I+++       ++
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 199 THIAHTGECWSLSVKDD--LLITTGTDSQVKIWK 230
           T   HT +   + + +D  L++++G D  +K+WK
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 68/158 (43%), Gaps = 22/158 (13%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           ++ H     +A    D   ++WD+ S+T L    GH   +  L F + G  L SG  D+ 
Sbjct: 281 VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 145 IIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST-SKDGMIKLWDLKTQQCIETHIAH 203
            IVWD+     +  L+ H   I  +    + + I+T   DG+I +WD++        +AH
Sbjct: 341 AIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAH 400

Query: 204 ------------TGECWSLSVKDDLLITTGTDSQVKIW 229
                       TG C         L++ G D Q++I+
Sbjct: 401 NNIVTGVRFQKSTGHC---------LVSCGYDKQIRIY 429

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 91/205 (44%), Gaps = 12/205 (5%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNF-NGHKAAITLLQFDSTGTRLISGSRDSNIIVW 148
           D  L A G   G IK+ D  +  V+    NGH   I  L ++ST T L+SG+ D  + + 
Sbjct: 197 DNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIH 256

Query: 149 DLVGEVGLYK----LRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
               +V + K    L+ H   +  + +     ++ S S D   +LWD++++  ++    H
Sbjct: 257 SFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGH 316

Query: 204 TGECWSLSVKDD--LLITTGTDSQVKIWKLNMENDKMGEKLTEVGVFEKQSKQRGLKVEF 261
             E +SLS ++D  LL + G D+   +W +      M  +     ++       G  +  
Sbjct: 317 GKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIA- 375

Query: 262 ITNASDGVSFFYIQNADKTIETFRI 286
            T   DGV    I +  KT ET R+
Sbjct: 376 -TGGGDGV--INIWDIRKTTETTRL 397

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 82/216 (37%), Gaps = 18/216 (8%)

Query: 431 GYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVT 490
           G  ++  F P G  V   +     +L+D+ S + L   ++ H   ++SL   +DG  L +
Sbjct: 276 GRVVNVDFHPSGRFVASASFDMTWRLWDIESETEL-QFQEGHGKEVYSLSFQNDGALLCS 334

Query: 491 GSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISL 550
           G  D     WD +   +++   +    P               I SV  SPD  ++A   
Sbjct: 335 GGLDNAAIVWDVRTGKSIM-NLQGHAKP---------------IYSVDWSPDGYHIATGG 378

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA-DKNIKIWGLDFGDCHK 609
            D  + ++ +        L  H   V  +     +   + S   DK I+I+  D     K
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 610 SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           +L  H D I+ V    ++    S   D  +K W  E
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 90/201 (44%), Gaps = 15/201 (7%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+ G++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+ I   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLPESHN-----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSF 671
            +  V+  P   N       S   D +VK W+  +F+       H   V  +  + +G+ 
Sbjct: 150 WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTL 209

Query: 672 VVSSSHDHSIRIWEETEDQVF 692
           + S+  D  I +W   E +  
Sbjct: 210 IASAGKDGEIMLWNLAEKKAM 230

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWCQGEDW------LISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK 213
             H D ++ +     D       +IS   D M+K W+L   Q     + H G   +++  
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 214 DD--LLITTGTDSQVKIWKL 231
            D  L+ + G D ++ +W L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 95/231 (41%), Gaps = 28/231 (12%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
           TG+ Q F +   S        H   +    LT DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGET--- 99

Query: 511 GTKDKLLPMLKLNHDTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                        +   +    D++SV I      +     D T+KV+ +   +   +L 
Sbjct: 100 -------------YQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLL 145

Query: 571 GH-----KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
           GH     ++ +   D + DS  +I++  DK +K W L+          H  ++ +V   P
Sbjct: 146 GHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASP 205

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSS 676
           +     S  KD  +  W+  + + +  L A Q EV+ALA + N  ++ +++
Sbjct: 206 DGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEVFALAFSPNRYWLAAAT 255

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ SGSRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
              Q   + +S S D  ++LWD+ T +  +  + H  +  S+++  K  ++I+   D  +
Sbjct: 74  --TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 69/167 (41%), Gaps = 21/167 (12%)

Query: 92  DLLAVGYADGVIKVWDLMS-----KTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNII 146
           +LL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHK-DCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           +WD+       +   HK D ++    +    +IS S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWSLSVK-------DD--LLITTGTDSQVKIWKLN---MENDKMGE 240
             W   V+       DD   +I+ G D  VK W LN   +E D +G 
Sbjct: 150 --WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGH 194

