Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1608.271ON89389346970.0
YLR092W (SUL2)8.271ON89389343360.0
Smik_12.1518.271ON89389343230.0
Suva_10.1768.271ON89389442180.0
NCAS0B050508.271ON92392230480.0
NDAI0B020208.271ON90590730440.0
KNAG0G020708.271ON89988829650.0
TDEL0F039808.271ON86789028890.0
Skud_2.424na 1ON86389628770.0
YBR294W (SUL1)na 1ON85989628630.0
Suva_4.554na 1ON85089828430.0
Smik_2.435na 1ON86390528340.0
KAFR0B027508.271ON83489128270.0
Kpol_543.438.271ON86688028220.0
TPHA0J008008.271ON91792828160.0
CAGL0L12342g8.271ON89191127980.0
SAKL0H16830g8.271ON86288826790.0
ZYRO0C01452g8.271ON90690226580.0
KLTH0G13486g8.271ON90289626220.0
KLLA0F19338g8.271ON89189325940.0
TPHA0A017608.271ON89390525280.0
Kwal_56.237598.271ON86187724940.0
AGR077C8.271ON84887323590.0
Ecym_42998.271ON87487322430.0
TBLA0F030508.271ON89754113231e-168
KNAG0D023908.99ON7165083262e-30
NDAI0B022108.99ON7064763201e-29
TBLA0C052708.99ON7764673112e-28
ZYRO0F04796g8.99ON7354962914e-26
NCAS0B048008.99ON7244822843e-25
Suva_16.3228.99ON7424772754e-24
KLTH0G16764g8.99ON7104822683e-23
TPHA0H007208.99ON7874802657e-23
Kpol_467.118.99ON7445682612e-22
YPR003C8.99ON7544762603e-22
Ecym_7084na 2ON6895042551e-21
KLLA0E14059g8.99ON7065302522e-21
SAKL0H08800gna 2ON6204411951e-14
CAGL0L09207g8.99ON7251401952e-14
Kwal_27.110398.99ON7261971791e-12
TDEL0C012808.99ON7271461737e-12
Skud_16.2868.99ON7452681665e-11
SAKL0B03124g8.99ON7441771665e-11
Smik_16.2418.99ON7441801656e-11
AGR213Cna 2ON6891441602e-10
KAFR0C019103.485ON1020216930.021
KLLA0E04731g3.485ON1060167850.20
KLTH0G15752g3.119ON964134820.44
YGR125W3.485ON1036168810.57
TBLA0C044403.485ON1150168810.59
ZYRO0B11814g8.236ON22879733.4
KLTH0F14674g3.485ON1010625743.9
CAGL0I01914g5.99ON14365686.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.160
         (893 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1813   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1674   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1669   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1629   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1178   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1177   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1146   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1117   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1112   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1107   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1099   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1096   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1093   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1091   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1089   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1082   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1036   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1028   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...  1014   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1003   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   978   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   965   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   913   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   868   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   514   e-168
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   130   2e-30
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   127   1e-29
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   124   2e-28
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   116   4e-26
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   114   3e-25
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   110   4e-24
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   107   3e-23
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   106   7e-23
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   105   2e-22
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   104   3e-22
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   102   1e-21
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   101   2e-21
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    80   1e-14
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    80   2e-14
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    74   1e-12
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    71   7e-12
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    69   5e-11
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    69   5e-11
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    68   6e-11
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    66   2e-10
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    40   0.021
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    37   0.20 
KLTH0G15752g Chr7 (1373153..1376047) [2895 bp, 964 aa] {ON} simi...    36   0.44 
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    36   0.57 
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...    36   0.59 
ZYRO0B11814g Chr2 (940104..940790) [687 bp, 228 aa] {ON} similar...    33   3.4  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...    33   3.9  
CAGL0I01914g Chr9 (159798..160229) [432 bp, 143 aa] {ON} some si...    31   6.7  

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1813 bits (4697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/893 (98%), Positives = 879/893 (98%)

Query: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60
           MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN
Sbjct: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60

Query: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120
           AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK
Sbjct: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120

Query: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180
           SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY
Sbjct: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360

Query: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXX 420
           IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSK             
Sbjct: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLL 420

Query: 421 XEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
            EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600
           FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600

Query: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660
           SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT
Sbjct: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660

Query: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720
           KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI
Sbjct: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840
           CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840

Query: 841 YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1674 bits (4336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/893 (89%), Positives = 840/893 (94%)

Query: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60
           MS+E  PN EEVEIPDFQ+  ++VP+LDDLELEYDQYKNNENN  F+D DLESNSVA  N
Sbjct: 1   MSREGYPNFEEVEIPDFQETNNTVPDLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHN 60

Query: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120
           AVN +KGVKGSKI+YF+PSDVSLYDNSVSQFEE+ VSLKEYY+HSIRSHLT+KGA  YLK
Sbjct: 61  AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120

Query: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180
           SVFPIINWLPHYNF+WF ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAY+Y
Sbjct: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSLQTAKVIA+V AKYPDGD+ ITGPVIATTLALLCGIISAAVG
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN LVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKN RLHKI+KWTYFYAQASRNGII
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360

Query: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXX 420
           IIVFTCIGWAITRGKS SERPISILGSVPSGLKEVGVFHVP GLMSK             
Sbjct: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420

Query: 421 XEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
            EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600
           FIVTVLITVFASIEDGIYFAMCWSCAML+LKVAFPAGKFLGRVE+AEVTDAYV+ DSD V
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600

Query: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660
           SYVSENNN ISTLE+ GED+KE S KY+TNSSKKIETNVQTKGF SPSSSI QPRIKYHT
Sbjct: 601 SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT 660

Query: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720
           KW+PFDHKYTRELNPDV ILPPP+ VLVYRLSESYTYLNCSRHYNII +EVK+ TRRGQ+
Sbjct: 661 KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKK+E+D E  +NAP+ S+D ERD+RPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840
           CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGT+NEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840

Query: 841 YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVP+ +ENP+KYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1669 bits (4323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 803/893 (89%), Positives = 835/893 (93%)

Query: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60
           MS+ET PNLEEVEIPDFQD +++VP+LDDLELEYDQYKNNENN  F DNDLESNSVA  N
Sbjct: 1   MSRETYPNLEEVEIPDFQDTSNTVPDLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPN 60

Query: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120
           AV + KG KGSKIEYF+PSDVSLYDNSVSQFEES VSLKEYY+HSIRSHLTLKGA DYLK
Sbjct: 61  AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK 120

Query: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180
           SVFPIINWLPHYNFNWF ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAY+Y
Sbjct: 121 SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240
           SFFATSKDVCIGPVAVMSLQTAKVIA+V AKYPDGD  ITGPVIATTLALLCGIISAA+G
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN LVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGP LNDRYNSKN RLHKI+KWTYFYAQASRNG+I
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI 360

Query: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXX 420
           I+VFTCIGWAITRGKS SERPISILGSVPSGLKEVGVFHVPSGLMSK             
Sbjct: 361 IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL 420

Query: 421 XEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
            EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600
           FIVTVLITVFASIEDGIYFAMCWSCAMLLLK+AFPAGKFLGRVEIAEVTDAY+KA+SDAV
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV 600

Query: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660
           SY SENNN I T EE  E EK+ S KYITNSSKKIETNVQTK F SPSS I QPR+KYHT
Sbjct: 601 SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT 660

Query: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720
           KW+PFDHKYTRELNPD+ ILPPPE VLVYRLSESYTYLNCSRHYNII ++VK  TRRGQ+
Sbjct: 661 KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKK+ESD EF +NAP+NSI  ERD+RPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840
           CLDFSQVAQTDATALQSLVDLRK INQYADRQVEFHFVGIISPWVKRGL+SRGFGT+NEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE 840

Query: 841 YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVP++KEN DKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1629 bits (4218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 779/894 (87%), Positives = 830/894 (92%), Gaps = 2/894 (0%)

Query: 1   MSKETQPNLEEV-EIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANR 59
           MS+ET  N+EEV EIPDFQD+T +VP+LDDLELEYDQYKNNENNG F+DNDLESNS+ N 
Sbjct: 1   MSRETHSNIEEVVEIPDFQDST-TVPDLDDLELEYDQYKNNENNGAFNDNDLESNSLTNH 59

Query: 60  NAVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYL 119
           N  ++AKGVKGSK+EYF+ SD+SLYDNSVSQF+E  VS KEYY+HSIRSHLTLK AG+YL
Sbjct: 60  NTASEAKGVKGSKVEYFNTSDISLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYL 119

Query: 120 KSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYA 179
           KSVFPII WLPHYN NWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYA
Sbjct: 120 KSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYA 179

Query: 180 YSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAV 239
           YSFFATSKDVCIGPVAVMSLQTAKVIA+V A+YPDGDTTITGP+IATTLALLCGIISAAV
Sbjct: 180 YSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAV 239

Query: 240 GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHL 299
           GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTR ATYK+VI++LKHL
Sbjct: 240 GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHL 299

Query: 300 PDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGI 359
           PDT LDA FGLIPLF+LY WKWWCGTYGPRLNDR+NSK  RLHKIVKWT FYAQASRNGI
Sbjct: 300 PDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGI 359

Query: 360 IIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXX 419
           IIIVFTCI WAITRGKSS++RPISILGSVPSGLKEVGVFHVP GLMSK            
Sbjct: 360 IIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVL 419

Query: 420 XXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT 479
             EHIAISKSFGR+NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT
Sbjct: 420 LLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT 479

Query: 480 PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI 539
           PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI
Sbjct: 480 PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI 539

