Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1968.321ON85485444680.0
Suva_10.2208.321ON85485436930.0
YLR127C (APC2)8.321ON85385436700.0
Smik_12.1908.321ON85085236490.0
ZYRO0F10340g8.321ON81884216230.0
TDEL0F044708.321ON80985016020.0
SAKL0H15598g8.321ON78783415730.0
KLTH0G12342g8.321ON77485013501e-174
Kwal_56.239098.321ON77682313451e-173
TPHA0C008308.321ON84286712161e-153
TBLA0A039208.321ON73274011871e-150
CAGL0M04235g8.321ON78383011501e-144
NCAS0C032808.321ON81188510021e-122
KAFR0H022808.321ON8178809731e-118
Kpol_YGOB_Anc_8.3218.321ON5115338401e-102
Ecym_42528.321ON6897338352e-99
KNAG0G024308.321ON7978538413e-99
AGL193W8.321ON7097418135e-96
NDAI0G026008.321ON9119507696e-88
KLLA0D16324g8.321ON6977515363e-57
KLTH0H11176g1.343ON774119960.009
NCAS0A090701.343ON770145920.027
ADR106W7.296ON798156860.14
TPHA0P008507.296ON823146860.16
AFR617C1.343ON771129830.32
Ecym_23361.343ON775109800.65
NDAI0A022307.296ON816211800.82
ZYRO0C09438g7.296ON81997791.1
TPHA0A008803.151ON716130781.1
Kwal_0.701.343ON772105781.4
ZYRO0B06644g3.86ON92670771.7
Ecym_50785.229ON690221743.7
ZYRO0D06380g8.295ON492686744.1
TDEL0D021101.343ON779123744.2
KNAG0C040707.296ON83694744.2
YPL048W (CAM1)8.498ON41570734.2
CAGL0G08294g8.397ON27176724.4
SAKL0D07436gsingletonON737106734.8
TBLA0H032208.397ON27176724.9
KLLA0D18557g8.397ON30194715.6
Kpol_333.48.498ON42168716.4
Skud_16.2348.498ON399176716.5
Smik_16.1888.498ON41570717.8
Ecym_80467.296ON798150719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.196
         (854 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...  1725   0.0  
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...  1427   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...  1418   0.0  
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...  1410   0.0  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   629   0.0  
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   621   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   610   0.0  
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   524   e-174
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   522   e-173
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   473   e-153
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   461   e-150
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   447   e-144
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   390   e-122
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   379   e-118
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   328   e-102
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   326   2e-99
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   328   3e-99
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   317   5e-96
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   300   6e-88
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   211   3e-57
KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {...    42   0.009
NCAS0A09070 Chr1 (1794111..1796423) [2313 bp, 770 aa] {ON}             40   0.027
ADR106W Chr4 (894779..897175) [2397 bp, 798 aa] {ON} Syntenic ho...    38   0.14 
TPHA0P00850 Chr16 complement(172533..175004) [2472 bp, 823 aa] {...    38   0.16 
AFR617C Chr6 complement(1549456..1551771) [2316 bp, 771 aa] {ON}...    37   0.32 
Ecym_2336 Chr2 complement(652787..655114) [2328 bp, 775 aa] {ON}...    35   0.65 
NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296     35   0.82 
ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {...    35   1.1  
TPHA0A00880 Chr1 complement(172938..175088) [2151 bp, 716 aa] {O...    35   1.1  
Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON} YJL...    35   1.4  
ZYRO0B06644g Chr2 complement(530103..532883) [2781 bp, 926 aa] {...    34   1.7  
Ecym_5078 Chr5 (169522..171594) [2073 bp, 690 aa] {ON} similar t...    33   3.7  
ZYRO0D06380g Chr4 (540803..555583) [14781 bp, 4926 aa] {ON} simi...    33   4.1  
TDEL0D02110 Chr4 complement(409766..412105) [2340 bp, 779 aa] {O...    33   4.2  
KNAG0C04070 Chr3 (800093..802603) [2511 bp, 836 aa] {ON} Anc_7.2...    33   4.2  
YPL048W Chr16 (464401..465648) [1248 bp, 415 aa] {ON}  CAM1Nucle...    33   4.2  
CAGL0G08294g Chr7 complement(784203..785018) [816 bp, 271 aa] {O...    32   4.4  
SAKL0D07436g Chr4 complement(609760..611973) [2214 bp, 737 aa] {...    33   4.8  
TBLA0H03220 Chr8 complement(783486..784301) [816 bp, 271 aa] {ON...    32   4.9  
KLLA0D18557g Chr4 complement(1564372..1565277) [906 bp, 301 aa] ...    32   5.6  
Kpol_333.4 s333 (14058..15323) [1266 bp, 421 aa] {ON} (14058..15...    32   6.4  
Skud_16.234 Chr16 (428492..429691) [1200 bp, 399 aa] {ON} YPL048...    32   6.5  
Smik_16.188 Chr16 (339762..341009) [1248 bp, 415 aa] {ON} YPL048...    32   7.8  
Ecym_8046 Chr8 complement(100862..103258) [2397 bp, 798 aa] {ON}...    32   9.2  

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score = 1725 bits (4468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 842/854 (98%), Positives = 842/854 (98%)

Query: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60
           MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK
Sbjct: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120
           NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL
Sbjct: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120

Query: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180
           RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR
Sbjct: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180

Query: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240
           LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM
Sbjct: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300
           ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV
Sbjct: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300

Query: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
           ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC
Sbjct: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420
           LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG
Sbjct: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420

Query: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480
           QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP
Sbjct: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480

Query: 481 GSVKSSYIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540
           GSVKSSYIKTNLFEILLDL            NLLTDRLSSLKFYKLDDKWSQCLKLIRER
Sbjct: 481 GSVKSSYIKTNLFEILLDLFESREFFISEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540

Query: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600
           IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG
Sbjct: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600

Query: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660
           LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD
Sbjct: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660

Query: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720
           QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL
Sbjct: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720

Query: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780
           LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ
Sbjct: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA
Sbjct: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840

Query: 841 NGSYEIAKNGHKNA 854
           NGSYEIAKNGHKNA
Sbjct: 841 NGSYEIAKNGHKNA 854

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score = 1427 bits (3693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/854 (81%), Positives = 753/854 (88%)

Query: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60
           M+YQITPTRDLK+ITD+LQTLSSY+FHTNI DDLNSLLIWMSP+DPKSNHQLRPPSLRIK
Sbjct: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120
           NIIK LFPNN  TSSYG +N+ Q  N++  EGNTNKELQLQ +ST KEYY+FQVRYHFFL
Sbjct: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120

Query: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180
            F+ I YLKDIQRWENYYEFPLRYV IFDL+VN W+LELNSLRHY+LNRN KFKNNLR R
Sbjct: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180

Query: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240
           LNKLI+DDDFDLA NLIRWLN ANGSLSSM+LIVNALF+KI  FCE NMSGVWNKRFMIM
Sbjct: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300
           ETFNKFINQYWSQF ELI CPEDDHELTTTVFNCFESNFLRIRT+EIFDICVLAYP SK+
Sbjct: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300

Query: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
            LLELKKIMKDFKDYTNIVT FLSDFKK+ILNPSITTVDALL YVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360

Query: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420
           LHSI TFVKPYFQERKHLVNVLLYA+LDLPEEELKEKI+FKVDMKALL LV+ LHD DI 
Sbjct: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420

Query: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480
           Q T+  KSKDKNK   F WNL VKGKKE N      Q+MLYEH+LN+YLTWVPEPND+IP
Sbjct: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480

Query: 481 GSVKSSYIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540
           G++KSS IKTNLFE+LLDL            NLLTDRL +LKFYKLD+KWS+CLKLIRE+
Sbjct: 481 GNIKSSSIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540

Query: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600
           IVK TETN  NYI NGI+GLP+TTAPAADAD SN+NSIDVMLWDIKCSEELC KMHEVAG
Sbjct: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600

Query: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660
           LDP ++PKFISLLYWKHNGDT N  +  F +P +LE ELQKYSDIYSQ+KPGR+LQLCKD
Sbjct: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660

Query: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720
           QGK+EMEL F DGRKLVLDVSLEQ SV+NQFNST+ EPI LSL+QLSE LNI  ++LL L
Sbjct: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720

Query: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780
           LNFWIQ+GVLSEE  VYSVIEYS T F+QTQ +  MKN NNNNELRDE+EVE+KCEL L+
Sbjct: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPK+WGYNRITLLQLEKYLN L DEGKLKYI 
Sbjct: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840

Query: 841 NGSYEIAKNGHKNA 854
           NGSYE+ KNGHKN+
Sbjct: 841 NGSYELEKNGHKNS 854

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score = 1418 bits (3670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/854 (80%), Positives = 758/854 (88%), Gaps = 1/854 (0%)

Query: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60
           MS+QITPTRDLKVITD+LQTLSSY+FHTNI DDLNSLL WMSPND KSNHQLRPPSLRIK
Sbjct: 1   MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120
           NIIKVLFPNN +TS Y +IN+ Q  N++  EGNTNKELQLQL STLKE+Y+FQVRYHFFL
Sbjct: 61  NIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFL 120

Query: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180
            FN+I YLKDIQRWENYYEFPLRYVPIFD++VNDW+LELNSLRHY+LNRNIKFKNNLR R
Sbjct: 121 HFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTR 180

Query: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240
           L+KLIMDDDFDLA NLI+WL  ANGSLSS ELIVNAL++KI KFCE NMS VWNKRFMIM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300
           ETFNKFINQYWSQF +L+ CPEDDHELTTTVFNCFESNFLRIRT EIFDICVLAYPDSKV
Sbjct: 241 ETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKV 300

Query: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
            LLEL+KIMKDFKDYTNIVT FLSDFKKYILNPS+TTVDALLRYVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420
           LHSI TFVKPYFQERKHLVNVLLYAMLDLPEEELKEKI F VDMKALLSLVD LHD DI 
Sbjct: 361 LHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDIN 420

Query: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480
           Q+T+  K +DKNK+SPFLWNLKVKGK+E N+D   R  MLYEH+LN+Y+ WVPEPND+IP
Sbjct: 421 QDTNITK-RDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIP 479

Query: 481 GSVKSSYIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540
           G++KSSYIKTNLFE+LLDL            NLLTDRL +LKFY LD+KW++CLKLIRE+
Sbjct: 480 GNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREK 539

Query: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600
           IVKFTET+H+NYITNGILGL ETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG
Sbjct: 540 IVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 599

Query: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660
           LDP +FPKFISLLYWK+N DTQ   D  F +P DLERELQKYSDIYSQ+KPGR+LQLCKD
Sbjct: 600 LDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKD 659

Query: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720
           +GKVE++L+F+DGRKLVLDVSLEQ SV+NQF+S NDEPI LSL+QLSESLNI   +L  L
Sbjct: 660 KGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHL 719

Query: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780
           L+FWIQKGVL +E   YSVIE+S+  F Q QK   M+  N+N EL ++SE+E+K ELTLQ
Sbjct: 720 LDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQ 779

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840
           RSLPFIEGML NLGAMKL+KIHSFLKITVPKDWGYNRITL QLE YLNTL DEG+LKYIA
Sbjct: 780 RSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIA 839

Query: 841 NGSYEIAKNGHKNA 854
           NGSYEI KNGHKN+
Sbjct: 840 NGSYEIVKNGHKNS 853

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score = 1410 bits (3649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/852 (80%), Positives = 758/852 (88%), Gaps = 4/852 (0%)