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 60/150 (40%), Gaps = 19/150 (12%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     GT + S  +D  I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDCITGIWCQGEDWLISTSKDGMIKLWDLKTQQCI--------------ETHIAHTG 205
            +  +     +     WL + +  G IK++ L  Q  +              E H     
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAVSL- 291

Query: 206 ECWSLSVKDDLLITTGTDSQVKIWKLNMEN 235
              + S     L    TDS +++W++   N
Sbjct: 292 ---AWSADGQTLFAGYTDSVIRVWQVMTAN 318

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 389 GQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALSCKFLPGGLLVI 446
           G   +V ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 447 LGTRTGELQLFDLASSSLLDTV--------EDAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T +G +++F L   SL+D +        + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 499 FWDFQVEN 506
            W     N
Sbjct: 311 VWQVMTAN 318

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 107/223 (47%), Gaps = 19/223 (8%)

Query: 465 LDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNH 524
           +DT++  H   +  + L   GK L + S D T + WD + +  +          +L+  H
Sbjct: 268 IDTLK-GHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEI----------LLQEGH 316

Query: 525 DTTLELNDDILSVRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
                 + +I S+    D    A +  D+   ++ L S K  ++L GH  P+ S+D + +
Sbjct: 317 ------SKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPN 370

Query: 585 SKMIITSSADKNIKIWGLDFGDCH-KSLFAHQDSIMSVKFLPESHNF-FSCSKDAVVKYW 642
              + T S D  IKIW L   + +  S+FAH++ + SV++   +  F FS   D ++K  
Sbjct: 371 GYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIH 430

Query: 643 DGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
           D + +E +  L  H  ++  L  +   + +VSS  D +++IW+
Sbjct: 431 DSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWD 473

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 76/154 (49%), Gaps = 5/154 (3%)

Query: 81  ECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGS 140
           E   L  H D  L A    D +  +WDL S   ++N  GH   I  L +   G +L +GS
Sbjct: 319 EIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGS 378

Query: 141 RDSNIIVWDLVG-EVGLYKLRSHKDCITGIWCQGED--WLISTSKDGMIKLWDLKTQQCI 197
            D  I +WDL   E     + +HK+ +T +  +  +  ++ S   D +IK+ D KT + +
Sbjct: 379 GDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESV 438

Query: 198 ETHIAHTGECWSL--SVKDDLLITTGTDSQVKIW 229
            T   HT +  +L  S   +L++++G D  VKIW
Sbjct: 439 ATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIW 472

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 111/241 (46%), Gaps = 31/241 (12%)

Query: 369 YEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATAS-NGSLKIWNVKTHKCIRT 427
           YEK + TS   LK H    QG+ +DV+   +    K L ++S + + ++W+++  K I  
Sbjct: 260 YEKNDLTSIDTLKGH----QGRVSDVK---LHPLGKYLGSSSFDNTWRLWDIEKKKEI-L 311

Query: 428 FECGYA---LSCKFLPGGLLVILGTRTGELQLFDLASS-SLLDTVEDAHDAAIWSLDLTS 483
            + G++    S  F   G L           ++DL S  ++++ +   H   I+SLD   
Sbjct: 312 LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLI--GHAKPIYSLDWAP 369

Query: 484 DGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRISPDD 543
           +G +L TGS D T+K WD + + +               N  +     + + SV+   ++
Sbjct: 370 NGYQLATGSGDGTIKIWDLRNKES---------------NCASIFAHKNLVTSVQYEKNN 414

Query: 544 RYLAISL-LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
                S   D  +K+    + +   +L GH   +L++D S  S +I++S  D+ +KIW  
Sbjct: 415 GGFVFSAGYDKLIKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDN 474

Query: 603 D 603
           D
Sbjct: 475 D 475

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 7/154 (4%)

Query: 537 VRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY---GHKLPVLSIDISFDSKMIITSSA 593
           V+++P  + LA    D  + +  +D+M      +    H   +  I+ S D   + T   
Sbjct: 194 VKLAPQSKLLASGSWDGAISI--VDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGE 251

Query: 594 DKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           D  +K++G +  D     +L  HQ  +  VK  P      S S D   + WD EK + I 
Sbjct: 252 DCLVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEIL 311

Query: 652 KLYAHQSEVWALAIASNGSFVVSSSHDHSIRIWE 685
               H  E+++LA  ++GS   ++  D    IW+
Sbjct: 312 LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWD 345