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDA 599
           CFIVTVLITVF+SIE+GIYFAMCWSCA+ +LKVAFPAGKFLGRVEIAEVTDAYV+ADSD+
Sbjct: 540 CFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDS 599

Query: 600 VSYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYH 659
           VS+ SENNNRISTLEE+G  EKE    YI NS KK+ET VQTKGF SPS+SIGQPRIKYH
Sbjct: 600 VSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYH 659

Query: 660 TKWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQ 719
           TKWLPFDHKYT+ELNPDV+ILPPPE VLVYRLSESYTY+NCSRHYN+I DE+K+ TRRGQ
Sbjct: 660 TKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQ 719

Query: 720 IIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKI 779
           +IRHRKKSDRPWNDPGPWE P F KNLKFWKKKE+D+E ++NA NN  DA RD+RPLLKI
Sbjct: 720 LIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKI 779

Query: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINE 839
           LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGT+NE
Sbjct: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839

Query: 840 EYSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           EYSDESIVAGHTSYHVARVP+N+E PDKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 840 EYSDESIVAGHTSYHVARVPQNEETPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/922 (63%), Positives = 713/922 (77%), Gaps = 39/922 (4%)

Query: 2   SKETQPNL--EEVEIPDFQDNT----DSVPNLDDLELEYDQYKNNENNGVFSDNDLESNS 55
           ++E++ +L  ++ EIP++  N     +S  NLDDLELEYDQYK +E N      +  +N+
Sbjct: 11  TRESENDLSNDQYEIPNYTSNIPSSGNSTQNLDDLELEYDQYKVSETNNNDDVINNNNNN 70

Query: 56  VANRNAVNDAKGVKGSKIEYFDPSD--------VSLYDNSV-SQFEESAVSLKEYYNHSI 106
             N N + + +  +   +++ + ++        VS  +  +   ++E  VS+K+YY+HSI
Sbjct: 71  NNNNNNIPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSIKDYYDHSI 130

Query: 107 RSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPA 166
           R ++TL G  DY  S+FPI  WLPHYN  WF +DLIAGIT+GCVLVPQSMSYAQ+ATLPA
Sbjct: 131 RENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPA 190

Query: 167 QYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIAT 226
           QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+ +V AKYPD D TIT P++AT
Sbjct: 191 QYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVAT 250

Query: 227 TLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRA 286
            L+LLCGI++A VG LRLGFLVELISLNAV GFMTGSA NILWGQVP LMGYN  VNTR 
Sbjct: 251 ALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRT 310

Query: 287 ATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNARLHKI 344
           A YKV+IETLKHLPDTKLDAVFGLIPLFLLY+WKWWC   GP+L D++   +KN R +  
Sbjct: 311 ANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFY 370

Query: 345 VKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGL 404
            K  YFYAQA++N IIIIVFT I W+ITRGK+ ++RPISILG+VP GLKEVGV  +P GL
Sbjct: 371 FKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEVGVMKLPDGL 430

Query: 405 MSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATG 464
           +SK              EHIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATG
Sbjct: 431 LSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATG 490

Query: 465 SFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASY 524
           SFSRSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIPKATLSAVII AVSDL+ASY
Sbjct: 491 SFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASY 550

Query: 525 QTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVE 584
           + TWNFWKMNPLD +CF+VTV ITVF+SIE+GIYFA+CWSCA+LLLKV FPAGKFLGR+E
Sbjct: 551 KITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIE 610

Query: 585 IAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGF 644
           +AEV D YV    ++ +  +E ++  S   +N  D K+I        +  I      K  
Sbjct: 611 VAEVIDGYVDNSIESAT-TAEYSSASSPSSDNETDTKKI------QKTSSISFGKDAKAV 663

Query: 645 ASPSSSIG-QPRIKYHTKWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRH 703
           A  +S +   P+++Y+TKW+PFDH YTRELNP V+ILPPP  V+VYRL++S+TY+NCSRH
Sbjct: 664 AVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYINCSRH 723

Query: 704 YNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKES-DLEFTQNA 762
           Y++I DEVKR TRRGQ++RHRKK+DRPWNDPG WEAP FLKNL   KKK S D E   + 
Sbjct: 724 YDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEESAVDV 783

Query: 763 PNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIIS 822
            +NS  + RD RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK+IN+YADRQVEFHF GI+S
Sbjct: 784 SDNS--SIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGIVS 841

Query: 823 PWVKRGLISRGFGTINEEYSDESIVAGHTSYHVAR-VP----------RNKENPDKYSVY 871
           PWVKRGLI+RGFGTIN+E+SD SI+AGH+SYH+ R +P          R+  +  +Y V+
Sbjct: 842 PWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYHVF 901

Query: 872 TASGTNLPFFHIDIPDFAKWDI 893
            A+GTNLPFFHIDIPDF+KWD+
Sbjct: 902 AATGTNLPFFHIDIPDFSKWDL 923

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1177 bits (3044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/907 (64%), Positives = 698/907 (76%), Gaps = 45/907 (4%)

Query: 11  EVEIPDFQDNTDSVPNLDDLELEYDQYKNNE-NNGVFSDNDLESNSV----ANRNAVNDA 65
           + E+P F ++  S  NL DLELEYDQYK +E NN      DLE+N++    +N     D 
Sbjct: 20  QYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDK 79

Query: 66  K-GVKGSKIEY--FDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSV 122
           K  +K  +I+   F+   V      +  FEE A+S K+YY HS++ + +LK   +Y  S+
Sbjct: 80  KNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSF 182
           FPII WLPHYN  WF +DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS 
Sbjct: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194

Query: 183 FATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFL 242
           FATSKDVCIGPVAVMSL+T KVI +V AKYP+ D  IT PVIAT LA LCG+I+A +GFL
Sbjct: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254

Query: 243 RLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDT 302
           RLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY   VNTR +TYKV+IE+LKHLPDT
Sbjct: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314

Query: 303 KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIII 362
           KLDAVFGLIPLF+LY+WKWWCG  GPR+ D++ + N + +  +K  YFYAQA++N +III
Sbjct: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374

Query: 363 VFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXE 422
           VFT I W+IT+GK+  ERPISILGSVP GLKEVGV  +P GL SK              E
Sbjct: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434

Query: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482
           HIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLS
Sbjct: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494

Query: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542
           GLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD   FI
Sbjct: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFI 554

Query: 543 VTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSY 602
           VTV ITVF+SIE+GIYFAMCWSCA+L+LKVAFPAGKFLGRVEIAEV +  V    +   Y
Sbjct: 555 VTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614

Query: 603 VSENNNRI--STLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660
            S +N  +   T+  N    K++   +I      +   ++ + F+  SS  G+ +I+Y+T
Sbjct: 615 SSNSNLSLSADTINHN----KKLKILHI-----PLLKTLKDQLFSDISSIQGKSKIRYYT 665

Query: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720
           KWLPFDH YT+ELNP+V ILPPP  V+VYRL++S+TY+NCS+HY++I +E+K+ T+RGQ+
Sbjct: 666 KWLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQL 725

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSID---------AER 771
           IRHRKKSDRPWNDPG WEAP F    K WKK    L F +N  NN  +         ++R
Sbjct: 726 IRHRKKSDRPWNDPGEWEAPNF---SKLWKK----LSFRRNKNNNDNEETHIPDVPVSKR 778

Query: 772 DERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLIS 831
           D+RPLLK+LCLDFSQVAQ DATALQSLVDLRKAIN+YADRQVEFHF GI+SPW+K+GLI+
Sbjct: 779 DDRPLLKVLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLIN 838

Query: 832 RGFGTINEEYSDESIVAGHTSYHVARVPRNK-ENP----DKYSVYTASGTNLPFFHIDIP 886
            GFGTINEEYSDESI+AGHTSYH+AR+P +  E P      Y VYTA+GTNLPFFHIDIP
Sbjct: 839 IGFGTINEEYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIP 898

Query: 887 DFAKWDI 893
           DF +WD+
Sbjct: 899 DFYQWDV 905

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/888 (63%), Positives = 681/888 (76%), Gaps = 30/888 (3%)

Query: 19  DNTDSVPNLDDLELEYDQYKNNE--------NNGVFSDNDLESNSVANRNAVNDAKGVKG 70
           +   S P+LD+LELEYDQYK +E        +N   +D +  +N      +V D+     
Sbjct: 29  NEVSSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSA 88

Query: 71  S--KIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINW 128
           S  +++YF  +  S     +  + E  V+  E++NHS+RS  TL  A +Y+ S+FPII+W
Sbjct: 89  SIEELQYF--AHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHW 146

Query: 129 LPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKD 188
           LPHYN  WFI DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA+ YS FATSKD
Sbjct: 147 LPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKD 206

Query: 189 VCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLV 248
           VCIGPVAVMSL+TAK+IA V  ++P+ D  + GP+IATT ALLCG I+A VGFLRLGFLV
Sbjct: 207 VCIGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTALLCGGIAAGVGFLRLGFLV 265

Query: 249 ELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVF 308
           ELISLNAVAGFMTGSA NI+ GQVPALMGY KLVNTR ATYKV++ TLKHLPDTKLDAVF
Sbjct: 266 ELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVF 325

Query: 309 GLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIG 368
           GLIPLF+LY W+WWC  YGP+L DRY  K +R + + K  YFYAQASR+GIIIIVFT I 
Sbjct: 326 GLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAIS 385

Query: 369 WAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISK 428
           W+ITR   S ER ISILG+VP GLK+VG   VP  L +K              EHIAISK
Sbjct: 386 WSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISK 445