Query: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60
           MSYQI PTRDLKVITD+LQTLSSY+FHT IADDLNSLLIW SPNDPKSNHQLRPPSLRIK
Sbjct: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120
           NIIKVLFPN+ STS Y V+N+GQT N++  EGNTNKELQLQLLSTLKEYY+FQVRYHFF 
Sbjct: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120

Query: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180
            F +I YLKDIQRWENYYEFPLRYVPIFDL +N WSLELNSLRHY+LNRN+KFKNNLR R
Sbjct: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180

Query: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240
           L+KLIMDDDFDLA NLI+WLN A+GSLSSMELIVNALFNKI KFCE  MSGVWNKRFMIM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300
           ETFNKFINQYWSQF +LI CPEDDHELTTTVFNCFESNFLRIRT+EIFDICVLAYP+SKV
Sbjct: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300

Query: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
            LLELKKIMKDFKDY NIVT FLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420
           LHSI TFVKPYFQERKHLV++LLYAMLDLPEEELKEKITFKVD+KAL+SLVD LHD DI 
Sbjct: 361 LHSITTFVKPYFQERKHLVDLLLYAMLDLPEEELKEKITFKVDIKALISLVDTLHDSDIS 420

Query: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480
           Q T+  K ++KNK+ PFLWNLKVKGK   N      QTM+Y+H+LN+YLTWVPEPND+IP
Sbjct: 421 QFTNVMK-RNKNKKGPFLWNLKVKGK---NGPSPTSQTMIYQHILNYYLTWVPEPNDMIP 476

Query: 481 GSVKSSYIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540
           GSVKSS IKTNLFE+LLDL            NLLTDRL +LKFYKLDDKW+QCLKLIRE+
Sbjct: 477 GSVKSSCIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDDKWTQCLKLIREK 536

Query: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600
           +VKF ET+H NYITNGILGLPETTAP+ADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG
Sbjct: 537 VVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 596

Query: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660
           LDP +FPKFISLLYWK+N D Q+  +  F +P  L++ELQKYSD+YSQ+KPGR+LQLCKD
Sbjct: 597 LDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKD 656

Query: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720
           QGKVE+EL+F+DGRKLVLDVSLEQ SV+NQF+ST+++ I+L+L+QLS+SLNIT  +L+ L
Sbjct: 657 QGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHL 716

Query: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780
           L+FWIQKGV+S+E  VYSVIE  +T F +  KD+ M+  NNN  LR+ESE E+KCELTLQ
Sbjct: 717 LDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQ 776

Query: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNR++L QLE+YL+ L DEG+LKYIA
Sbjct: 777 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIA 836

Query: 841 NGSYEIAKNGHK 852
           NGSYEI KN HK
Sbjct: 837 NGSYEIVKNEHK 848

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/842 (42%), Positives = 516/842 (61%), Gaps = 36/842 (4%)

Query: 10  DLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPN 69
           DLK +  Q+Q ++    H N  DDL SLL W++PN+P+SNHQ +PP+LR+KN IK+L   
Sbjct: 10  DLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKML--- 65

Query: 70  NVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLK 129
                    +N    +     E +T   L +QL+   +++YV+QVR HFF   +++   K
Sbjct: 66  ---------VNQYYNMELREDERDTGY-LFIQLV---RQFYVYQVRLHFFASLSNLHTFK 112

Query: 130 DIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDD 189
           D+QR   YYEFPL+YV IF+    +W  E + L HY+LNR+ K + N+  RL  L+M+DD
Sbjct: 113 DVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDD 172

Query: 190 FDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQ 249
           FDLA ++++WLN +N ++SSM+L+++ +  KI +FC+  M+G WN RF+IMETFN+FI  
Sbjct: 173 FDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITS 232

Query: 250 YWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIM 309
           YWSQFC L+ CPED+HELTT V++ FE  F+++RT+EIFDI V  YPDSK  LLEL++++
Sbjct: 233 YWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVL 292

Query: 310 KDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVK 369
              KD+T IV +FLS+F++ ILNPSI+TV+ALL YVKT+KAFL LDPTGRCL+S+  FVK
Sbjct: 293 VKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVK 352

Query: 370 PYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSK 429
           PYFQER  LV VLLYA+L+L  EE +      +D  +L  L   L D + G       S 
Sbjct: 353 PYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFG----IESSF 408

Query: 430 DKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSV-KSSYI 488
           +   ++  L             DP     + Y+ V+ ++L W PEP D I  +  KS   
Sbjct: 409 ETIPQADLLSRPASTATTAAMLDP----RLPYKSVIKNFLQWTPEPMDTISKNYSKSLSA 464

Query: 489 KTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETN 548
             NL +IL+D+            +LLT +L +LK Y LD KWS CL+L++ +        
Sbjct: 465 SRNLLDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLKTKFGPAGAAA 524

Query: 549 HANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPK 608
                T    G   +       D SN+N+IDVML D++ S ELC++MH+VAGLD  ++PK
Sbjct: 525 VVA--TGIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPK 582

Query: 609 FISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMEL 668
           FIS LYW  +  +       F++   +  EL KY  +YS++KPGR L L KDQG V + L
Sbjct: 583 FISPLYWNRDNSSNG---WTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTL 639

Query: 669 SFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKG 728
           SF+DGRK   + +LEQ SV+ QF+++      L+ + +   L +  ++    L  W+Q+G
Sbjct: 640 SFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEG 699

Query: 729 VLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELT--LQRSLPFI 786
           VL  +G  Y   EY D   ++       K+ + +++ R  S  ++   LT  L+++ PFI
Sbjct: 700 VLYYDGNAYKTREYLDDQPAENLP--ASKDSSASSQARTMSP-DRDSRLTSILEQTWPFI 756

Query: 787 EGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEI 846
           +GML NLGA+K+ KIHSFLK+T PK+ G++ +T  QLE YL++L +E +L    N +Y++
Sbjct: 757 QGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKL 816

Query: 847 AK 848
            K
Sbjct: 817 PK 818

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/850 (40%), Positives = 512/850 (60%), Gaps = 60/850 (7%)

Query: 8   TRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLF 67
           + +L VI D ++ ++    H    DDL +LL W++PN+ +SNH +RPP LR+K+ IK LF
Sbjct: 6   SSELPVIIDSIKEVA-LRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63

Query: 68  PNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIY 127
            N    S Y              +G  NK  + +L + L+++Y++QVR HFF  FN I  
Sbjct: 64  VNQYYNSGY----------ISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113

Query: 128 LKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMD 187
            KDIQR E YY  PL Y+ +F+ S  +W +E + LRHY+LNRN++F NN++ R+  L M 
Sbjct: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173

Query: 188 DDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFI 247
           DDF+    ++ W+  A+ SLSS +++++ +  K+++FC+ +M GV+ K +++M+TFNKFI
Sbjct: 174 DDFEYVAEMLDWVEKAHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233

Query: 248 NQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKK 307
            +YWS F +L+ CP+DDH LT  V+ CFE  F+RIRT+E+FDI V  +P+SK  ++E++K
Sbjct: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293

Query: 308 IMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITF 367
           ++    D+  IV  FLS F+K +LNPS+TT DALL YVK++KAFL LDP+GR L S+I+F
Sbjct: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353

Query: 368 VKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHK 427
           VK  FQER  LV +LLYA+LDL  + L      +VD   L +L   L D ++G   D + 
Sbjct: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412

Query: 428 SKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSV-KSS 486
             +    +  +  L  +G             + YE V+  +L+W P+P D+ P ++ K S
Sbjct: 413 DDNLANVATGMAKLNYEG------------CLPYEEVMQRFLSWNPDPRDMAPRAISKQS 460

Query: 487 YIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTE 546
               +L +IL++L             LLT RL SLKFY LD  WS+CL+L+++++ +   
Sbjct: 461 PSHMSLLDILMELFESKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQLLKKKLAR--- 517

Query: 547 TNHANYITNGILGLPETT-APAADA-------DQSNLNSIDVMLWDIKCSEELCRKMHEV 598
                       G P  + AP           D SN+NS DVMLWD+K S ELC++MH+V
Sbjct: 518 ------------GAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQV 565

Query: 599 AGLDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLC 658
           +GLD  ++PKFIS LYW    +++N     F IP  L  E +KYS +YS++K GR L+L 
Sbjct: 566 SGLDQRIYPKFISYLYWNCQLESKN----DFEIPEPLNSEFEKYSRVYSEVKAGRALKLL 621

Query: 659 KDQGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPIN-LSLKQLSESLNITTSKL 717
           KDQG +E++L F+DGR L  DV+LEQY+V+ QF+   D   N L  + +S  LN+  S++
Sbjct: 622 KDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFD--EDSYANRLMAETISLYLNMEISRV 679

Query: 718 LQLLNFWIQKGVLSEEGEVYSVIE-YSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCE 776
              L FW++KGVL +    Y+  E   D+     + D +      N  + +E     K  
Sbjct: 680 KSALQFWVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNETIIEEETTLSK-- 737

Query: 777 LTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKL 836
            TL    PF++GML NLG++K  KIHSFLK+TVPK+ GY  +T  QLE YLN+L +E +L
Sbjct: 738 -TLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERL 796

Query: 837 KYIANGSYEI 846
               +GSY++
Sbjct: 797 ACTTSGSYKL 806

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/834 (40%), Positives = 501/834 (60%), Gaps = 76/834 (9%)

Query: 25  VFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQT 84
            ++ N+ D+L+ +L W++PN+P SNHQLRPPSLR+KN IK+            V+N    
Sbjct: 20  TYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKL------------VVN---- 63

Query: 85  INAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRY 144
                     N+++    +  L+++ + Q R HFF  FN I   KDIQR E YYEFPL+Y
Sbjct: 64  ----------NEDVPPGFVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKY 113

Query: 145 VPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFAN 204
           + IF  + ++W +E+N  RHY++++N  F +N++ R+ +LIM+DDFD+A  +  WL    
Sbjct: 114 INIF--TPDEWFIEMNGFRHYLMSKNRIFGDNIKHRVRQLIMEDDFDMAWKIYTWLTETM 171

Query: 205 GSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDD 264
           G    + L++  L +KI  F + NM G W +RF++METFN FI +YWS F + + CPEDD
Sbjct: 172 GH-QLVSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCPEDD 230

Query: 265 HELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLS 324
           HE+TT +F+CFE  F++IRT EI++ICVL YP SK ALLEL+ +MK   DY+ ++ +FLS
Sbjct: 231 HEITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSADYSKLMIEFLS 290

Query: 325 DFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLY 384
            F+  ++NPS+TT + LL Y++TIK+FL +DP GR L S+  ++KPY +ER+  V  LLY
Sbjct: 291 KFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVHLLY 350

Query: 385 AMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVK 444
           AML+L E E+ +     ++M  L  L   L D D G   DA     KNK       L V 
Sbjct: 351 AMLELDESEIDDA-NVSLNMPILTELSKELKDPDFGIE-DADSKSRKNK-------LMV- 400

Query: 445 GKKETNEDPLAR-QTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLXXXX 503
               T+  P+ + +  L E VLN++L W PEP+D+      ++++  +L +ILLD+    
Sbjct: 401 ----TDSSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKPNNTFVNKSLLDILLDIFDSK 456

Query: 504 XXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPET 563
                   +L T +L  LK+YKL+ KW + L+L++++               G    P+ 
Sbjct: 457 DVFISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKF--------------GHTSFPQH 502

Query: 564 TAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGDTQN 623
                  D SN+N+ID+ML D+K S EL  KMHEVAGLD  VFPKFIS L+W    + + 
Sbjct: 503 QF----QDTSNINNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFISYLFWNSALEAET 558