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 5/149 (3%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSN 144
           +++H     L     D   ++WD+  K  +L   GH   I  L F + G+   +   DS 
Sbjct: 281 VKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSI 340

Query: 145 IIVWDLVGEVGLYKLRSHKDCITGI-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHI-A 202
            ++WDL     +  L  H   I  + W      L + S DG IK+WDL+ ++     I A
Sbjct: 341 GMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKESNCASIFA 400

Query: 203 HTGECWSLSVKDD---LLITTGTDSQVKI 228
           H     S+  + +    + + G D  +KI
Sbjct: 401 HKNLVTSVQYEKNNGGFVFSAGYDKLIKI 429

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 66/152 (43%), Gaps = 5/152 (3%)

Query: 85  LEVHEDTDLLAVGYADGVIKVWDLMSK--TVLLNFNGHKAAITLLQFDSTGTRLISGSRD 142
           +E   D   L  G  D ++KV+       T +    GH+  ++ ++    G  L S S D
Sbjct: 237 IEWSNDEAYLFTGGEDCLVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHPLGKYLGSSSFD 296

Query: 143 SNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLISTSK-DGMIKLWDLKTQQCIETHI 201
           +   +WD+  +  +     H   I  +    +  L +T+  D +  +WDL++ + I   I
Sbjct: 297 NTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLI 356

Query: 202 AHTGECWSLS-VKDDLLITTGT-DSQVKIWKL 231
            H    +SL    +   + TG+ D  +KIW L
Sbjct: 357 GHAKPIYSLDWAPNGYQLATGSGDGTIKIWDL 388

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 89/197 (45%), Gaps = 15/197 (7%)

Query: 506 NTLVPGTKDKLLPMLKLNHD--------TTLELNDDILS-VRISPDDRYLAISLLDNTVK 556
           N L+  ++DK L   KL  D         + + +  I+    ++ D  Y   +  D T++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+ I   + MII+ S DK IK+W +  G C  +L  H D
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 617 SIMSVKFLPESHN-----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSF 671
            +  V+  P   N       S   D +VK W+  +F+       H   V A+  + +GS 
Sbjct: 150 WVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSL 209

Query: 672 VVSSSHDHSIRIWEETE 688
           + S+  D  I +W   E
Sbjct: 210 IASAGKDGEIMLWNLLE 226

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGSRD  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDCITGIWCQGEDW------LISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVK 213
             H D ++ +     D       +IS   D M+K W+L   Q     + H G   +++  
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 DD--LLITTGTDSQVKIWKL 231
            D  L+ + G D ++ +W L
Sbjct: 205 PDGSLIASAGKDGEIMLWNL 224

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 112/273 (41%), Gaps = 45/273 (16%)

Query: 451 TGELQLFDLASSSLLDTVEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT--- 507
           TG+ Q F +   S        H   +    LT DG   ++ S DKT++ WD     T   
Sbjct: 48  TGDDQKFGVPVRSF-----KGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQR 102

Query: 508 -------------------LVPGTKDKLLPMLKLNHD---TTLELNDDILSVRISP---- 541
                              ++ G++DK + +  +      T L  ND +  VRI+P    
Sbjct: 103 FVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQN 162

Query: 542 DDRYLAISLL-DNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           DD    IS   D  VK + L+  +      GH   V ++  S D  +I ++  D  I +W
Sbjct: 163 DDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLW 222

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------Y 654
            L       +L A QD + ++ F P  + + + +  + VK +  +    I  L      Y
Sbjct: 223 NLLEKTAMYTLSA-QDEVFALAFSPNRY-WLAAATASGVKIFSLDPQSLIDDLRPEFAGY 280

Query: 655 AHQSEVWALAI--ASNGSFVVSSSHDHSIRIWE 685
              +E  A+++  +++G  + +   D+ IR+W+
Sbjct: 281 NKAAEPHAVSLTWSADGQTLFAGYTDNVIRVWQ 313

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     +++++S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIASNGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 15/125 (12%)

Query: 119 GHKAAITLLQFDSTGTRLI-SGSRDSNIIVWDLVGE-------VGLYKLRSH--KDCITG 168
           GH   +T L   +    L+ S SRD  +I W L G+       V  +K  SH  +DC   
Sbjct: 15  GHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTL- 73

Query: 169 IWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWSLSV--KDDLLITTGTDSQV 226
              Q   + +S S D  ++LWD+ T +  +  + H  +  S+++  K  ++I+   D  +
Sbjct: 74  --TQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 227 KIWKL 231
           K+W +
Sbjct: 132 KVWTI 136