Query: 429 SFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGS 488
           SFGRINDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSALKAKCNV+TPLSGLF+GS
Sbjct: 446 SFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGS 505

Query: 489 CVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLIT 548
           CVLLALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF+KMNPLDF+CF+ T++IT
Sbjct: 506 CVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIIT 565

Query: 549 VFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNN 608
           VF+SIE+GIYFA+CWSCA+LL KVAFPAGKFLGRVEIAEV D  +  D+  V    +  +
Sbjct: 566 VFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVS 625

Query: 609 RISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHK 668
                +E  +D+    + +I     K+++        + SSSI + ++KY+TKW+PFDH 
Sbjct: 626 EFGGNKEFSKDKLNGKSDFIVKD--KLDS-------TASSSSIAENKLKYYTKWVPFDHA 676

Query: 669 YTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSD 728
           YTRELNPDV I PPP  V+VYR+S+SYTY+N S HY+IIIDE+KR TRRGQ+++HRKKSD
Sbjct: 677 YTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSD 736

Query: 729 RPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAE--RDERPLLKILCLDFSQ 786
           RPWNDPG W+ P FL N+  W+K +      Q A   S++    RDERP+LK+LCLDFSQ
Sbjct: 737 RPWNDPGEWKPPKFLSNVLHWRKNKKK---NQTADVESLETGIVRDERPVLKVLCLDFSQ 793

Query: 787 VAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESI 846
           VAQ D+T+LQSLVDLRKA+N YADRQVEFHF GIISPW+KRGL+  GFGT+NEE+SDESI
Sbjct: 794 VAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESI 853

Query: 847 VAGHTSYHVAR-VPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           +AGH+SYH+ +    + EN   Y V TA+GTNLPFFHIDIPDF KWDI
Sbjct: 854 IAGHSSYHLVKNTIGDIEN--GYQVKTATGTNLPFFHIDIPDFKKWDI 899

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/890 (61%), Positives = 659/890 (74%), Gaps = 52/890 (5%)

Query: 22  DSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKG---VKGSKIEYFDP 78
           DS   LDDLE EYD YK NE      DN++  N   + +   + KG   VK +++ Y+  
Sbjct: 12  DSAFKLDDLEAEYDLYKANEQ---LEDNEVTVN--GSEDDYGNKKGIDLVKETEVRYYGS 66

Query: 79  SDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFI 138
                   ++  FEES VS+K+YYN  IR  LTL  AG Y+ S+FPI+ W PHYN  W  
Sbjct: 67  PGPEAIGGNIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGY 126

Query: 139 ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMS 198
           ADL+AGIT+GCVLVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMS
Sbjct: 127 ADLVAGITVGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMS 186

Query: 199 LQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAG 258
           LQTAKVIA+V AKYP+ D  +T PVIAT L+LLCGI++  VG LRLGFLVELISLNAVAG
Sbjct: 187 LQTAKVIAQVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAG 246

Query: 259 FMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYV 318
           FMTGSAFNILWGQVPALMGY+  VNTRA+TYKVVI++LKHLPDTKLDAVFGL+PL LLY+
Sbjct: 247 FMTGSAFNILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYL 306

Query: 319 WKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSS 378
           WKWWCGTYGP+L DR  + + +  +I+K  YFY+ A RN +IIIVFT I W IT+ K   
Sbjct: 307 WKWWCGTYGPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKE 366

Query: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKV 438
            RPI +LG+VPSGL++VGV  +P GL++K              EHIAISKSFGRINDYKV
Sbjct: 367 HRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKV 426

Query: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498
           VPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT
Sbjct: 427 VPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLT 486

Query: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558
            AFF+IP ATLSAVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVF+SIE+GIY
Sbjct: 487 DAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIY 546

Query: 559 FAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGE 618
           FAMCWSCAMLLLK AFPAG+FLGRVE+AEV +  V  D +A+S   +    +   +    
Sbjct: 547 FAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKA 606

Query: 619 DEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVH 678
           D+  ISA   +N                          K+H+KW+   + Y RELNPDV 
Sbjct: 607 DKGAISASSGSN-------------------------YKFHSKWVAEQYAYNRELNPDVK 641

Query: 679 ILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWE 738
           ILPPP  V+VYR+S+S+TY+NCSRHY+ I D +K+ TRRGQ++  RKKSDRPWNDPG WE
Sbjct: 642 ILPPPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWE 701

Query: 739 -APAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQS 797
            +P+  K  K  KK ++D+E      + +ID  RDERPLLKI+CLDFSQV Q D+TA+QS
Sbjct: 702 ISPSIKKFFKLGKKNQNDIE--SQDEDVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQS 759

Query: 798 LVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVAR 857
           LVDLRKA+++YADRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+
Sbjct: 760 LVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAK 819

Query: 858 VPRNKENPDKYS--------------VYTASGTNLPFFHIDIPDFAKWDI 893
               K   D ++              +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 820 T--TKPLADDFTTDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1112 bits (2877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/896 (61%), Positives = 663/896 (73%), Gaps = 60/896 (6%)

Query: 13  EIPDFQDNTDSVPNLDDLELEYDQYKNNE---NNGVFSDNDLESNSVANRNAVNDAKGVK 69
           E+ D Q++TD    ++  E EY  Y+ +E   N   F + D +S  +  +      K   
Sbjct: 13  EVLDNQEDTD----IEVFESEYRTYRESEAAENRDNFQNGDDQSWKINGKQKYEVTKS-- 66

Query: 70  GSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWL 129
                  + SDV+ YD S+  +EES V+LKEYY+HSI+S LT+K AGDYL S+FPII WL
Sbjct: 67  -------EVSDVA-YD-SIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWL 117

Query: 130 PHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDV 189
           PHYNF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS FATSKDV
Sbjct: 118 PHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDV 177

Query: 190 CIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVE 249
           CIGPVAVMSLQTAKVIAEV  KYP+G T +TGP+IAT L  LCG++S A+G LRLGFLVE
Sbjct: 178 CIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVE 237

Query: 250 LISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFG 309
           LISLNAVAGFMTGSAF+I+WGQ+PALMGYN LVNTR ATYKVVI TLKHLP+TKLDAVFG
Sbjct: 238 LISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFG 297

Query: 310 LIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGW 369
           LIPL +LYVWKWWCGT+G  L DRY     ++   +K  YFYAQA RN ++IIVFT I W
Sbjct: 298 LIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISW 357

Query: 370 AITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKS 429
            ITR KSS ERPISILG+VPSGL EVGV  +P GL+S               EHIAISKS
Sbjct: 358 RITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKS 417

Query: 430 FGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSC 489
           FGRINDYKV+PDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP SG+F+G+C
Sbjct: 418 FGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGAC 477

Query: 490 VLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITV 549
           VLLALYCLT AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD I FI TV ITV
Sbjct: 478 VLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITV 537

Query: 550 FASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNR 609
           F+SIE+GIYFAMCWSCAMLLLK AFPAGKFLGRVE+AEV +  V+   +AV+  +E  N 
Sbjct: 538 FSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSNELPNE 597

Query: 610 ISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKY 669
           +S                     K++++ V           +  P  K+  KW+PFDH Y
Sbjct: 598 LS---------------------KQVKSTVDV---------LPAPEYKFSVKWIPFDHDY 627

Query: 670 TRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDR 729
           +RELN    + PPP  V+VYRL++S+TY+NCSRHY+II D +K  TRRGQ+I  RKKSDR
Sbjct: 628 SRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDR 687

Query: 730 PWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQ 789
           PWNDPG W+ P   K L  +K+K +  +      +   + E  E+PLLK++CLDFSQVAQ
Sbjct: 688 PWNDPGEWKMPNSFKALFKFKRKSATTDNELPVSSGRNNQESYEKPLLKVVCLDFSQVAQ 747

Query: 790 TDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAG 849
            D+TA+QSLVDLRKA+N+YADRQVEFHF GIISPW+KR L+S  FGT NEEYSD+SI+AG
Sbjct: 748 VDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAG 807

Query: 850 HTSYHVARVPRNKEN--------PDKYSVY----TASGTNLPFFHIDIPDFAKWDI 893
           H+S+HVA+V ++  +           YS Y     A+GTNLPFFHIDIPDF+KWD+
Sbjct: 808 HSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1107 bits (2863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/896 (62%), Positives = 664/896 (74%), Gaps = 60/896 (6%)

Query: 18  QDNTDSVPNLDD-----LELEYDQYKNNE---NNGVFSDNDLESNSVANRNAVNDAKGVK 69
           + +T+ V N +D      E EY  Y+ +E   N     + D E+  V   N+     GV 
Sbjct: 4   KSSTEYVHNQEDADIEVFESEYRTYRESEAAENRDGLHNGDEENWKV---NSSKQKFGVT 60

Query: 70  GSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWL 129
            +++     SDV LYD S+  +EES V+LKEYY+HSI+++LT K AG YL S+FPII W 
Sbjct: 61  KNEL-----SDV-LYD-SIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWF 113

Query: 130 PHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDV 189
           PHYNF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS FATSKDV
Sbjct: 114 PHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDV 173

Query: 190 CIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVE 249
           CIGPVAVMSLQTAKVIAEV  KYP+  T +T P+IATTL LLCGI++  +G LRLGFLVE
Sbjct: 174 CIGPVAVMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVE 233

Query: 250 LISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFG 309
           LISLNAVAGFMTGSAFNI+WGQ+PALMGYN LVNTR ATYKVVI TLKHLP+TKLDAVFG
Sbjct: 234 LISLNAVAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFG 293