Query: 624 PKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLE 683
              S F++P  LE E++KYS++YSQ+KPGRRL L KDQG VE++L F+DGRK+  +V L 
Sbjct: 559 ---SDFQLPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLN 615

Query: 684 QYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVL--SEEGEVYSVIE 741
           + +V++ F+  +     L+++Q+ +++ +  + +  +L FW +K  +   +    Y V+E
Sbjct: 616 KAAVISCFDQ-DTALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLE 674

Query: 742 YSDTGFSQTQKDVLMKNVNNN---NELRDESEVEKKCELTLQRSL----PFIEGMLANLG 794
           Y +   + +   V+    N N   N + D+     K +    +S+    PFI+GML NLG
Sbjct: 675 YYEPNSALSASTVISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPFIQGMLTNLG 734

Query: 795 AMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848
           +MK  KIHSFLK+ VPKD GY   T+ QLE YLN L DE KL  + NGSY++ K
Sbjct: 735 SMKPEKIHSFLKMAVPKDIGYT-ATVNQLESYLNVLVDEDKLAAVPNGSYKLVK 787

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  524 bits (1350), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 302/850 (35%), Positives = 470/850 (55%), Gaps = 82/850 (9%)

Query: 5   ITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIK 64
           +T + + + +++QL +L   V  +++ DDL  +L W++PN+P SNHQ+RPPSLR+K+ IK
Sbjct: 1   MTLSDEGRELSEQLHSLLHDV-DSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIK 59

Query: 65  VLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFND 124
            L    V++ S+                          +  L +Y +FQ R HFFL +  
Sbjct: 60  SLLNGVVTSESF--------------------------IDLLGKYMIFQTRKHFFLNYQS 93

Query: 125 IIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKL 184
           ++Y KD+Q+ E YYEFP RYV IF  S  +W  E++ LR+Y++ +N   KNN+++RL +L
Sbjct: 94  LLYFKDVQKLERYYEFPTRYVNIF--SSEEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQL 151

Query: 185 IMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFN 244
           + +DDFD+A  +  WL  A G L   E++V+ L +K++ F   NM+  W +RF IME +N
Sbjct: 152 VHEDDFDMACKIYEWLCQAEGRLLP-EILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYN 210

Query: 245 KFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLE 304
            F+  YWS FC ++ C EDDHE+T  ++ CFE  F+RIRT ++FDI V  +P +K  LLE
Sbjct: 211 LFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLE 270

Query: 305 LKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSI 364
           L+ ++K    YT ++T+FL  F+  +LNPSITT + LL YV+ IK+ L++D + R    +
Sbjct: 271 LRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLL 330

Query: 365 ITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTD 424
             FV+PY  ER   V   LYAML L   +L  K +    M     L   L     G +  
Sbjct: 331 TNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELR----GSHQP 386

Query: 425 AHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVK 484
              S  +    P        GK   + +P       Y+ ++++YL W PEP D I  +  
Sbjct: 387 ISSSTAERGNLP-------HGKHALSMNPYEPA---YQQIIDYYLHWNPEPADSIQANND 436

Query: 485 SSYIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKF 544
            + I   LF+I+++L             L T +L  L+ YKL+  W Q LK++++++   
Sbjct: 437 QALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFK 496

Query: 545 TETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPT 604
           T ++   +                    SN+N+IDVML D+K SEELC  MHE  GL   
Sbjct: 497 TYSSAQEF--------------------SNINNIDVMLRDVKHSEELCSLMHEKLGLSDR 536

Query: 605 VFPKFISLLYWKHNGD-TQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGK 663
           + PKF+S L+W  + D +  PKD    +P +LE ++  Y   Y+ +K GR+L+L  +Q  
Sbjct: 537 IIPKFVSYLFWNAHSDFSALPKDHP--LPKELEADINNYKKAYTNVKKGRKLRLHPEQSI 594

Query: 664 VEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNF 723
           VE++L   DGR L  +V+L++  V++  +S  D  +   +KQ     N+  S++ + L F
Sbjct: 595 VELQLRLADGRDLNYEVTLDEALVLSYLSSNGDGTVEEIVKQ----TNLDISQVEKSLKF 650

Query: 724 WIQKGVL--SEEGEVYSVIEYSDTGFSQT---QKDVLMKNVNNNNELRDESEVEKKCELT 778
           W++  +L  S E   YSV E  +         Q    + N  ++ +L+ +  ++     +
Sbjct: 651 WVKSSILRYSTETSRYSVEERQNVDVKHAVERQSSSEIVNATDSVDLQQQQFID-----S 705

Query: 779 LQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKY 838
           +Q+ LPFI+GML NLG++K +KIHSFLK+ VPK+ GY+  T  QL+ YLN L +E KL  
Sbjct: 706 MQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGYS-ATPSQLQLYLNALVEESKLVK 764

Query: 839 IANGSYEIAK 848
             NG++ +AK
Sbjct: 765 TPNGAFRLAK 774

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  522 bits (1345), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/823 (36%), Positives = 463/823 (56%), Gaps = 76/823 (9%)

Query: 29  NIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAV 88
            + DDL S+L W++PN+P SNHQLRPPSLR+K+ IK+L   N                  
Sbjct: 24  TVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINEN------------------ 65

Query: 89  AGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIF 148
            G G         L   L++Y +FQ R HFF  +  + + KD+Q+ E YYEFPLR+V +F
Sbjct: 66  -GNGPA-------LTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF 117

Query: 149 DLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSLS 208
           +    +W+ E+N LR+Y++++N+ F  N R+RL +L+++DDF++A  L  WL  A G L 
Sbjct: 118 NR--EEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLL 175

Query: 209 SMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELT 268
           +  L+V+A+ +K++ F   +M   W+KRF+ +E +N FI++YWS   +++ CPEDDH++T
Sbjct: 176 T-HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVT 234

Query: 269 TTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKK 328
             ++ CFE  F+RIRT++ F I V  YP+S+  LLEL+ ++K    YT +VT+ LS F+ 
Sbjct: 235 NEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEA 294

Query: 329 YILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLD 388
            +LNPSITT + LL YVK IK+ L +D + R    +  FV+P+  ER+  V   LYAML 
Sbjct: 295 RMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLG 354

Query: 389 LPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKE 448
           L   E +              L   L D           + DK+ +SP      V  K+ 
Sbjct: 355 LDASETRGPKPTGAHASIASQLSAELKD---SHQPIFRSALDKSAQSPVDDMASVNPKEP 411

Query: 449 TNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLXXXXXXXXX 508
                      +Y+ V+N YL W PEP+D I  +   + +   LF+I+++L         
Sbjct: 412 -----------VYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIG 460

Query: 509 XXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPAA 568
               L TD+L  LK Y+L+  W + LK+++ R   F   N++N    G+           
Sbjct: 461 EFLTLFTDKLLDLKGYRLEQNWVKSLKILKNR---FDFKNYSN--AQGV----------- 504

Query: 569 DADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGDTQN-PKDS 627
               SN+N+IDVML D+K SEELC +MH V  +   V P FIS L+W         PKD 
Sbjct: 505 ----SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDC 560

Query: 628 KFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSV 687
             R+P+ LE E++KY D+Y+Q+KPGR+L+L ++Q  V ++L F D R +  +VS+++ SV
Sbjct: 561 --RLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSV 618

Query: 688 MNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVL--SEEGEVYSVIEYSDT 745
           +    +   E   +S  ++ E+  +  +++ Q L FW+   VL    +  +YS +E  DT
Sbjct: 619 L----ACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDT 674

Query: 746 GFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKLNKIHSFL 805
             + ++++  M+  +      D S+ ++  E ++++  PFI GML NLG +K+ KIHSFL
Sbjct: 675 D-NASEREAQMRAEDQARSAFD-SQQQQFVE-SMEKVWPFIRGMLTNLGTLKVEKIHSFL 731

Query: 806 KITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848
           K+ VPK+ G+N  T  QLE YL  L DE KL   AN ++++ K
Sbjct: 732 KVAVPKEIGFNATT-AQLEAYLRLLVDENKLVCSANNAFKLVK 773

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  473 bits (1216), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 289/867 (33%), Positives = 468/867 (53%), Gaps = 98/867 (11%)

Query: 31  ADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAG 90
           +DD++SLL W++PNDPKSNHQL+PP++R+K +IK +    +  ++ G  +S +T+N++  
Sbjct: 25  SDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKIL---LDVNTLGDYDSIETLNSL-- 79

Query: 91  EGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFDL 150
                          L+ YY+FQVR +FF     I Y KDI + E YYEFP+ +VPIF  
Sbjct: 80  ---------------LRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLN 124

Query: 151 SVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSL-SS 209
           +   W  ELN +RHY+L  N+ F++NL  RL KL+ +DDFDLA  +I+W N AN SL SS
Sbjct: 125 NNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSS 184

Query: 210 MELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELTT 269
            ++I+NAL +KI  + +   +  W++RF+IMET+NKFIN+YWS F  L+ C EDDHE+T 
Sbjct: 185 KQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITK 244

Query: 270 TVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKKY 329
            ++  FE  FLRIR+ EIFDICV++YPDSK  ++EL+ ++   K  TNI+ + LS+F+  
Sbjct: 245 VLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLK 304

Query: 330 ILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDL 389
           +LN SI T   L+ Y+KT+K+ L+LDPT R L S  +F  PY Q++  ++ +LL+A+LDL
Sbjct: 305 VLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDL 364

Query: 390 PEEELKEKITFKVDMKALLSLVDILHDYDIGQN-----TDAHKSKDKNKRSPFLWNLKVK 444
             +++K     KVD   L  L + L +   G N      D   + +    +  +  L   
Sbjct: 365 RTDDIKTNPIVKVDQNLLKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQLDYA 424

Query: 445 GKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLXXXXX 504
           G++ +         +LY  +LN  LTW+PE   + P        K NL +IL  +     
Sbjct: 425 GQESSQ--------LLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHE 476

Query: 505 XXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETT 564
                   LL  +L  +K Y L++ W QCL+L + +           +  N +   P +T
Sbjct: 477 LFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTK-----------FSPNSLDDAPTST 525

Query: 565 ---APAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGDT 621
                  + D   + +IDVMLWD++ S++L  +MH +  LD  +  K IS LYW++  D 
Sbjct: 526 NLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQY--DM 583

Query: 622 QNPKDSKF-----RIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKL 676
           +N K   +     ++   L  +L KYS +YS++KPGR L L  DQ  +E++ +F D R +
Sbjct: 584 KNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTV 643

Query: 677 VLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEV 736
             + + E Y  +  F   N+   + +L++LS   +     L   L FW+ + +L  +G+ 
Sbjct: 644 TCECTFENYMSICPF-LENEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKT 702

Query: 737 YSVIEYSDTGFSQTQKDVLMK-----NVNN-----NNEL-------RDESEVEKKCELTL 779
           Y  +EY D      + +++++     NVN+     NN L       +    +++  +  +
Sbjct: 703 YRPLEYLD------RSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENI 756

Query: 780 QRSLP------------------FIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLL 821
            +  P                  ++  +L NLG   + K+++ L+ T   D    +++ +
Sbjct: 757 TKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSV 815

Query: 822 QLEKYLNTLTDEGKLKYIANGSYEIAK 848
            LE  +  L + G++  + NG Y++ +
Sbjct: 816 TLENIVTELVENGQILCLPNGLYQLPE 842

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  461 bits (1187), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 258/740 (34%), Positives = 433/740 (58%), Gaps = 58/740 (7%)

Query: 27  HTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTIN 86
           + +I+D+L +LLIW+ PNDP SNH L PP+L++K IIK + P   S+  Y          
Sbjct: 26  YKDISDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITP---SSDIYK--------- 73

Query: 87  AVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVP 146
                 + +  ++  + + LK +YV+QVR +FF + ++I   KD+ + E YY+FPL+++P
Sbjct: 74  ------DPSNSIKNNIQNWLKLFYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIP 127

Query: 147 IFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGS 206
           +F  +  +W  EL SLRHY+L++N +F   + + L +LI ++DF+ + +++ W+   + +
Sbjct: 128 LF--TFQEWCFELLSLRHYILHQNKEFTQKIILELRQLIKEEDFETSLDIVTWIREVDSN 185

Query: 207 LSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHE 266
           L S   I++ L  KI  +CE  M G W +R+++MET+N F+  YW  F +L+ C ED+H+
Sbjct: 186 LLSENFILDILLEKITLYCEQTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHK 245

Query: 267 LTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDF 326
           +T  +F  FE  F++IR +EIF IC+L+YPD+K  LLEL+ ++  +  +  +V  FLS F
Sbjct: 246 ITNILFKYFEKQFIKIRIQEIFKICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAF 305

Query: 327 KKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAM 386
           ++ +L P+I T+D LL Y++T+K+F +LDP+GR L+SI  ++ P+F+ERK L  +LL+A+
Sbjct: 306 ERIVLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAI 365

Query: 387 LDLPEEELKEKI-TFKVDMKALLSLVDILHDYDIG-QNTDAHKSKDKNKR---SPFLWN- 440
           L LP+ +L+  I   KV   +L  +++ L D ++G +NT   K+  K      SP  +N 
Sbjct: 366 LALPKIDLENAIYPIKVSSISLKLIINELEDPELGIENTSTKKNSIKKFNEILSPKRFNN 425

Query: 441 ------LKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFE 494
                 L    +  ++ED  +  T+L + V+  +LTWVP PNDI     K  Y  TNL +
Sbjct: 426 HNSSEYLPDLLQNTSSED--SNSTLLVQKVVKQFLTWVPIPNDIATNDTKKLYSSTNLLD 483

Query: 495 ILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVK----FTETNHA 550
           ILL++             LL+ RL   K YKL+ KW  CL+L+R+R       +T TN A
Sbjct: 484 ILLNIFESKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTNLA 543

Query: 551 NYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFI 610
           +            T    + +   + +++VML D+  S ELC+  H   G++  V+PKFI
Sbjct: 544 D------------TDNLVNGENLKITNMNVMLSDLNYSSELCKIFHHANGVNTRVYPKFI 591

Query: 611 SLLYW-----KHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVE 665
           S  YW     ++  +  N + + F+IP  L    ++Y+ +Y  +  GR++ +  ++G +E
Sbjct: 592 SSHYWVDLDDENVSNGPNEETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIE 651

Query: 666 MELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPIN---LSLKQLSESLNITTSKLLQLLN 722
           ++LSF DGR L +D +L QY+++      N    N    ++ +LS  LN++   + +L++
Sbjct: 652 IKLSFEDGRVLEIDATLPQYALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVD 711

Query: 723 FWIQKGVLSEEGEVYSVIEY 742
           FW++K VL +  + YS++EY
Sbjct: 712 FWLKKNVLKKVDDKYSILEY 731

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  447 bits (1150), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 278/830 (33%), Positives = 454/830 (54%), Gaps = 87/830 (10%)

Query: 31  ADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAG 90
           A++ N LL W+ P   K NHQL+PP+L +K +I+ L    + ++ Y              
Sbjct: 27  AEEWNVLLQWLDPAG-KKNHQLKPPNLLVKTMIEKLL---LGSNDY-------------- 68

Query: 91  EGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFDL 150
                     QLLS +++YY +Q R +F+  +  I  L +++R E +  FPL+Y+PIF+ 
Sbjct: 69  ----------QLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFE- 117

Query: 151 SVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSLSSM 210
             N    E+    +Y+L  N K  +    RL   +++DDF+LA  ++ + ++      S 
Sbjct: 118 GNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQT--DST 175

Query: 211 ELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELTTT 270
            ++++ + +KIE+FC+ + +  WNKR++IMETFN+FI+QYW Q   L+ C ED+H +T T
Sbjct: 176 SIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNT 235

Query: 271 VFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKKYI 330
           ++  FE  F+ IRT EIFDIC+      +  LLEL+K +    D+  +V + LS F   +
Sbjct: 236 LYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKV 295

Query: 331 LNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDLP 390
           +NPSI T DAL  Y++TIK F +LDP+GR L +I ++VKP+F++RK LV++LL++ML L 
Sbjct: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355

Query: 391 EEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKETN 450
           E +    +  +V  + L +L + L D +I   T+    +  +   P +      G     
Sbjct: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYTE----ESDDVVDPMI------GSFSKE 405

Query: 451 EDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYI---KTNLFEILLDLXXXXXXXX 507
           ED     +M+ E V+  Y+ W+PE    +P S     +   K +LF+ILL+L        
Sbjct: 406 ED-----SMVLEQVIKRYMEWIPE----VPTSFGKGILSDHKLDLFDILLELLESKETLV 456

Query: 508 XXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPA 567
               NLLT +L  L+ Y LD KWS+ L L+++R                      +T   
Sbjct: 457 IEFKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDN------------------RSTETM 498

Query: 568 ADADQSNLNSIDVMLWDIKCSEELCRKMH-EVAGLDPTVFPKFISLLYWKHNGDTQNPKD 626
            + D +N+N+ID+ML DI  S ++   M  ++   +  V+PK +S LYW +N DTQ+ K 
Sbjct: 499 DEEDLNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQS-KA 557

Query: 627 SKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYS 686
             F +  +LE  L+ YS  YSQ + G++L+L +D G V + LSF DGR +    SL QYS
Sbjct: 558 GDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYS 617

Query: 687 VMNQFNS----TNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEY 742
           V+  F S    +N     L++ +L     + + ++  +L +W+ K VL      Y  +E+
Sbjct: 618 VLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEF 677

Query: 743 ----SDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKL 798
                D+ ++    DVL ++V     +   S+ E K E  ++R+LP+I+ +L NLG +K+
Sbjct: 678 LRWKGDSTYAAI-PDVLEESV-----VERSSQHEDKQENHVERALPYIKDILLNLGTLKI 731

Query: 799 NKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848
           +K+H+ L+  +PKD  Y+ +   QL+ YL+TL +EG L   +N SY++ +
Sbjct: 732 DKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  390 bits (1002), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 281/885 (31%), Positives = 441/885 (49%), Gaps = 130/885 (14%)

Query: 10  DLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPN 69
           DL  I   L+      FH      L SLL+W+ PN  K   Q +PP+L +K+ I +L   
Sbjct: 6   DLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCINLL--- 58

Query: 70  NVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLK 129
                              AG     K         L+EYY++ V++HF    ++I  LK
Sbjct: 59  ------------------RAGYSQDEK-----FKMWLREYYLYVVKFHFMKNVDEISVLK 95

Query: 130 DIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRL-------N 182
           D +  E  Y +PL+++ + D +  D S  + S +HY++++N+ F+ NL  +        N
Sbjct: 96  DFKLLEMIYIYPLQFMDLVDST--DISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGN 153

Query: 183 KLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMET 242
           +   + +F     +I W+  + G LS+ +LI++A   KIE F    M G  N++F++MET
Sbjct: 154 QFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMET 213

Query: 243 FNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVAL 302
           FNKFI+ YW    +LI   EDDH+LT  ++  FE  F++IR  EI  I V  YP +K  +
Sbjct: 214 FNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTI 273

Query: 303 LELKKIMKDFKDYT---------------NIVTKFLSDFKKYILNPSITTVDALLRYVKT 347
           LELK I+      T                ++ +FL  FK+  LNP I T+D L  YVK 
Sbjct: 274 LELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKA 333

Query: 348 IKAFLVLDPTGRCLHSIITFVKPYFQERK-HLVNVLLYAMLDLPEEELK----EKITFKV 402
            K+FL+LDP+G  L+SI+ FVKPY +  +  +V++LLYA+L+L  ++L     EK T+  
Sbjct: 334 TKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTY-- 391

Query: 403 DMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYE 462
           DM+++  L   L +       D     D  K SP          + TNE      T+ YE
Sbjct: 392 DMRSIELLSKELSNDHSKHAGDV----DYKKFSP----------EGTNE--FENSTLPYE 435

Query: 463 HVLNHYLTWVPEPNDIIPGSVKSSY--IKTNLFEI--LLDLXXXXXXXXXXXXNLLTDRL 518
            V   +L W P    I   S    +  +  N+  I  + +              LLT +L
Sbjct: 436 QVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKL 495

Query: 519 SSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPAADADQSNLNSI 578
             +K Y+++D+W +CLK++++++     T+  N + +             ++  S++N+I
Sbjct: 496 LHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVND-------------ESITSDINTI 537

Query: 579 DVMLWDIKCSEELC-RKMHEVA-GLDPTVFPKFISLLYW--KHNGDTQNPKDSKFRIPAD 634
            +ML DI  S+E    K+ E     +  +FPKFIS LYW  K   + Q P DSK R    
Sbjct: 538 LIMLHDISISKESSNEKISEFQNSSEMQLFPKFISKLYWKFKRQSEYQFPLDSKLR---- 593

Query: 635 LERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSVMNQF-NS 693
             ++L KY   Y    PG +L+L    G   + L+F+DGRKL +D + EQY+V++ F N 
Sbjct: 594 --KKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHND 651

Query: 694 TNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEY----------- 742
            +D    LS+ QLS  L +   ++   L FWI K VL  + + Y++ EY           
Sbjct: 652 KDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPT 711

Query: 743 --SDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKLNK 800
             + +    +Q+ +  K     N L D  E+       L R  P+I  M  NLG++K++K
Sbjct: 712 VITSSILPLSQERMPFKRSVPTNVLNDPKEI-------LHRVYPYINDMFTNLGSLKVDK 764

Query: 801 IHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYE 845
           IHSFL ++VP+   Y+++T+ QLE YL+ L +E +L  + +GS++
Sbjct: 765 IHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  379 bits (973), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 275/880 (31%), Positives = 439/880 (49%), Gaps = 121/880 (13%)

Query: 19  QTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGV 78
           Q L   + +   A+DL+ LL+W+SP    + HQ +PPSLRIK  I               
Sbjct: 5   QILHMMLPNAKFAEDLDRLLLWLSP----AEHQCKPPSLRIKKSI--------------- 45

Query: 79  INSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFF---------LRFNDIIYLK 129
               Q I           +L     + L + Y+  +R+ F          L+FND++ L 
Sbjct: 46  ----QRIRECF-------QLSSDFTNCLVKLYIDLIRFEFISYMKENANCLKFNDVLKL- 93

Query: 130 DIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDD 189
                EN  E P  ++P  +    ++   L+ LRHY+L+ +  FK  L   +  LIM+DD
Sbjct: 94  -----ENRIEHPRLFIPELEF---EYFKNLHMLRHYLLDSDKSFKTALCTSIENLIMEDD 145

Query: 190 FDLAGNLIRWLNFANG-SLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFIN 248
           F  A  ++ W++ A    LS  +L+++ L  KI   C  ++ G W +RF+++ETFN FI 
Sbjct: 146 FYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGSWTRRFIVIETFNDFIE 205

Query: 249 QYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKI 308
            YWS F +L+ CPE+DHELT TVF CFE  F+ IR  EIF+I   AYP+SK  +LEL+K+
Sbjct: 206 VYWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINEIFEIFTSAYPESKPTILELRKV 265