Query: 310 LIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGW 369
           LIPL +LYVWKWWCGT+G  L DRY     ++   +K  YFYAQA RN ++I+VFT I W
Sbjct: 294 LIPLVILYVWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISW 353

Query: 370 AITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKS 429
           +ITR KSS +RPISILG+VPSGL EVGV  +P GL+S               EHIAISKS
Sbjct: 354 SITRNKSSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKS 413

Query: 430 FGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSC 489
           FGRINDYKVVPDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP SG+F+G C
Sbjct: 414 FGRINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGC 473

Query: 490 VLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITV 549
           VLLALYCLT AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD I FIVTV ITV
Sbjct: 474 VLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITV 533

Query: 550 FASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNR 609
           F+SIE+GIYFAMCWSCAMLLLK AFPAGKFLGRVE+AEV +  V+ D DAV   +E  N 
Sbjct: 534 FSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNE 593

Query: 610 ISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKY 669
           ++                     K++++ V+          +  P  K+  KW+PFDH Y
Sbjct: 594 LN---------------------KQVKSTVEV---------LPAPEYKFSVKWVPFDHGY 623

Query: 670 TRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDR 729
           +RELN +  + PPP  V+VYRL +S+TY+NCSRHY+II D +K  TRRGQ+I  RKKSDR
Sbjct: 624 SRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDR 683

Query: 730 PWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQ 789
           PWNDPG W+ P  LK+L  +K+  +         N S + E  E+PLLK++CLDFSQVAQ
Sbjct: 684 PWNDPGEWKMPDSLKSLFKFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQ 743

Query: 790 TDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAG 849
            D+TA+QSLVDLRKA+N+YADRQVEFHF GIISPW+KR L+S  FGT NEEYSD+SI+AG
Sbjct: 744 VDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAG 803

Query: 850 HTSYHVARVPRNKEN--------PDKYSVY----TASGTNLPFFHIDIPDFAKWDI 893
           H+S+HVA+V ++  +           YS Y     A+GTNLPFFHIDIPDF+KWD+
Sbjct: 804 HSSFHVAKVLKDDVDYTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/898 (60%), Positives = 661/898 (73%), Gaps = 61/898 (6%)

Query: 9   LEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGV 68
           +   E+ D Q+N     N++  + +Y  Y+ +E      D+  E +   N N     +  
Sbjct: 1   MSSTEVLDNQENL----NIEIFDSKYSSYRESEAAANRDDSHNEQSWKVNGN-----RKF 51

Query: 69  KGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINW 128
           + +K E    SDVS YD S+ ++EES V+LKEYY HSI++ LT K AG+Y+ S+FPI+ W
Sbjct: 52  EHTKTE---SSDVS-YD-SIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKW 106

Query: 129 LPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKD 188
           LPHYNF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSF+GA+ YS FATSKD
Sbjct: 107 LPHYNFTWCYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKD 166

Query: 189 VCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLV 248
           VCIGPVAVMSLQTAKVIAEV  KYP   T +TGP+IAT L LLCGI++ A+G LRLGFLV
Sbjct: 167 VCIGPVAVMSLQTAKVIAEVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLV 226

Query: 249 ELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVF 308
           ELISLNAVAGFMTGSAF+I+WGQVPALMGYNKLVNTR +TYKVVI TLKHLP+TKLDAVF
Sbjct: 227 ELISLNAVAGFMTGSAFSIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVF 286

Query: 309 GLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIG 368
           GLIPL +LYVWKWWCGTYG  L +R+   + ++   +K  YFYAQA RN ++I+VFT I 
Sbjct: 287 GLIPLVILYVWKWWCGTYGITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAIS 346

Query: 369 WAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISK 428
           W+ITR K+S +RPISILG+VPSGL EVGV  +P GL+S               EHIAISK
Sbjct: 347 WSITRNKASEDRPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISK 406

Query: 429 SFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGS 488
           SFGRINDYKVVPDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP SGLF+G 
Sbjct: 407 SFGRINDYKVVPDQELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGG 466

Query: 489 CVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLIT 548
           CVLLALYCLT AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD + FIVTV IT
Sbjct: 467 CVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFIT 526

Query: 549 VFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNN 608
           VF+SIE+GIYFAMCWSCA+LLLK AFPAG+FLGRVE+AE+ +  ++ +  AV  ++E+N 
Sbjct: 527 VFSSIENGIYFAMCWSCAILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAVVSLNESN- 585

Query: 609 RISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHK 668
                                   K+++T V           +     ++ TKW+PFDH+
Sbjct: 586 ------------------------KQVKTTVDV---------LRSSEYRFTTKWVPFDHE 612

Query: 669 YTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSD 728
           Y+RELN    I PPP  V+VYRLS+S+TY+NCSRHY+II D VK  TRRGQ++  RKKSD
Sbjct: 613 YSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSD 672

Query: 729 RPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVA 788
           RPWNDPG W+ P  LK L  +K+K        +  N S +    E+PLLK++CLDFSQVA
Sbjct: 673 RPWNDPGEWKMPTSLKTLFRFKRKSVTENEEPSVSNGSTNRGSYEKPLLKVICLDFSQVA 732

Query: 789 QTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVA 848
           Q D+TA+QSLVDLRKA+N+YADRQVEFHF GIISPW+KR L S  FGT+NEEYSDES++A
Sbjct: 733 QVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIA 792

Query: 849 GHTSYHVARVPRNKEN---------PDKYSVY----TASGTNLPFFHIDIPDFAKWDI 893
           GH+S HV +   + +             YS Y     A+GTNLPFFHIDIPDF+KWDI
Sbjct: 793 GHSSVHVTKFSSDDDADYTDEESHISAPYSNYGTLCAATGTNLPFFHIDIPDFSKWDI 850

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1096 bits (2834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/905 (60%), Positives = 670/905 (74%), Gaps = 54/905 (5%)

Query: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60
           MS +   ++   E+ D QD+ D    ++  E EY  Y+  E      +   + N      
Sbjct: 1   MSGKYSSHVTSTEVSDKQDDAD----IEVFESEYRTYREAEAAENREEIQNDDN------ 50

Query: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120
              D K      +E  +     ++ +S+  +EE+ V+LK+YY+H+I+ +LTLK AG YL 
Sbjct: 51  --QDWKVPSKLNLELTNSKVSEVFYDSIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLY 108

Query: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180
           S+FPII WLPHYNF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ Y
Sbjct: 109 SLFPIIKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIY 168

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240
           S FATSKDVCIGPVAVMSLQTAKVIAEV  KYP+    +TGP+IATTL LLCG+++  +G
Sbjct: 169 SLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLG 228

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300
            LRLGFLVELISLNAVAGFMTGSAF+I+WGQ+PALMGYNKLVNTR ATYKVVI TLKHLP
Sbjct: 229 VLRLGFLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNKLVNTREATYKVVINTLKHLP 288

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360
           +TKLDAVFGLIPL +LY+WKWWCG++G +L DR+ S   +    +K  YFYAQA RN ++
Sbjct: 289 NTKLDAVFGLIPLVILYLWKWWCGSFGIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVV 348

Query: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXX 420
           IIVFT I + ITR KS  +RPISILG+VPSGL EVGV  +P GL+S              
Sbjct: 349 IIVFTAISFRITRNKSKEKRPISILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLV 408

Query: 421 XEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
            EHIAISKSFGRINDYKV+PDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP
Sbjct: 409 LEHIAISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTP 468

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
            SG+F+G+CVLLALYCLT AFFYIPKATLSAVIIHAVSDLLASY+TTWNFWKMNPLD I 
Sbjct: 469 FSGVFTGACVLLALYCLTSAFFYIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCIS 528

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600
           FIVTVLITVF+SIE+GIYFAMCWSCAMLLLK AFPAGKFLGRVE+AEV +  ++   D++
Sbjct: 529 FIVTVLITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSI 588

Query: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660
              +E+ N                       SK+++++V     A PSS       K+  
Sbjct: 589 VSPNESPNEF---------------------SKQVKSSVD----ALPSS-----EYKFSV 618

Query: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720
           KW+PFDH YTRELN    + PPP  V+VYR S+S+TY+NCSRHY++I D +K  TRRGQ+
Sbjct: 619 KWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQL 678

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780
           +  RKKSDRPWNDPG W+ P   KN+   K+  +       A N++ ++E  E+PLLK++
Sbjct: 679 VSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGLATKNSELPAVNDNTNSESYEKPLLKVV 738

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840
           CLDFSQVAQ D+TA+QSLVDLRKA+N+YADRQVEFHF GIISPW+KR L+S  FGTINEE
Sbjct: 739 CLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEE 798

Query: 841 YSDESIVAGHTSYHVARVPR------NKENP------DKYSVYTASGTNLPFFHIDIPDF 888
           +SD SI+ GH+S+H+A+V +      ++++P      +  ++  A+GTNLPFFHIDIPDF
Sbjct: 799 FSDTSIITGHSSFHIAKVLKDEVDYTDEDSPISVTCSNYDTLCAATGTNLPFFHIDIPDF 858

Query: 889 AKWDI 893
           +KWD+
Sbjct: 859 SKWDV 863

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/891 (61%), Positives = 661/891 (74%), Gaps = 64/891 (7%)

Query: 8   NLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKG 67
           N  + E+ DF        NLDDLE E++QYK  E     +  + E +S   R   +D K 
Sbjct: 3   NQHDTELTDFS-------NLDDLEQEFNQYKKIELTISSTRQNEEVDS--KRQGKSD-KN 52

Query: 68  VKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIIN 127
           VK S    FD          V  +EE+++++ +YY +S+R + T K   DY+KS+FPI +
Sbjct: 53  VKSSS---FDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFH 109