Query: 309 MKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFV 368
           MK  KD   +   FL  FK  +LNP +TT+DAL  Y+K IK FL+LDP GR L+ + TFV
Sbjct: 266 MKAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFV 325

Query: 369 KPYFQERKHLVNVLLYAMLDLPEEELKE-KITFKVDMKALLSLVDILHDYDIGQNTDAHK 427
           KPYFQ++  L+N+LLYA+LDL  ++ ++  I++   +  L   +D+  D +         
Sbjct: 326 KPYFQDKSDLINILLYAILDLKPKDFEDLNISYIPGLNKL--SLDMREDPEFSIENVEPN 383

Query: 428 SKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEP------NDIIPG 481
             +  +  P   NL+  G    ++    + T++ +H++  ++ WVPEP      ND   G
Sbjct: 384 DNNYKRTVP---NLESIGANSLHD----KGTLIQDHIMKQFMMWVPEPNMNNLENDHDNG 436

Query: 482 -----------SVKSSYIKTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKW 530
                      +V S +   NL +ILLDL            NLLT +   L+ Y++D  W
Sbjct: 437 NDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLTIKFFKLQNYRVDPNW 496

Query: 531 SQCLKLIR-----------ERIVKFTETNHANYITNGILGLPETTAPAADAD--QSNLNS 577
            +CL+LI            E++ +       N      +     T  + D +  Q +LN 
Sbjct: 497 QKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASNDMEEIQISLNK 556

Query: 578 IDVMLWDIKCSEELCRKM------HEVAGLDPTVFPKFISLLYWKHN----GDTQNPKDS 627
           I+VML DI+ SE+   ++      + +   +  + PKFIS LYW +     G     K++
Sbjct: 557 IEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISPLYWDYEDNELGVNNFLKEN 616

Query: 628 KFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSV 687
            F    +  + + +Y+  Y  +  G  L  CK +  +E+E+SF DG      V+  QY V
Sbjct: 617 VF--DEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIKGFLVNASQYYV 674

Query: 688 MNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEYSDTGF 747
           +  F++ N++    S+    E+   + ++++  L FW++K VL  EG  Y    YS    
Sbjct: 675 LTLFDTGNEKLTIESILTAGEAKR-SKNEIIDALKFWVEKNVLVYEGGYY----YSRDLH 729

Query: 748 SQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKI 807
           S       ++N   N   R +       +L ++ +LP+I+ ML + G +  ++I +FLK 
Sbjct: 730 S-------IENSKGNTTTRTD-------DLLVKEALPYIKTMLESFGNLSASRIQNFLKA 775

Query: 808 TVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIA 847
           T+P     + I +  +   L+TL  +G L   ++GSY++A
Sbjct: 776 TLPAAQDSDHI-ITDIHSVLDTLVSDGILFKNSSGSYKLA 814

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  328 bits (840), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 206/533 (38%), Positives = 309/533 (57%), Gaps = 45/533 (8%)

Query: 331 LNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDLP 390
           +NPSITTVDAL+ YVKT+K+FL LDP+G+ LHSI TFV PY QER  LV+VLLYA+LDL 
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 391 EEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGKKETN 450
            E  +E+    +D  +L+ L D L D + G   + +   DKN         ++ G+    
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKN---------ELTGQPSNK 111

Query: 451 EDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLXXXXXXXXXXX 510
                  ++LY  V+   L WVPE + I     K   ++ NL +ILL++           
Sbjct: 112 S---GDSSLLYRQVITQMLNWVPESSKIDSKRQKMIGLRKNLLDILLEIFENNEVFIAEF 168

Query: 511 XNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPAADA 570
             LLT +L  LK+YKLD +WS+CLKL++E+     + N A     G   +         +
Sbjct: 169 LKLLTKKLLKLKYYKLDSRWSKCLKLLKEKF----KGNSA-----GTTSISTNIGNVTGS 219

Query: 571 DQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGDTQNPKDSKFR 630
           D   +N+IDVMLWD+K S +L  +MH++ GLD  + PKFIS LYW    ++++  ++  +
Sbjct: 220 DLVYINNIDVMLWDLKTSGDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQ 279

Query: 631 IPAD--LERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSVM 688
              D  L  +L+KY  +YS++KPGR L L KD G VE+E +F DGR +  D +LEQ +++
Sbjct: 280 TQIDPLLSTQLEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNII 339

Query: 689 NQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEYSDTGFS 748
           N F+    E   LSL+QL     I ++ L ++L FW+ + VL  +G++Y ++EY D    
Sbjct: 340 NYFSEAVSEN-GLSLEQLHILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLD---- 394

Query: 749 QTQKDVLMKNVNNNNE-LRDESEVE--------------KKCELTLQRSLPFIEGMLANL 793
             Q +++++++ +  E L++E ++                K   TL    P+I+GML NL
Sbjct: 395 --QPEIIVQSLTHTGEVLKEEQKLNPLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNL 452

Query: 794 GAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEI 846
           G++KL KIHSFL+ TVPKD  YN IT+  LE YLN+L ++  L+ +A+GSY +
Sbjct: 453 GSLKLEKIHSFLRATVPKDVNYNSITVSSLEVYLNSLVEDDVLELLASGSYRL 505

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  326 bits (835), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 222/733 (30%), Positives = 375/733 (51%), Gaps = 83/733 (11%)

Query: 30  IADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVA 89
           + DDL +LL W++PND  +NHQ+R PSLRIKN IK+L  ++                   
Sbjct: 25  LRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE----------------- 67

Query: 90  GEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFD 149
                    Q+ LL  L+++ + Q+RYHFF  +  ++  KD+ R E YYEFPL+YV +F 
Sbjct: 68  ---------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF- 117

Query: 150 LSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMD-DDFDLAGNLIRWLNFANGSLS 208
            +  + S EL  LR Y+LNRN  F+NN+  R+  LI++ DDF+++  L +W+    G   
Sbjct: 118 -TAEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH-P 175

Query: 209 SMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-EDDHEL 267
            ++ +++ L NKIE FC++ M G  +++ +I E FN FI++ W+QF +L+  P EDD EL
Sbjct: 176 MVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQEL 235

Query: 268 TTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDF-KDYTNIVTKFLSDF 326
              ++ CFE+ F+ ++T+E+FD  +  +P SK +LLE+K ++K   ++   +V +  +DF
Sbjct: 236 NNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDF 295

Query: 327 KKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAM 386
              +L PS+TT++ LL YVK IK  +V+DPTGR ++     +KP  +ER  L+  +L A+
Sbjct: 296 HSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAI 355

Query: 387 LDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGK 446
           L+L ++E+ E I+ K  +     L+D L             S    K    ++++     
Sbjct: 356 LELTKDEIHEVIS-KNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSV----- 409

Query: 447 KETNEDPLARQTMLYEHVLNHYLTWVPEP-----------NDIIPGSVKSSYIKTNLFEI 495
            +  ++PL +Q          +L W PEP           N+    + ++  +  ++ E+
Sbjct: 410 AQERQNPLVKQ----------FLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDVLEV 459

Query: 496 LLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITN 555
           +  +             L+T+ +  ++ Y L  KWSQ LK + ++           Y  N
Sbjct: 460 VFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKK-----------YFKN 508

Query: 556 GILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYW 615
               L       +  ++SNL ++ VM  D++ S        ++  +   V+PK IS LYW
Sbjct: 509 NKQVL------KSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYW 562

Query: 616 KHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRK 675
           K    ++      +RI + L    Q+    +    PGR+L+   DQG VE+ L+F DGR 
Sbjct: 563 K---ISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRH 619

Query: 676 LVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEG- 734
               VSL +Y+V+  F      P  L    + +  ++    +  ++ +W Q+ VL   G 
Sbjct: 620 WSNKVSLPKYTVIELFQKV---PRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGD 676

Query: 735 EVYSVIEYSDTGF 747
           + Y ++E +D  F
Sbjct: 677 DCYRILERADVAF 689

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  328 bits (841), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 240/853 (28%), Positives = 410/853 (48%), Gaps = 93/853 (10%)

Query: 21  LSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVIN 80
           L  Y+      DDL  ++ W+ P      H   PPSLR+K  I+                
Sbjct: 12  LKRYLATEQEQDDLERVMGWIHPQ----AHACHPPSLRMKKAIR---------------- 51

Query: 81  SGQTINAVAGEGNT-NKELQLQLLSTLK-EYYVFQVRYHFFLRFNDIIYLKDIQRWENYY 138
                 +V G+ +  +++ ++  +  +K EY   QV+  F          K IQ  E+  
Sbjct: 52  ------SVLGKASELDRQFKIYYIDVIKQEYLCDQVKREF----------KHIQVLESKL 95

Query: 139 EFPLRYVPIFDLSVNDWSLE--LNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNL 196
            +P+ Y+P   +S +  ++E  + SLRHY+++ +   +N+L      L+ DDDF+    +
Sbjct: 96  VYPVTYLPFLSIS-DQLAIEQTICSLRHYLVDNDDNLRNSLVAEFETLMQDDDFESGYQI 154

Query: 197 IRWLNFANGSL-SSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFC 255
           I WL  AN  L     L ++ + +KI   C+  M   W  +F++M TFNKFIN YWS   
Sbjct: 155 IEWLYTANAKLLRPWNLALDTIVSKISTLCDNEMRRNWEAKFLVMNTFNKFINLYWSHLA 214

Query: 256 ELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDY 315
           + +   ED+H+ T  ++ CFE  F+RIRT EIF+I V +Y  +K  +LEL+  M  ++  
Sbjct: 215 KFLHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEIVVESYQAAKTTILELRTFMSGYERL 274

Query: 316 TNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQER 375
           + +V +FL  FK  +LNPS+ TV+AL+ +++++K F++LDP  R +H+I  FVKP+F +R
Sbjct: 275 SKLVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQR 334

Query: 376 KHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHD------YDIGQNTDAHKSK 429
              V ++LYA+LDL + + +     K+ +  +  L ++ H+       +I          
Sbjct: 335 GDAVQIILYAILDLRDVDFE-----KMGVSPVKGLSELSHELREDPYVNINAKCQTPTPS 389

Query: 430 DKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPN-----DIIPGSVK 484
                SP L +       +  +D      ++Y+ VLN +             D +  +VK
Sbjct: 390 PSKISSPHLNDSSSMDVDDKLDD--GTTDLVYKQVLNQFXXRGHHETNQGTRDYVGVNVK 447

Query: 485 SSYI--KTNLFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIV 542
            S    +TNL + L +L             LLT +L  L  Y L+  W++C +LI+ ++ 
Sbjct: 448 FSQRSNRTNLLDPLFELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKRKVT 507

Query: 543 KFTETNHANYITNGILGLPETTAPAADADQS---NLNSIDVMLWDIKCSEELCRKMHEVA 599
           K       +    G L      AP +  ++    +LN IDVML D++ + ++ R++H  +
Sbjct: 508 K------GDVGDGGPLSRDTADAPVSSNNEQVLLSLNKIDVMLHDLRENAKITRRLHRTS 561

Query: 600 GLDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPAD--LERELQKYSDIYSQMKPGRRLQL 657
            L+  VFPKFIS  YW +  DT     ++ +I  D  LE ++ +Y   + ++K GR ++L
Sbjct: 562 MLNGNVFPKFISSQYWSYRDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRL 621