Query: 128 WLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSK 187
           WLPHYN  WFI+DLIAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA++YS FATSK
Sbjct: 110 WLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSK 169

Query: 188 DVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFL 247
           DVCIGPVAVMSLQTAKVIA VQ K P  DT IT   IATTLALLCGII+  VG LRLGFL
Sbjct: 170 DVCIGPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFL 228

Query: 248 VELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAV 307
           VELISLNAVAGFMTGSA NI+ GQVP LMGYN  VNTR +TYKV+I+TLKHLPDTKLDAV
Sbjct: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAV 288

Query: 308 FGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNARLHKIVKWTYFYAQASRNGIIIIVFT 365
           FGLIPLFLL+ WKW C   GPRLN+R+  N KN R H+I+K  YFYAQ ++N IIIIVFT
Sbjct: 289 FGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFT 348

Query: 366 CIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIA 425
           CI WAITRGK+S  RPIS+LGSVP GLK+V  F VPSGLM+K              EHIA
Sbjct: 349 CISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIA 408

Query: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485
           I+KSFGRINDYK+VPDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLSGLF
Sbjct: 409 IAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLF 468

Query: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545
           SG+CVLLALYCLTGAFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+VTV
Sbjct: 469 SGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTV 528

Query: 546 LITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSE 605
           +ITVFASIEDGIYFAMCWS A+LL KVAFP GKFLG++EI EV D  +  DS  ++   E
Sbjct: 529 IITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE 588

Query: 606 NNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPF 665
           N+  + T +         S + ++N ++   TN                   Y+TKW+PF
Sbjct: 589 NSEILPTTKAG------YSVEVVSNHNE--NTN-------------------YYTKWVPF 621

Query: 666 DHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRK 725
           D  YT+ELNPD HI PPP  V+VYR+++S+TY+NCSRH++I+ DE+KR+T+RG++ +  +
Sbjct: 622 DFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMR 681

Query: 726 KSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAER---DERPLLKILCL 782
           KSDRPWNDPG WE   F+K  K+ +++  D         +++D E    D+RP LKI+CL
Sbjct: 682 KSDRPWNDPGKWEPRVFIK--KYLRRENYD--------EDNVDIEDRVIDDRPFLKIICL 731

Query: 783 DFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYS 842
           DFSQV+Q DATA+Q L DLRK++N+YADRQVEFHFVGIISPW+K+ L + GFGTIN EYS
Sbjct: 732 DFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYS 791

Query: 843 DESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           DESI+ GH+SYH+ +        D   +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 792 DESIIMGHSSYHLTK--------DVDGIKAATGTNLPFFHIDIPNFNKWDI 834

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/880 (62%), Positives = 653/880 (74%), Gaps = 48/880 (5%)

Query: 34  YDQYKNNENNGVFSDNDLESN---SVANRNAVNDAKGVKGSKIEYFDPSDV----SLYDN 86
           Y+QYK  E  G     D   N     A      D+K V    + Y D S+     S  ++
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYTDDSNELTRESFLNS 74

Query: 87  S--VSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAG 144
           S  V ++ E  V+LKEYYNHSIR +LT K  G+YL S+FPII WLP YN+ W I+DLIAG
Sbjct: 75  SENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAG 134

Query: 145 ITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKV 204
           ITIGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY YS FATSKDVCIGPVAVMSLQTAKV
Sbjct: 135 ITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKV 194

Query: 205 IAEVQAKYPDGDTT-ITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGS 263
           I  V +   +   T IT P+IATTLALLCGIISA VG LRLGFLVELISLNAV GFMTGS
Sbjct: 195 IQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGS 254

Query: 264 AFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWC 323
           A NI+ GQVPALMGY   VNTR ATYKV+I TLKHLPDTK+DA+FGLIPL +LY WKWW 
Sbjct: 255 ALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWF 314

Query: 324 GTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPIS 383
            + GP+L DRY   N++  K +K  YFY  A R+GIIIIV T I W++TRGKS SERPIS
Sbjct: 315 SSMGPKLVDRY-YPNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERPIS 373

Query: 384 ILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQE 443
           ILG+VPSGL+EVGVF  P+GL++K              EHIAI+KSFGR+NDYKVVPDQE
Sbjct: 374 ILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPDQE 433

Query: 444 LIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFY 503
           LIAIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLTGAFFY
Sbjct: 434 LIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAFFY 493

Query: 504 IPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCW 563
           IPKATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVFASIEDGIYF MCW
Sbjct: 494 IPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTMCW 553

Query: 564 SCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEI 623
           S A+LL KVAFPAGKFLG V+IAE+ +  +  DSD +   +E + + ST+  N E  +  
Sbjct: 554 SAAILLFKVAFPAGKFLGYVKIAEIVNPEI-VDSDYLVEKAETSVQYSTVLMNPEKGELS 612

Query: 624 SAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVHILPPP 683
                ++ S                      ++KYH KW+P+DH YT+E+NP+V + PPP
Sbjct: 613 YLSSKSSES----------------------QLKYHIKWIPYDHAYTKEMNPNVEVTPPP 650

Query: 684 ESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEAPAFL 743
           + V+VYRL+ES+TY+NCSR+Y  + D+VK  TR GQ++ H KKSDRPWNDPG W+ P FL
Sbjct: 651 DGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFL 710

Query: 744 KNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRK 803
           KN+  W+K ++      + P    +   D RP+LKI+CLDFSQVAQTD+TALQSL+DLR+
Sbjct: 711 KNIINWRKNKNK----DDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRR 766

Query: 804 AINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVARVPRNKE 863
           AIN+YADRQVEFHF GI+SPWVK+GL++ GFGT+N+EYSDESI+ GHTSYHV +    + 
Sbjct: 767 AINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLEN 826

Query: 864 NP----------DKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           NP            Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 827 NPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/928 (59%), Positives = 676/928 (72%), Gaps = 67/928 (7%)

Query: 8   NLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKG 67
           +L+ +E+  +  N+++V +L+ LE EYDQYK  E     S N L S+   N N  ++ K 
Sbjct: 15  DLDNIELSSYS-NSNTV-DLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKY 72

Query: 68  VKGSKIEYFDPS------DVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKS 121
            +  K+++ D S      +    D  +    E+ ++ KEYYNHS++ + T   A +Y  S
Sbjct: 73  EEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALS 132

Query: 122 VFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYS 181
           +FPII+WLP YNFNWFI+DLIAGITIGCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ Y+
Sbjct: 133 IFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYA 192

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
            FATSKDVCIGPVAVMSL+TAKVIA+V + + + D  +TGP+IATTLALLCG I+AAVGF
Sbjct: 193 LFATSKDVCIGPVAVMSLETAKVIADVSSHFQN-DPDVTGPIIATTLALLCGGIAAAVGF 251

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPD 301
           LRLGFLVELISLNAV GFMTGSAFNILWGQVP LMGY+KLVNTR ATYKVVI+TLKHLPD
Sbjct: 252 LRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPD 311

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIII 361
           TKLDAVFGLIPLF+LYV KWWC  YG +L ++  S N R    +K  YFY  A RN ++I
Sbjct: 312 TKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVI 371

Query: 362 IVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXX 421
           I+FT I W+ITR KSSSERPI++LG+VPSGLK++GVF   + ++ K              
Sbjct: 372 IIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLL 431

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           EHIAI+KSFGRINDYK+VPDQELIAIG+SNL+GTFF+AYPATGSFSRSAL AKCNV+TPL
Sbjct: 432 EHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPL 491

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICF 541
           SG+F+G CVLLALYCLTGAFFYIPKATLSAVIIHAVSDL+ASYQTT +FW MNPLD +CF
Sbjct: 492 SGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCF 551

Query: 542 IVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVS 601
           +VTVLITVF+SIE+GIYFAMC+SCA+ + + AFPAGKFLGR+EIAEV +A  K D     
Sbjct: 552 LVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDD----- 606

Query: 602 YVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTK 661
           +  +N N   T E N     +   K+          N  T  + SP  S       ++TK
Sbjct: 607 FQMDNFNGFETSEYNNFPADQSYGKFDI-------ANKNTHKYNSPHCSKN-----FYTK 654

Query: 662 WLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQII 721
           W+PFDH YT+ELN DV IL PP  V+VYRLS+S+ YLNCSRH++ I DEVKR T+RG+ I
Sbjct: 655 WVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFI 714

Query: 722 RHRKKSDRPWNDPGPWEAPAFL------KNLKFWKKKESDLEFTQNAPN----------N 765
            + KKS RPWNDPG WEAP ++      +NL F +K+E++     N PN          N
Sbjct: 715 GNIKKSQRPWNDPGEWEAPTWMTKKFSIRNL-FKRKQEAE----SNVPNEDASTDLDISN 769

Query: 766 SIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWV 825
           + D + D RP+L+++CLDFSQV+QTD TALQSL DLRK++N YADRQVEFHF GIISPWV
Sbjct: 770 NKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWV 829

Query: 826 KRGLISRGFGTINEEYSDESIVAGHTSYHVARVP--RNK------------------ENP 865
           KRGLI  GFGT+NE YSD S + GH SYH+ + P  RNK                  ++ 
Sbjct: 830 KRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDY 889

Query: 866 DKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           + YS+  ASGTN PFFHIDIP+F+KWD+
Sbjct: 890 NNYSIEAASGTNYPFFHIDIPNFSKWDV 917

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/911 (60%), Positives = 670/911 (73%), Gaps = 67/911 (7%)