Query: 658 CKDQGKVEMELSFRDGR-KLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSK 716
           CK++   E+EL+  DG    V  V   +YSV+ ++ +T       +  +L E   +  + 
Sbjct: 622 CKEKTIFEIELTVNDGEVPQVFKVDAMKYSVIEKY-ATGGPRAGYTPTELCELCGMDIAD 680

Query: 717 LLQLLNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCE 776
           +   L +W+  G+L            S +G+ ++  +      N    L   +      E
Sbjct: 681 VQTSLTYWVNAGLL----------RLSSSGYYESTSET-GPPPNRGTPLEASTR-----E 724

Query: 777 LTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNR-ITLLQLEKYLN-TLTDEG 834
                   FI GML +LG +   +IH +L  TVP    Y   +T+LQL+ YL+  +    
Sbjct: 725 FLDGVVWTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQSTH 784

Query: 835 KLKYIANGSYEIA 847
            L+    G Y+++
Sbjct: 785 LLQQTPEGEYKLS 797

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  317 bits (813), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 221/741 (29%), Positives = 368/741 (49%), Gaps = 90/741 (12%)

Query: 29  NIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAV 88
           ++ D++ ++L WM PND  +NHQ+RPPSLRIKN I++L          G    G T+   
Sbjct: 24  SLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLL--------RLGEQAPGTTVG-- 73

Query: 89  AGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIF 148
                            L++  V Q+R HFF  +  +    D+ + E YYEFPLRYV +F
Sbjct: 74  ----------------LLRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVF 117

Query: 149 DLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIM-DDDFDLAGNLIRWLNFANGSL 207
             + ++ + EL  LR Y+LN N  F+ N+  R+  LI+ DDDF+ A  L +W+    G  
Sbjct: 118 --TEDEVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQGLGH- 174

Query: 208 SSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-EDDHE 266
             ++ ++  L  KI  FC   M G  ++R++IME FN FI + W+QF +L+  P  DD E
Sbjct: 175 PMVKFVIEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPE 234

Query: 267 LTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMK-DFKDYTNIVTKFLSD 325
           L   ++ CFE  F+ ++T+E+F   +  +P SK ALLE+K ++K D  +   +V +  +D
Sbjct: 235 LNNLIYRCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYND 294

Query: 326 FKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYA 385
           F K +L PS+TTV+ LL YVKTIK  +V+DPTGR ++   + +KP  +ER  L+  +L A
Sbjct: 295 FHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCA 354

Query: 386 MLDLPEEELKEKITFKV--DMKALLSLVDILHDYDIGQNTDAHKSKD-KNKRSPFLWNLK 442
           +L+L  +E+ E I+     +   LLS +                SK+ KN  +    ++ 
Sbjct: 355 ILELDSDEIHEVISKNTLTENPQLLSQL----------------SKELKNSTALTFHSMS 398

Query: 443 V-KGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSVKSS----------YIKTN 491
             KGK         RQ    + ++  +L W PEP        K+            +  +
Sbjct: 399 TSKGKAAIYSVAFERQ----DQLVKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKD 454

Query: 492 LFEILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHAN 551
           + E++  +             L+T+ +  +  Y L+ KWSQ LK + ++  K    N+  
Sbjct: 455 VLEVVFQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKWSQLLKTVMKKYFK----NNKQ 510

Query: 552 YITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFIS 611
            + +               ++SNL ++ VM  D++ S        ++  + P V+PK IS
Sbjct: 511 VLKSM-------------CEESNLVNVFVMWSDLEKSATFQTWSTKLQLVPPNVYPKIIS 557

Query: 612 LLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFR 671
            LYWK     ++P    + +   L     +    +    PGR+L+  KDQG V+++L F 
Sbjct: 558 YLYWKIG--RRSPY-GDYAVAPGLAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVFE 614

Query: 672 DGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLS 731
           DGR     VSL +Y+V++ F     +   LS+  ++   N++   +  ++ FW  + VL 
Sbjct: 615 DGRHWSSRVSLPKYTVIDLFQR---QACPLSVTDIAAHTNMSPRLVEDIIQFWCHEHVLH 671

Query: 732 -EEGEVYSVIEYSDTGFSQTQ 751
             + ++Y ++E  ++  +  Q
Sbjct: 672 LNKNDLYEILENHNSAIASRQ 692

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  300 bits (769), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 280/950 (29%), Positives = 440/950 (46%), Gaps = 203/950 (21%)

Query: 34  LNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAGEGN 93
           L ++L+W++PN+  +       ++ +KN I      N+  S+YG                
Sbjct: 30  LQTMLLWLNPNETTTQSATTM-TIDLKNCI------NIIVSTYG---------------- 66

Query: 94  TNKELQLQLLSTLKEYYVFQVRYHFFL--RFNDIIYLKDIQRWENYYEFPLRYVPIFDL- 150
             K+ Q++LL   K+YY F ++ HF    R  ++  +++  + EN Y  PLR+   +DL 
Sbjct: 67  --KDDQIRLL--FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLI 120

Query: 151 SVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIM-DDDFDLAGNL------IRWLNFA 203
             N+    +N  + Y++N N  F+ N+   +  L + +D F+   N+      + WLN A
Sbjct: 121 DTNEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDA 180

Query: 204 NGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-- 261
           NG++S ++L+++ L  KIEKFC+  M+G+WN RF+IME FN FINQYW    +L      
Sbjct: 181 NGNVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQF 240

Query: 262 -----EDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIM------- 309
                E+DH LT  ++  F   F++IR  E   I V  +P S   ++ELK ++       
Sbjct: 241 DYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPR 300

Query: 310 --------KDFKDYTNI--------VTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLV 353
                     F+D TN+        V KFL DF++  LNP I T+  +   VK   +FL+
Sbjct: 301 ENVSTTATTTFRD-TNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLI 359

Query: 354 LDPTGRCLHSIITFVKPYFQER-KHLVNVLLYAMLDLPEEEL-KEKITFKVDMKALLSLV 411
           LDP G+ L +II  +KP  Q R   +VN+LLYAML+L E EL K       D+++   LV
Sbjct: 360 LDPRGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILV 419

Query: 412 DILHDYDI------------------GQNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDP 453
             L+   I                  G  T     +  N   P+  N+K      T E  
Sbjct: 420 SELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPY-QNVKDMANANTME-Y 477

Query: 454 LAR---QTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYI---------KTNLFEILLDLXX 501
           LAR   +T  +  +   YL WVP  N I   + K++ +           +  + L     
Sbjct: 478 LARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFD 537

Query: 502 XXXXXXXXXXNLLTDR-LSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGL 560
                      LLT++ + S  +Y LD+ W  CL L++E+      +N +N        +
Sbjct: 538 SIDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEK------SNSSN--------V 583

Query: 561 PETTAPAADADQSNLNSIDVMLWDIKCSEELCR-----KMHEVAGLDPTVFPKFISLLYW 615
           P+         +S +N+ID+ML D+K S    +     K + +   D   +PK +S LYW
Sbjct: 584 PDENV------KSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYW 637

Query: 616 KHNGDTQNPKDSKFRIPADLERELQKYS---------DI-----YSQM-KPGRRLQLCKD 660
           K N  + N    +  +  D    L KYS         DI     ++++ + G++++L KD
Sbjct: 638 KIN--STNIAKWRMNMKGDF-FHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKD 694

Query: 661 QGKVEMELSFRDGRKLVLD-VSLEQYSVMNQFNSTNDEPINLSLK-QLSESLNITTSKLL 718
           +  +EM++SF DGR+L  D +++EQY V++ F         L         L     KL 
Sbjct: 695 KSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLE 754

Query: 719 QLLNFWIQKGV--LSEEGEVYSVIEY---------------------------------- 742
           + + FW+ K V  L ++   Y V+E                                   
Sbjct: 755 ECIQFWVDKKVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQE 814

Query: 743 ----SDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKL 798
                D    +T KDV+ +    N+E+++           L R  PFI GML NLG+MKL
Sbjct: 815 AAEDDDIAGFETHKDVISR---ANDEIKN----------ILDRIFPFINGMLENLGSMKL 861

Query: 799 NKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEIAK 848
            KIHSFLK+TVP+D+ YNRI + QLE YLN L ++ KL+   +G+++  K
Sbjct: 862 EKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  211 bits (536), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 184/751 (24%), Positives = 335/751 (44%), Gaps = 113/751 (15%)

Query: 28  TNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINA 87
           +N+ ++++ +L W++P       Q + P+LRIK  +KV+   +   + +           
Sbjct: 21  SNLEEEVDMVLAWLNPT-----FQPQIPTLRIKQCLKVVLEQSDERTRF----------- 64

Query: 88  VAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPI 147
                             +++YY+  +R HFFL+F+DI+  KD+ + E  Y   + +  +
Sbjct: 65  -----------------LIEQYYLTLIRTHFFLQFDDIVNWKDMIKLEKLYISKVEF--M 105

Query: 148 FDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSL 207
           F  SV     E+ S +  ++ +N +F+  L  +L   I+D+D      + +WL  A    
Sbjct: 106 FGTSVYWIKEEMISFKRLLMKKNNEFRKQLHAKLESHILDNDLVRFDQMYQWLAPAFDG- 164

Query: 208 SSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHEL 267
             +E  V  +  K+++  +  M    + R+++M T+N FI  +WS+F +L+   EDDHEL
Sbjct: 165 QEIEFNVRIINLKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLLII-EDDHEL 223

Query: 268 TTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIM-KDFKDY-TNIVTKFLSD 325
           T  ++  FE N+++ +  E +   V  +P S+  LLEL+ I+ KD K   T ++      
Sbjct: 224 TAIIYQSFEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSILNKDIKTVGTKVLETLYHG 283

Query: 326 FKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYA 385
           F    L  S+ T + L  Y+KT+K   ++DP G CL S+   V+ Y   R  ++  LL  
Sbjct: 284 FVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRPDIIKTLLLG 343

Query: 386 MLDLPEEELKEKITFKVD-----MKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWN 440
           +      E + KI    D     ++ L      + D+ +G              +   W 
Sbjct: 344 IFPFQNNE-RFKIASSTDGSSVHLEKLEQFSREVGDFSMGPELP----------TALPW- 391

Query: 441 LKVKGKKETNEDPLARQTMLY-EHVLNHYLTWVPEPNDIIP-----GSVKSSYI-KTNLF 493
                    N+  L R T    + +L  YL WVPEP  I             Y+   +L 
Sbjct: 392 --------FNQPHLPRCTYDGDDQLLKQYLNWVPEPPRIKLDVEDFADNDGKYVPPVDLI 443

Query: 494 EILLDLXXXXXXXXXXXXNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYI 553
            +LLD+             +++ +    + Y LD +W + + +                I
Sbjct: 444 HVLLDVLESKRTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDI----------------I 487

Query: 554 TNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFP--KFIS 611
            N + G  + T  + +AD ++LN +D+ML D++ S +   ++          FP  K +S
Sbjct: 488 LNHLEGTRKGTVTSEEADLTHLNDVDIMLEDLRLSSQFRNQVAHKNNSHFENFPHIKILS 547

Query: 612 LLYWKH----NGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQL-CKDQGKVEM 666
            LYW+H    NG       +K++  +++E  +QK + +Y ++  GR L+       +V +
Sbjct: 548 KLYWRHYQNLNGRLVT---TKYKWDSEMEPLIQKLTKVYERLNTGRTLKFDTGSSSRVSI 604

Query: 667 ELSFRDGRKLVLDVSLEQYSVMNQF-NSTNDEPI--------------NLSLKQLSESLN 711
            +  + G +    V++EQY V++ F N TN                    +LK L +  +
Sbjct: 605 NIVTKSGERRFFKVTMEQYLVISHFQNETNGRNAPGMMADCNYVIPERRYTLKDLHKMTS 664

Query: 712 ITTSKLLQLLNFWIQKGVLSEEG-EVYSVIE 741
           +   K+L +L+FW QK ++++   + YSV E
Sbjct: 665 MPRQKILDILSFWQQKEIVTKHSDDSYSVQE 695

>KLTH0H11176g Chr8 complement(957667..959991) [2325 bp, 774 aa] {ON}
           weakly similar to uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 774

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 9/119 (7%)

Query: 628 KFRIPADLERELQKYSDIYSQMKPGRR-----LQLCKDQGKVEMELSFRDGRKLVLDVSL 682
           + +IP  L+   QK+   Y++  P        LQ      +V+      DGR L+L+++L
Sbjct: 557 ELKIPRSLDALWQKFCAFYAESDPRSTKKPLVLQNMLHHLEVQTNFKLEDGRPLMLELTL 616

Query: 683 EQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIE 741
            Q S+++ FN + +    L+++ +   L +  + L   L  +I  G+L+ +G  + V E
Sbjct: 617 LQASILDLFNESGE----LTVRDIESELGVAANILEPALTSFISAGLLNTDGGSFIVNE 671

>NCAS0A09070 Chr1 (1794111..1796423) [2313 bp, 770 aa] {ON} 
          Length = 770

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 74/145 (51%), Gaps = 13/145 (8%)

Query: 601 LDPTVFPKF-ISLLYWKHNGDT-QNPK--DSKFRIPADLERELQKYSDIYSQMKPGRRLQ 656
            +P VF +  +  L+ ++ G+T + PK   +++    +  +E  K+  +  ++ P   LQ
Sbjct: 524 FEPLVFERQKVPHLFLENTGETVELPKGLSARWESFVNFYKEENKHGSL-QKLSPAYNLQ 582

Query: 657 LCKDQGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSK 716
            C+    V+   +  +G  L L+++L Q  V++ FN    E  NL+ K+L   L ++ + 
Sbjct: 583 HCE----VDTPYTLPNGESLTLELTLFQTCVLSLFN----EISNLTFKELQNQLKLSVAT 634

Query: 717 LLQLLNFWIQKGVLSEEGEVYSVIE 741
           L  +L  +I  G+L  E E Y++ E
Sbjct: 635 LQLVLKSFIDIGILYLEDEQYNLRE 659

>ADR106W Chr4 (894779..897175) [2397 bp, 798 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL132W (CDC53)
          Length = 798

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 72/156 (46%), Gaps = 18/156 (11%)

Query: 578 IDVMLWDIKCSEELCRKMHEVAGLDPTV----FPKFISLLYWKHNGDTQNP---KDSKFR 630
           I  M  D++ S++L ++       +P      +P+F   +      +T  P   ++ +F+
Sbjct: 513 ITKMFQDVRLSKQLGQEFDSQIKSEPDYSKERYPEFQPFVL----AETMWPFPYQEVEFK 568

Query: 631 IPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSF-RDGR-KLVLDVSLEQYSVM 688
           +P +L  E QK  D+Y +   GR L+      + E+     R GR      V+L Q +++
Sbjct: 569 LPQELVAEHQKLVDLYVKKHSGRVLKWLWPLSRSELRADIGRPGRPPFHFTVTLFQMAIL 628

Query: 689 NQFNSTNDEPINLSLKQLSESLNITTSK-LLQLLNF 723
             FN  +     LS +Q+ E  N+TT   +L +L F
Sbjct: 629 LMFNEND----TLSFEQIQEGTNLTTQHIILSMLPF 660

>TPHA0P00850 Chr16 complement(172533..175004) [2472 bp, 823 aa] {ON}
           Anc_7.296 YDL132W
          Length = 823

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 19/146 (13%)

Query: 578 IDVMLWDIKCS----EELCRKMHEVAGLDPTVFPKFISLLYWKHNGDTQNP---KDSKFR 630
           I  M  D++ S    EE    + E+    P  +P+    +      +T  P   ++S++ 
Sbjct: 515 IAKMFQDVRLSKIVEEEFNSSVKELPDYSPLKYPELEPFIL----AETMWPFQYQESEYT 570

Query: 631 IPADLERELQKYSDIYSQMKPGRRLQ----LCKDQGKVEMELSFRDGRKLVLDVSLEQYS 686
           +P DL+    K  D+Y     GR L+    LC+  G+++  ++          V+L Q S
Sbjct: 571 VPPDLKPSFTKLEDMYITKHSGRILKWLYPLCR--GELQANIAKTHNAPFNFTVTLYQMS 628

Query: 687 VMNQFNSTNDEPINLSLKQLSESLNI 712
           ++  +N + +    L+L+Q+ E  N+
Sbjct: 629 ILLLYNGSENN--QLTLEQIQEGTNL 652

>AFR617C Chr6 complement(1549456..1551771) [2316 bp, 771 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL047C
           (RTT101) and YBR259W
          Length = 771

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 60/129 (46%), Gaps = 13/129 (10%)

Query: 613 LYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSF-- 670
           ++ +HN   +   D    I   LER+        S M P   ++       +E+E  F  
Sbjct: 555 IFLEHNITVKTLPDDLCPITPSLERQ-------SSVMPPSTVVEEQCSLHHLEIETPFLL 607

Query: 671 RDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVL 730
           +D R L LDV++ Q  +++ FN+ +    ++SL  +S    I  ++L   ++ ++   ++
Sbjct: 608 KDNRNLTLDVTMVQACILDMFNNQD----SVSLDDVSNKYGIQVAELKTAMDSFVSINMM 663

Query: 731 SEEGEVYSV 739
             EG  Y++
Sbjct: 664 KCEGGQYTI 672

>Ecym_2336 Chr2 complement(652787..655114) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii AFR617C
          Length = 775

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 631 IPADLERELQKYSDIYSQMKPG--RRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSVM 688
           +PADL++ L++ + + +        + Q      +VE   +F D  K +LDV++ Q  ++
Sbjct: 570 LPADLQKTLEELNSLRTNSSSPIVTQSQFALHHLEVETPFTFPDNSKFILDVTMVQACIL 629

Query: 689 NQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVY 737
           + FN  +     +++ Q+S    I   +L   +  ++  G++ + G  Y
Sbjct: 630 DYFNDLD----QITVDQVSRRYGIEDFELTMAMESFVSIGMVKKVGNNY 674

>NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296
          Length = 816

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 90/211 (42%), Gaps = 40/211 (18%)

Query: 625 KDSKFRIPADLERELQKYSDIYSQMKPGRRLQ----LCKDQGKVEMELSFRDGRKLV-LD 679
           ++ +F++P DL++  +K  +IY++   GR L+    LC+  G++   +  + GR      
Sbjct: 571 QEVEFKLPQDLQQSYKKLEEIYTEKHNGRILKWLWPLCR--GELSAAIG-KPGRPAFHFT 627

Query: 680 VSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSV 739
           V+L Q +++  FN    E   L+L+ + E+ N+    +   +  +I+  +L +       
Sbjct: 628 VTLFQMAILLLFN----EKDVLTLENIQEATNLNLQNIAAAMVPFIKYKLLQQSPPGLEA 683

Query: 740 IEYSDTGF----------------SQTQKDVL---------MKNVNNNNELRDESEVEKK 774
           +   DT F                   + D+L          K V   N L +  ++EK 
Sbjct: 684 LMKPDTEFKISLPYKALRTNINFAGGVKSDILNGLISADGTTKRVPGTNGLTENEKIEK- 742

Query: 775 CELTLQRSLPFIEGMLANLGAMKLNKIHSFL 805
            EL  +R + F+E  +  +   K    HS L
Sbjct: 743 -ELNAERQI-FLEACIVRIMKAKRKSPHSML 771

>ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {ON}
           highly similar to uniprot|Q12018 Saccharomyces
           cerevisiae YDL132W CDC53 Cullin structural protein of
           SCF complexes (which also contain Skp1p Cdc34p and an
           F-box protein) involved in ubiquitination SCF promotes
           the G1-S transition by targeting G1 cyclins and the
           Cln-CDK inhibitor Sic1p for degradation
          Length = 819

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 10/97 (10%)

Query: 625 KDSKFRIPADLERELQKYSDIYSQMKPGRRLQ----LCKDQGKVEMELSFRDGRKLVLDV 680
           +D  F++P  L+   +K  ++YS    GR L+    LC+  G++   +  +        V
Sbjct: 569 QDVDFKLPLVLQHSYEKLEEMYSNKHNGRVLKWLWPLCR--GEIRAAIGKQGRPPFQFTV 626

Query: 681 SLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKL 717
           +L Q S++ QFN  ND    L+L+Q+ E  N++   +
Sbjct: 627 TLFQMSILLQFND-NDV---LTLEQIQEGTNLSVQNI 659

>TPHA0A00880 Chr1 complement(172938..175088) [2151 bp, 716 aa] {ON}
           Anc_3.151 YOL068C
          Length = 716

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 65/130 (50%), Gaps = 13/130 (10%)

Query: 264 DHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFL 323
           D +L + +++C +   L++   +  D+    + D     L+ K+IM+ FKD+  +VT+ L
Sbjct: 269 DLDLLSRIYDCTDVQSLQLTAEDQDDVIYNNFDDP----LDQKQIMRIFKDFQMVVTRVL 324

Query: 324 -SDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVL 382
            SDF+     P+  T  +L+  ++  K  +VL  TG  + + +    P F+  +   + +
Sbjct: 325 HSDFRI----PTYLTTSSLVDILERSKNIIVL--TGAGISTSLGI--PDFRSSQGFYSQI 376

Query: 383 LYAMLDLPEE 392
               LD P++
Sbjct: 377 KNLGLDDPQD 386

>Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON}
           YJL047C (RTT101) - Regulator of Ty1 Transposition
           [contig 76] FULL
          Length = 772

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 642 YSDIYSQMKPGRRLQLCKDQG---KVEMELSFR--DGRKLVLDVSLEQYSVMNQFNSTND 696
           +++ Y++ +P    +L   Q     +E+E +F+  DG  LVL+++L Q S++  FN    
Sbjct: 563 FTEFYARSEPKADKKLLTLQNTLHHLEVETNFKLDDGSYLVLELTLLQTSILELFN---- 618

Query: 697 EPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIE 741
           E   LS  ++   LN++ + L   L  +I+ G+L    E  S+ E
Sbjct: 619 EHKELSSLEIGSYLNVSGATLEVALESFIEVGLLETSEEKLSINE 663

>ZYRO0B06644g Chr2 complement(530103..532883) [2781 bp, 926 aa] {ON}
           similar to uniprot|P23643 Saccharomyces cerevisiae
           YDR495C VPS3 Vacuolar sorting protein
          Length = 926

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 346 KTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDM- 404
           + +K   + D   R L S+IT VK +  +  H++ +L      +PE+E+KE+   + DM 
Sbjct: 759 QNVKNLCMQDEGDRLLRSVITQVKSF--DVNHMLTILF-----IPEDEIKEEFLTRQDMF 811

Query: 405 KALLSLVDIL 414
           KA LS  D L
Sbjct: 812 KAFLSFNDFL 821

>Ecym_5078 Chr5 (169522..171594) [2073 bp, 690 aa] {ON} similar to
           Ashbya gossypii ADR342C
          Length = 690

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 86/221 (38%), Gaps = 50/221 (22%)

Query: 100 LQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLEL 159
           L LLS  + +   +V Y FF+ +ND+IY+KD +    Y       +P            L
Sbjct: 316 LILLSRDRSFLDLEVSY-FFIEYNDMIYIKDTKLEILYLLADAENLPQI----------L 364