Query: 27  LDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVND-AKGVKGSKIEYFDPS--DVSL 83
           LD+LELEY+Q+KNNE               +N NA  D  KG+   K  YF+ S  D S 
Sbjct: 4   LDNLELEYNQFKNNERP-------------SNTNAGADIEKGLDTKK--YFERSITDNST 48

Query: 84  YDN---SVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIAD 140
           Y     S+  +EE  ++LK+YY+ ++R + T     DY++S+FP++NWLP YN  WF++D
Sbjct: 49  YGKKSYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSD 108

Query: 141 LIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQ 200
           LIAGIT+G VLVPQSMSYAQ+ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSLQ
Sbjct: 109 LIAGITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQ 168

Query: 201 TAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFM 260
           TAKVIA V+ K+PD D +ITGP+IAT LA +CGII+  VG LRLGFLVELISLNAVAGFM
Sbjct: 169 TAKVIARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFM 228

Query: 261 TGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWK 320
           TGSAFNI+WGQ+P LMGY+K VNTR +TY VVI++LKHLPDTKLDA FGLIPLF L+ WK
Sbjct: 229 TGSAFNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWK 288

Query: 321 WWCGTYGPRLNDRYNSKNA--RLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSS 378
           WWC + GP+L DRY   N+  R +K  K  YFY QASRNGIIII+FT + + IT+G +  
Sbjct: 289 WWCNSMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKD 348

Query: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKV 438
           +R IS+LG+VP GL+  GV  +P G+++               EHIAISKSFGR+NDYK+
Sbjct: 349 KRRISVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKI 408

Query: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498
            P+QE+IAIGVSNLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCLT
Sbjct: 409 NPNQEIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLT 468

Query: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558
           GAFFYIPKATLSAVIIHAV DL+ASY TTW+ WKMN  DFI FI TV ITVF+SIE+GIY
Sbjct: 469 GAFFYIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIY 528

Query: 559 FAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLE---- 614
           FA+CWSCA+LL   AFPAGKFLGR+EIAEV +  +  D D   +  EN+N     E    
Sbjct: 529 FAVCWSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDD---FSFENSNESFDDEGIYF 585

Query: 615 ENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPR--IKYHTKWLPFDHKYTRE 672
           +N   E ++     +N  KK    V+T+       + GQ    I+Y+TKW+PFDH Y++E
Sbjct: 586 DNSVAEDKLGTS--SNDLKKFNAGVKTRSINGELVN-GQTSSDIRYYTKWVPFDHAYSKE 642

Query: 673 LNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWN 732
           LNP V I PPP  V+VYRLS+SYTY+NCSRHY++I DE+KR TRRGQ+I+HR K DRPWN
Sbjct: 643 LNPSVRITPPPPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWN 702

Query: 733 DPGPWEAPAFLK--NLK----FWKKKESDLEFTQNAPNNSIDA----------ERDERPL 776
           DPG WEAP   K  N+K     +K+K +D++  +N   N I+           ++DERPL
Sbjct: 703 DPGEWEAPDLKKFFNVKKFVSVFKRKVTDVDTFEN--ENEIEHIHDGEHYKKNDKDERPL 760

Query: 777 LKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGT 836
           L+++CLDFSQVA TDATALQSL DLRKA+N+YADRQVEFHFVGI SPW+KRGL + GFGT
Sbjct: 761 LRVVCLDFSQVANTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGT 820

Query: 837 INEEYSDESIVAGHTSYHVARVPRNKEN--------------PDKYSVYTASGTNLPFFH 882
            NEEYSDESI+AGH+SYH++R   ++++                K  V  ASGTNLPFFH
Sbjct: 821 TNEEYSDESIIAGHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFH 880

Query: 883 IDIPDFAKWDI 893
           +DIPDF+KWDI
Sbjct: 881 VDIPDFSKWDI 891

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/888 (58%), Positives = 651/888 (73%), Gaps = 49/888 (5%)

Query: 16  DFQDNTDSV--PNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKI 73
           D + N+     PNLDDLE EYD YKN E N     + +E+         NDAKG+K    
Sbjct: 14  DLEHNSSDFAEPNLDDLEAEYDNYKNAEQNPREKSDVVETLPPTTHQ--NDAKGLKNDGQ 71

Query: 74  EYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYN 133
              +    +     +  + E  V+ K+YY+ S+ S+++     +YL S+FP+I W+PHYN
Sbjct: 72  TTVELYGTTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYN 131

Query: 134 FNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGP 193
           F W   D++AG+T+GCVLVPQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVCIGP
Sbjct: 132 FAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGP 191

Query: 194 VAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISL 253
           VAVMSL+TAKVIA V    PD DT ITGP+IAT L+LLCG I+  +G LRLGFLVELISL
Sbjct: 192 VAVMSLETAKVIARVTEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISL 250

Query: 254 NAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPL 313
           NAVAGFMTGSAF+I+ GQ+PALMGYN+ VNTR  TYKVVI TLKHLPDTKLDAVFGLIPL
Sbjct: 251 NAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPL 310

Query: 314 FLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITR 373
            +LY+WK+ C T GP   DR  + ++   K  K  +FYAQA RN  +I++FT I W ITR
Sbjct: 311 LILYLWKYGCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAWGITR 370

Query: 374 GKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRI 433
            K   + PIS+L +VPSGLK VGV   P  L +               EHIAI+K+FGRI
Sbjct: 371 HKK--KHPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRI 428

Query: 434 NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLA 493
           NDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+CVLLA
Sbjct: 429 NDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLA 488

Query: 494 LYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASI 553
           LYCLT AF+YIPKATLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+F+SI
Sbjct: 489 LYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSI 548

Query: 554 EDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVS-YVSENNNRIST 612
           E+GIYFA+CWSCA+LL K+AFP+GKFLGRVE++EV +  V+ D   V  + SEN N    
Sbjct: 549 ENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENIN---- 604

Query: 613 LEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSI--GQPRIKYHTKWLPFDHKYT 670
                          + +S+K         G ++ +SSI  G  R+++HTKW+P ++ Y 
Sbjct: 605 ---------------VASSTKP------KLGLSADNSSISTGPSRVRFHTKWIPLENNYG 643

Query: 671 RELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRP 730
           RE N  + + PPP  V+VYR SES+TY+NCSR Y+II DEVKR TRRG ++ H KKSDRP
Sbjct: 644 REYNSGIVVQPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRP 703

Query: 731 WNDPGPWEAPAFLKNL-KFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQ 789
           WNDPG WE P FLK L K  K+ E +L         S +  RDERP+LKIL +D+SQV Q
Sbjct: 704 WNDPGQWEPPLFLKKLFKRGKRLEQEL---------SPELGRDERPVLKILAMDWSQVTQ 754

Query: 790 TDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAG 849
            DAT +Q+LVDLRKAIN+YADRQVEFHF GIISPW+KR L++ GFGT+N+E++DES++ G
Sbjct: 755 IDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILG 814

Query: 850 HTSYHVARV-PRNKEN---PDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           H+SYH+ +  P+++EN     +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 815 HSSYHIVKTRPQDEENHIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/902 (57%), Positives = 653/902 (72%), Gaps = 40/902 (4%)

Query: 15  PDFQDNTD--SVPNLDDLELEYDQYKNNENNG-VFSDNDLESNSVANRNAVNDAKGVKGS 71
           P F+   +   V NLDDLE EYDQYK  E+   V    D E +    +  V+     K +
Sbjct: 22  PRFESEVELSEVSNLDDLEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVD----YKET 77

Query: 72  KIEYFDPSDVSLY----DNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIIN 127
           ++EY++ ++ +        +V  +EE  V   + + H ++  +TL     Y +S FPII 
Sbjct: 78  ELEYWNSTNGTTNLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIK 137

Query: 128 WLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSK 187
           WLP YN+ W  ADL+AGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSF+GA+ YSFFATSK
Sbjct: 138 WLPFYNWKWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSK 197

Query: 188 DVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFL 247
           DVCIGPVAVMSL+TAKVI E   K+P  D  +TGP+IAT LALLCGI++   G LRLGFL
Sbjct: 198 DVCIGPVAVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFL 257

Query: 248 VELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAV 307
           VELISLNAVAGFMTGS+ NI+ GQVPALMG+ K V+TR +TYK++I +LK+L  T+LDAV
Sbjct: 258 VELISLNAVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAV 317

Query: 308 FGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCI 367
           FGLIPL LLY WKWWC +YGP+L DR+   N +   I+K  YFYAQA R+ +IIIVFT I
Sbjct: 318 FGLIPLVLLYTWKWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAI 377

Query: 368 GWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAIS 427
            + IT+G+ +    IS+LG VP GLK+V V  +P GL+SK              EHI+I+
Sbjct: 378 SYGITKGRKTPR--ISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIA 435

Query: 428 KSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSG 487
           KSFGR+N+YKVVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+FSG
Sbjct: 436 KSFGRVNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSG 495

Query: 488 SCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLI 547
           +CVLLALYCLT  F+YIP ATLSAVIIHAVSDL ASY+T+WNF+KMNP DFI FIVTV I
Sbjct: 496 ACVLLALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFI 555

Query: 548 TVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVS------ 601
           TVF+SI+ GIYFAMCWS AM LLK  F  G+FLGRVE+AEV +A V  + ++VS      
Sbjct: 556 TVFSSIDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSH 615

Query: 602 ---YVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKY 658
              + ++++   S+ + +  D+  + + Y+       + N+  +        IGQ ++ Y
Sbjct: 616 LDGFQAQSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQ--------IGQ-KLVY 666