Query: 160 NSLRHY-------MLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSLSSMEL 212
           N L+ Y       M  + I+   NL V+L   +     +    LI  L F  G    ++ 
Sbjct: 365 NELKEYGTDIDIQMSRKAIRAIGNLAVKLESSVK----ECVNVLIELLGF--GVEYIVQE 418

Query: 213 IVNALFNKIEKF--------------------CEANMSGVWNKRFMIMETFNKFINQYWS 252
           IV+ + N + K+                     E   + VW     I+  ++  +  +  
Sbjct: 419 IVSVIKNIMRKYPDDFAYIVPTLTEYIDSIKEPEPKSALVW-----IISEYSDMLTNFLD 473

Query: 253 QFCELICCPEDDH-ELTTTVFNCFESNFLRIRTREIFDICV 292
            F E +   ++ H E+  T+ NC    F+R  + E   +C+
Sbjct: 474 LFGEFVYTYKEQHLEVQYTILNCIVVYFVRHPSEESEKLCI 514

>ZYRO0D06380g Chr4 (540803..555583) [14781 bp, 4926 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4926

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 285  REIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRY 344
            R IF   VL++   K+  +EL  + +D   + +   K L +  K  +N SI  +  L + 
Sbjct: 3917 RGIFTSLVLSF--QKIMNMELLSVNEDDDKWLSSTAKQLMNVNKVFINSSI--LQKLEQA 3972

Query: 345  VKTIKAFLVLDPTGRCLHSIITFVKP 370
            +K IK   +  PT   + ++ITF  P
Sbjct: 3973 IKQIKEMHLAGPTVTLIRAVITFTLP 3998

>TDEL0D02110 Chr4 complement(409766..412105) [2340 bp, 779 aa] {ON}
           Anc_1.343 YJL047C
          Length = 779

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 13/123 (10%)

Query: 622 QNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCK-------DQGKVEMELSFRDGR 674
           +N   +   +  ++E+   K +D Y      +R Q  K          +VE ++   + +
Sbjct: 552 ENATATNLPLTEEMEQSWDKLTDFYRM--TDKRAQFKKLFLIDYLQHFEVETQIILSNSK 609

Query: 675 KLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEG 734
            LVLD+S  Q  V+  FN ++    +L+L  +S    I    L ++L  ++  G+L  + 
Sbjct: 610 PLVLDLSFHQTRVLCLFNDSD----SLTLDAISSRSRINRGVLTEVLKSFLNIGLLVSDS 665

Query: 735 EVY 737
           E Y
Sbjct: 666 ESY 668

>KNAG0C04070 Chr3 (800093..802603) [2511 bp, 836 aa] {ON} Anc_7.296
           YDL132W
          Length = 836

 Score = 33.1 bits (74), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 49/94 (52%), Gaps = 12/94 (12%)

Query: 625 KDSKFRIPADLERELQKYSDIYSQMKPGRRLQ----LCKDQGKVEMELSFRDGR-KLVLD 679
           +D   ++P +L    QK +D+Y+    GR L+    LC+ + + ++    + GR   +  
Sbjct: 582 QDVSLKLPDELMDSHQKLADMYTSKHNGRVLKWLWPLCRGELRADIG---KPGRPPFIFT 638

Query: 680 VSLEQYSVMNQFNSTNDEPINLSLKQLSESLNIT 713
           V+L Q S++  FN  +     L+L+Q+ E  N++
Sbjct: 639 VTLFQLSILMLFNRGD----VLTLEQIQEGTNLS 668

>YPL048W Chr16 (464401..465648) [1248 bp, 415 aa] {ON}  CAM1Nuclear
           protein required for transcription of MXR1; binds the
           MXR1 promoter in the presence of other nuclear factors;
           binds calcium and phospholipids; has similarity to
           translational cofactor EF-1 gamma
          Length = 415

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 139 EFPLRYVPIFDLSVNDWSL-ELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLI 197
           +FPL+ VP F +    + L E  ++ +Y+    +K   + +++   L  DDD +    +I
Sbjct: 43  DFPLKKVPAF-VGPKGYKLTEAMAINYYL----VKLSQDDKMKTQLLGADDDLNAQAQII 97

Query: 198 RWLNFANGSL 207
           RW + AN  L
Sbjct: 98  RWQSLANSDL 107

>CAGL0G08294g Chr7 complement(784203..785018) [816 bp, 271 aa] {ON}
           highly similar to uniprot|Q06543 Saccharomyces
           cerevisiae YLR243w
          Length = 271

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 11/76 (14%)

Query: 350 AFLVLDPTGRCLHSIITFVKPYFQ---ERKHLVNVLLYAMLDLPEEELKEKITFKVDMKA 406
             LVL P G    +    +  + Q    R H+VN      LD   E    K  F +D++ 
Sbjct: 5   GLLVLGPAGAGKSTFCNSIISHMQTIGRRAHIVN------LDPAAE--PSKYEFTIDIRD 56

Query: 407 LLSLVDILHDYDIGQN 422
           L+SL D++ + D+G N
Sbjct: 57  LISLDDVMEELDLGPN 72

>SAKL0D07436g Chr4 complement(609760..611973) [2214 bp, 737 aa] {ON}
           some similarities with uniprot|P47050 Saccharomyces
           cerevisiae YJL047C RTT101 Cullin family member subunit
           of a complex containing ubiquitin ligase activity binds
           HRT1 and is modified by the ubiquitin like protein RUB1
           Regulator of Ty1 Transposition Regulator of Ty1
           Transposition
          Length = 737

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 9/106 (8%)

Query: 630 RIPADLERELQKYSDIYSQM---KPGRRLQLCKDQGKVEMELSFRDGRK--LVLDVSLEQ 684
           ++P DLE   QK+   Y +       ++L+L  +   +E+   F+  R   LVLDV++ Q
Sbjct: 570 KLPGDLELLWQKFEQYYREFDETASNKKLELRCNLHHLEVLTPFKISRDVFLVLDVNMVQ 629

Query: 685 YSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVL 730
           Y ++  FN  ND    LS  +L ++  I    L Q L+ +++  +L
Sbjct: 630 YCILELFN-YNDV---LSFYELEKTTQIDDVTLNQALHSFVRIKLL 671

>TBLA0H03220 Chr8 complement(783486..784301) [816 bp, 271 aa] {ON}
           Anc_8.397 YLR243W
          Length = 271

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 11/76 (14%)

Query: 350 AFLVLDPTGRCLHSIITFVKPYFQ---ERKHLVNVLLYAMLDLPEEELKEKITFKVDMKA 406
             LV+ P G    +    +  + Q    R H+VN      LD   E    K  F VD++ 
Sbjct: 5   GVLVMGPAGAGKSTFCNSIISHMQTIGRRAHIVN------LDPAAE--PNKYEFTVDIRD 56

Query: 407 LLSLVDILHDYDIGQN 422
           L+SL D++ + D+G N
Sbjct: 57  LISLEDVMEELDLGPN 72

>KLLA0D18557g Chr4 complement(1564372..1565277) [906 bp, 301 aa]
           {ON} highly similar to uniprot|Q06543 Saccharomyces
           cerevisiae YLR243W Protein required for cell viability
          Length = 301

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 332 NPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQE---RKHLVNVLLYAMLD 388
           N   TT++ + R        LVL P G    +    +  + Q    R H+VN      LD
Sbjct: 22  NTKSTTINQMSRV-----GVLVLGPAGAGKSTFCNAIISHMQSIGRRAHIVN------LD 70

Query: 389 LPEEELKEKITFKVDMKALLSLVDILHDYDIGQN 422
              E  K +  F +D++ L+SL D++ ++ +G N
Sbjct: 71  PAAEATKYE--FTIDIRDLISLEDVMEEFGLGPN 102

>Kpol_333.4 s333 (14058..15323) [1266 bp, 421 aa] {ON}
           (14058..15323) [1266 nt, 422 aa]
          Length = 421

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 140 FPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRW 199
           FPL+ +P F  +      E  ++ +Y++N      NN +++   L   D+F +   +IRW
Sbjct: 44  FPLKKLPAFYDATGFKLTESMAINYYLIN----LSNNEKIKRKLLGPADNFKIQSQIIRW 99

Query: 200 LNFANGSL 207
            + AN  L
Sbjct: 100 QSLANSDL 107

>Skud_16.234 Chr16 (428492..429691) [1200 bp, 399 aa] {ON} YPL048W
           (REAL)
          Length = 399

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 70/176 (39%), Gaps = 10/176 (5%)

Query: 139 EFPLRYVPIFDLSVNDWSL-ELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLI 197
           +FPL+ VP F +    + L E  ++ +Y+    +K   + +V+   L  +DD +    +I
Sbjct: 43  DFPLKKVPAF-VGPRGYKLTEAMAINYYL----VKLSKDEKVKTQLLGAEDDLNAQAQII 97

Query: 198 RWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCEL 257
           RW + AN       +   A       + + N+ G  +    I+E F+  +        E 
Sbjct: 98  RWQSLANNDFCIQMVNAVAPLKGDVPYNKKNVDGAMDAIGKIVEVFDARLRDNAYLATES 157

Query: 258 ICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDFK 313
           I   +    +  ++F  +  N      R      V  + D + +   LK   KDF+
Sbjct: 158 ISLAD---LVAASIFTRYFENLFGPEWRAQHPAIVRWFNDVRASFF-LKDEYKDFQ 209

>Smik_16.188 Chr16 (339762..341009) [1248 bp, 415 aa] {ON} YPL048W
           (REAL)
          Length = 415

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 139 EFPLRYVPIFDLSVNDWSL-ELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLI 197
           +FPL+ VP F +    + L E  ++ +Y+    +K   + +++   L   DD +    +I
Sbjct: 43  DFPLKKVPAF-VGPKGYKLTEAMAINYYL----VKLSQDEKIKAQLLGASDDLNAQAQII 97

Query: 198 RWLNFANGSL 207
           RW + AN  L
Sbjct: 98  RWQSLANNDL 107

>Ecym_8046 Chr8 complement(100862..103258) [2397 bp, 798 aa] {ON}
           similar to Ashbya gossypii ADR106W
          Length = 798

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 68/150 (45%), Gaps = 17/150 (11%)

Query: 578 IDVMLWDIKCSEELCRKMHEV----AGLDPTVFPKFISLLYWKHNGDTQNP---KDSKFR 630
           I  M  D++ S++L ++  ++    A      +P+F   +      +T  P   ++  F+
Sbjct: 513 ITKMFQDVRLSKQLDQEFDKLVKSEADYSKEKYPEFQPFVL----AETMWPFPYQEVDFK 568

Query: 631 IPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSF-RDGR-KLVLDVSLEQYSVM 688
           +P +L  E  K  D+Y +   GR L+      + E+     R GR      V+L Q S++
Sbjct: 569 LPQELVSEHFKLVDLYVKKHSGRVLKWLWPLSRGELRADIGRPGRPPFYFTVTLFQMSII 628

Query: 689 NQFNSTNDEPINLSLKQLSESLNITTSKLL 718
             FN  +     L+ +Q+ E  N+TT  ++
Sbjct: 629 LMFNRND----MLTFEQIQEGTNLTTQHII 654

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,540,891
Number of extensions: 4612688
Number of successful extensions: 16362
Number of sequences better than 10.0: 105
Number of HSP's gapped: 16799
Number of HSP's successfully gapped: 109
Length of query: 854
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 736
Effective length of database: 39,950,811
Effective search space: 29403796896
Effective search space used: 29403796896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)