Query: 659 HTKWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRG 718
           HTKW+ +D  Y+RE NP+V I PPP  V+VYR  +SYTYLNCSRHY+II DEV+R TRRG
Sbjct: 667 HTKWISYDRSYSREFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRG 726

Query: 719 QIIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAE---RDERP 775
           Q+I   KK DRPWNDPG WEAP + K L    KK++  E+ +     S  AE   +D RP
Sbjct: 727 QMISAVKKVDRPWNDPGEWEAPRWFKKLT--SKKKTAEEWAETEAQESKAAEQKLQDNRP 784

Query: 776 LLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFG 835
           LLKI+CLDFSQ +QTDATA+Q+L DLRK +N+YADRQVEFH  G+ +PWVKR L++ GFG
Sbjct: 785 LLKIICLDFSQCSQTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFG 844

Query: 836 TINEEYSDESIVAGHTSYHVARVPRNKEN----PDKYSVYTASGTNLPFFHIDIPDFAKW 891
           T+NEEYSDES++AGH SYHVAR P + E+    P +YSVY ASGTNLPFFH++IPDF+KW
Sbjct: 845 TVNEEYSDESLLAGHRSYHVARAPTSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKW 904

Query: 892 DI 893
           D+
Sbjct: 905 DL 906

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/896 (56%), Positives = 641/896 (71%), Gaps = 42/896 (4%)

Query: 20  NTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNA-------VNDAKGVKGSK 72
           + D+  +LDDL+ EY Q+KN E++   +  DL S   A   A            G    +
Sbjct: 23  SNDAPIDLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPE 82

Query: 73  IEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHY 132
            +   P+      +++ +F E  V++ E+Y+ ++RS  TL    +YL+S+ PI+ WLPHY
Sbjct: 83  AKPVAPAAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHY 142

Query: 133 NFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIG 192
           N  W   DL+AGIT+GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDVCIG
Sbjct: 143 NARWLYQDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIG 202

Query: 193 PVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELIS 252
           PVAVMSLQTAK I+ V +  P+ DT IT P+IAT LALLCGIIS  +G LRLGFLVELIS
Sbjct: 203 PVAVMSLQTAKAISHVVSSLPE-DTEITSPMIATALALLCGIISLGLGVLRLGFLVELIS 261

Query: 253 LNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIP 312
             AVAGFMTGSA NI+ GQVPALMGYNKLVNTR +TYKV+I +L+HLPDTKLDAVFGL+P
Sbjct: 262 STAVAGFMTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVP 321

Query: 313 LFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAIT 372
           L +LYVWKW C T GPRL  RY S+ +R+   V   + Y QA RN ++I+VFT I W ++
Sbjct: 322 LVILYVWKWGCSTGGPRLVQRYGSRRSRMWDNV---FLYTQALRNAVVIVVFTAIAWGMS 378

Query: 373 RG--KSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSF 430
               K      IS+LG+VPSGLK+VGV  VPSGL+SK              EHIAISK+F
Sbjct: 379 HRALKEGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAF 438

Query: 431 GRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCV 490
           GR+NDY+VVPDQELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLFSG+CV
Sbjct: 439 GRVNDYRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACV 498

Query: 491 LLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVF 550
           LLA+YCLT AF +IPKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV+ITVF
Sbjct: 499 LLAIYCLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVF 558

Query: 551 ASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRI 610
           +SIE+GIYFAMCWS A+LL + AFPAGKFLGRV+IAE        +S A + V  ++   
Sbjct: 559 SSIENGIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEAR----VTNSGAGAGVGMSSGNS 614

Query: 611 STLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSI-------------GQPRI- 656
           +    N E E+E +   ++ SS+ +      K  A+ S+               G PR  
Sbjct: 615 AGTAVNREKERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAP 674

Query: 657 KYHTKWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATR 716
           ++HTKW+PFD +YTRELNP+V + PPP  V+V+R SES+TY+NCSR Y+ I DEV R TR
Sbjct: 675 RFHTKWVPFD-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTR 733

Query: 717 RGQIIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPL 776
           RG+     K S RPWNDPG W  P FL+  K +K    DLE      N ++   RDERP+
Sbjct: 734 RGRPQIVAKSSSRPWNDPGEWHPPKFLR--KLFKSSSEDLE------NRAV--ARDERPV 783

Query: 777 LKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGT 836
           L+++ +D+SQVAQ D+T LQ+L DLRKA+N+YADRQVEFHF GII PWVKRGLI+ GFGT
Sbjct: 784 LRVIAMDWSQVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGT 843

Query: 837 INEEYSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWD 892
           +N+E++DES++ GH S H+AR     E+ +    + A+GTNLPFFH+++PDF++WD
Sbjct: 844 VNDEFADESLLVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/893 (56%), Positives = 639/893 (71%), Gaps = 54/893 (6%)

Query: 25  PNLDDLELEYDQYKNNE------NNG-----------VFSDNDLESNSVANRNAVNDAKG 67
           P+ D LE EYD  K +E      +NG           ++ D  L+S    N +       
Sbjct: 29  PDFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDN 88

Query: 68  VKGSKIEYFDPSDVSLYDN-SVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPII 126
             G K    +   +  YD+  V  +EE+ V  K+ Y+  +R +LT     +YL S+FP++
Sbjct: 89  GNG-KFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLL 147

Query: 127 NWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATS 186
            W+ HYNFNW   DL+AGIT+GCVLVPQSMSYAQ+ATLPAQYGLYSSF+GA+ YSFFATS
Sbjct: 148 KWVHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATS 207

Query: 187 KDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGF 246
           KDVCIGPVAVMSL+TAKVIA V  K  + +  IT P+IATTL+L+CG ++  VG LRLGF
Sbjct: 208 KDVCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGF 267

Query: 247 LVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDA 306
           LVE ISLNAVAGFMTGSA NI+ GQVP LMGY+K VNTR +TYKV+I TLKHLPDTKLDA
Sbjct: 268 LVEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDA 327

Query: 307 VFGLIPLFLLYVWKWWCGTYGPRLNDRYNSK-NARLHKIVKWTYFYAQASRNGIIIIVFT 365
           VFGLIPLF+LY WK++CGT GP+L DRY ++ + +     K+  FY QA RN  +II+FT
Sbjct: 328 VFGLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFT 387

Query: 366 CIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIA 425
            I W ITR K+  + PIS+LG+VPSGLK VGV  +P GL+S               EHIA
Sbjct: 388 LISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIA 447

Query: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485
           ISK+FGR+N YKVVPDQELIAIGV+NL+ TFFNAYPATGSFSRSALKAKCNV+TPLSG+F
Sbjct: 448 ISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIF 507

Query: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545
           +G+CVLL+LYCLT AF++IPKA LSA+IIHAVSDL+ASY+TTWNFW MNPLDF+CFIVTV
Sbjct: 508 TGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTV 567

Query: 546 LITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSE 605
           +IT+F+SIE+GIYFA+CWSCA+LLLKV FP G+FLG VEI +V++A V  + D +  V  
Sbjct: 568 IITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEVDENIDRI--VLS 625

Query: 606 NNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPF 665
            +++  T+E+N           +T ++  ++  V        + S G  +++YHTKWLP 
Sbjct: 626 EDSQPKTIEDN-----------VTKNNTAVKVGVVA------NESFGHSQLQYHTKWLPL 668

Query: 666 DHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRK 725
           ++ Y RELNPDV +  PP  V+VYR SES+TY+NCSR Y+ I D VK  TR G++++H  
Sbjct: 669 NNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVS 728

Query: 726 KSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFS 785
           K D+ WNDPG WE P  +K L F    + DLE  +           DERP+LKIL +D+S
Sbjct: 729 KHDKMWNDPGEWEPPFLVKKL-FKLGNKHDLEGGEVI---------DERPVLKILAMDWS 778

Query: 786 QVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDES 845
           QV Q D+T +Q+LVDLRKAIN+YA+RQVEFHF GIISPW+KR LI+ GFGT+NEE+SDES
Sbjct: 779 QVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWIKRSLINAGFGTVNEEFSDES 838

Query: 846 IVAGHTSYHVARVPRNKENPDK-----YSVYTASGTNLPFFHIDIPDFAKWDI 893
           I+ GHTSY + +   + ++P+       +++TA G NLPFFH+++P+F KW +
Sbjct: 839 IIVGHTSYSLVKNRPDLQDPEAALPEPIALHTALGVNLPFFHLEMPEFHKWHL 891

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/905 (56%), Positives = 640/905 (70%), Gaps = 58/905 (6%)

Query: 26  NLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYD 85
           +L+  ELEYD  K  ++    + + +E+  + ++    D + V      Y    DV+   
Sbjct: 10  DLERFELEYDHGKRGDD----THDRVEARDLYSKV---DIEEVTFQCDNYSGRLDVN-SS 61

Query: 86  NSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGI 145
            S+  + E  V++K++Y   I  + ++     YL S+FP++ WLPHYN +W I DLIAGI
Sbjct: 62  LSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGI 121

Query: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI 205
           T+GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSLQTAKVI
Sbjct: 122 TVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVI 181

Query: 206 AEVQAKYPDGDTTI-TGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA 264
             V +     + TI T P+IAT LALLCGIIS  +GFLRLGFL+E ISLNAVAGFMTGSA
Sbjct: 182 ERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSA 241

Query: 265 FNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG 324
           FNI+ GQVPALMGYNK VNTRA+TY+VVI TLKHLPDTKLDAVFGLIPL +LY+ KW+  
Sbjct: 242 FNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFS 301

Query: 325 TYGPR-LNDRYNSKN--ARLHKIVKWT---YFYAQASRNGIIIIVFTCIGWAITRGKSSS 378
           + GP+ LN   N +N   R  KI+K+    +FY+ A RNG++IIVFT I WAITRGKSS+
Sbjct: 302 SLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSST 361

Query: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKV 438
             PISILG+VP GLKEV VF VP GL  K              EHIAISKSFGR+NDYK+
Sbjct: 362 SVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKI 421

Query: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498
           VPDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVLLALYCLT
Sbjct: 422 VPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481

Query: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558
           GAF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVF+SIE GIY
Sbjct: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIY 541

Query: 559 FAMCWSCAMLLLKVAFPAGKFLGRVEIAEV------TDAYVKADSDAVSYVSENNNRIST 612
           FA+C+SCA L+ K  FP G FLG ++IAEV      T+ Y     D+ S + E N +  +
Sbjct: 542 FAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDS 601

Query: 613 LE---ENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKY 669
           ++   +  E+ K    +Y    S ++ +N +T   +            Y+ +W+P  + Y
Sbjct: 602 VKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLS------------YYVRWVPMKNDY 649

Query: 670 TRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDR 729
            RE+NP + I PPP  ++VYR  +S+TYLNCSRHY+II DEVK+ TR+G    +++K DR
Sbjct: 650 HREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDR 709

Query: 730 PWNDPGPWEAPAFLKNLKFWKKKESDL------EFTQNAPNNSIDAERDERPLLKILCLD 783
           PWND G WE P  LKNL    KK++D+      +  +   +NS     D +P LKI+C D
Sbjct: 710 PWNDVGEWECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFD 769

Query: 784 FSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSD 843
           FSQV QTDATA+QSL DLRKA+N+Y+++Q+E+HF GIIS WVK+ LI  GFGT+N+ YSD
Sbjct: 770 FSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSD 829

Query: 844 ESIVAGHTSYHVARVPRNKEN------------PDK---YSVYTASGTNLPFFHIDIPDF 888
           +SI+ GH SYHV+++  N+E+            PD    Y + T +GTN PFFHIDIPDF
Sbjct: 830 KSIIIGHQSYHVSKI-NNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDF 888

Query: 889 AKWDI 893
           + W++
Sbjct: 889 SNWEL 893

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/877 (56%), Positives = 621/877 (70%), Gaps = 39/877 (4%)

Query: 26  NLDDLELEYDQYKNNENN----GVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDP--S 79
           +LDDL+ EY  +KN E++    G  S+        A+     D  G K       +    
Sbjct: 11  DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANE 70

Query: 80  DVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIA 139
            ++LYD+  + +E+  V+ +EYY+ +IR  LT      YL+ + P+INWLPHYN  WF  
Sbjct: 71  PLALYDSPEAYYEDK-VTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQ 129

Query: 140 DLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSL 199
           D++AGIT+GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGPVAVMSL
Sbjct: 130 DMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSL 189

Query: 200 QTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGF 259
           QTAK +++V A+ P  DT IT PV+AT LA LCG+IS  +G LRLGFLVELIS  AVAGF
Sbjct: 190 QTAKAVSKVMAELP-ADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVAGF 248

Query: 260 MTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVW 319
           MTGSA NI+ GQ+PALMGYNKLVNTR +TYKV+IETLKHLPDTKLDAVFGLIPL +LY W
Sbjct: 249 MTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTW 308

Query: 320 KWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSE 379
           KW C + GPRL +RY  + +R  +I   T FY QA RN +IIIVFT I W+I+  K  + 
Sbjct: 309 KWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA- 367

Query: 380 RPISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVV 439
            PIS+LG VPSGLK+VGV  +P GL +K              EHIAI+K+FGR+NDY+VV
Sbjct: 368 -PISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVV 426

Query: 440 PDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTG 499
           PDQELIAIG +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA+YCLT 
Sbjct: 427 PDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTS 486

Query: 500 AFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYF 559
           AF YIPKATLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VF+SIE+GIYF
Sbjct: 487 AFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYF 546

Query: 560 AMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGED 619
           AMCWS A+LL KVAFP  +FLGRVEIAE+      A ++ VS  SE     + L ++ E 
Sbjct: 547 AMCWSVAVLLFKVAFPRAQFLGRVEIAEL------ATNEGVSAGSE----FAPLSKDFEK 596

Query: 620 EKEISAKYITNSSKKIETNVQTKGFASPSSSI----GQPRIKYHTKWLPFDHKYTRELNP 675
            K +S  Y + S      N + +G    S  +          +HTKW+PF+  YTRELNP
Sbjct: 597 GKGVS--YASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNP 653

Query: 676 DVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPG 735
            V +  PP  V+V+R SES+TY+NC+R YN I DEV R TRRG+ ++   KS RPWNDPG
Sbjct: 654 QVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPG 712

Query: 736 PWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATAL 795
            W  P FL+   F KK    LE              D+RP+L+++ +D+SQVAQ D+T L
Sbjct: 713 EWHPPKFLRKW-FGKKYSESLE---------QGVVSDDRPVLRVIAMDWSQVAQVDSTGL 762

Query: 796 QSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHV 855
           Q+L DLRKA+++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ GH +Y V
Sbjct: 763 QTLHDLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQV 822

Query: 856 ARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWD 892
           AR     +  +      A+G N+PFFH ++PDF+KWD
Sbjct: 823 ARGGATGDE-EALLPQPATGVNMPFFHAEMPDFSKWD 858

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/873 (52%), Positives = 594/873 (68%), Gaps = 65/873 (7%)

Query: 26  NLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYD 85
           +++ L+ EYDQ K  E   V S        + +R      K       +Y   +  S   
Sbjct: 30  DIEALQAEYDQLKAGE---VHSAQGATHGDIGSRQYSGSGKPAA----QYLGLNVNS--R 80

Query: 86  NSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGI 145
            +V ++EE+ VS+K+YYN+ +R  ++L  A DY  SVFP+  W+ HYN  W  AD++AGI
Sbjct: 81  EAVPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGI 140

Query: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI 205
           T+GCVLVPQSMSYAQ+A+L  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TAKVI
Sbjct: 141 TVGCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVI 200

Query: 206 AEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAF 265
           A V    P+ DT ITGP+IAT L LLCG I+  +G LRLGFLVE IS+ AV GFMTGSA 
Sbjct: 201 ARVTENLPE-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSAL 259

Query: 266 NILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325
           +I+ GQVP+LMGY+K VNTRA TYKV+IE+LKHL DT ++A FGL+PL LL++WKW CG+
Sbjct: 260 SIISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGS 319

Query: 326 YGPRLNDRYNSKNARLHKIVKW--TYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPIS 383
            GPRL DRY     +  +  +W   +FY QA RN +II+VFT I W I+R K   + PIS
Sbjct: 320 LGPRLVDRY--LQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLE-KPPIS 376

Query: 384 ILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQE 443
           +LG VPSGLK VG   +P GL+ K              EHIAI+KSFGRIN+YKVVPDQE
Sbjct: 377 LLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQE 436

Query: 444 LIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFY 503
           LIAIGV+NL  TFFNAYPATGSFSRSALKAKCNV+TPLSGLF+G+CVLLALYCLT AF++
Sbjct: 437 LIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYF 496

Query: 504 IPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCW 563
           IPKATLSAVIIHAV+DL+ASY+ TW FW+ NPLDF  FIVTV+ITVF+SIE GIYF++ W
Sbjct: 497 IPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISW 556

Query: 564 SCAMLLLKVAFPAGKFLGRVEIAEVTDAY----VKADSDAVSYVSENNNRISTLEENGED 619
           SCA+LL KVAFP GKFLG +++AEV +      + +++D  S   +N+     ++++G  
Sbjct: 557 SCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASI--DNSATFQQIDKDGGK 614

Query: 620 EKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVHI 679
              +                         S +  P  ++H +W+P DH Y+RELNP+  +
Sbjct: 615 LNTV------------------------ESVLPDPHTRFHRRWIPLDHAYSRELNPEAVV 650

Query: 680 LPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEA 739
            PPP  V+VYR ++S+TYLNCSRH++II+D VK  TR GQ++ H    +R W DPGPW  
Sbjct: 651 NPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRP 710

Query: 740 PAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLV 799
           P   +     K+  S              A  D RP+L++L +D+SQV+Q D+T +Q+LV
Sbjct: 711 PRIFRRFIADKRTGS--------------AVADARPVLRVLAMDWSQVSQVDSTGIQNLV 756

Query: 800 DLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVARVP 859
           DLR A+N+YADR VEFHF GI+SPW+KR L++ GFG      +D  +++   SYH+ R+P
Sbjct: 757 DLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLP 811

Query: 860 RNKEN-PDKYSVYTASGTNLPFFHIDIPDFAKW 891
            +  +    +SV  A GTN PFFH+D+PDF  W
Sbjct: 812 ADPPHIVHGHSVVFALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/873 (50%), Positives = 599/873 (68%), Gaps = 44/873 (5%)

Query: 27  LDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYDN 86
           LD+LE +Y ++K NE++  +S  + E + +   ++V       GS +++      +L D 
Sbjct: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSV-------GSSLQFAKYDGNALPDF 92

Query: 87  SVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGIT 146
               + E+ V+  EYY+ +IRS +       Y  S+FPII W+ HYNF W  +D IAGIT
Sbjct: 93  KAPPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGIT 152

Query: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIA 206
           +GCVLVPQSMSYAQ+A L  +YGLYSSFIGA+ YSFFATSKDVCIGPVAVMS+Q +KVI+
Sbjct: 153 VGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVIS 212

Query: 207 EVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFN 266
            V  + P+G T IT P++A+ LAL   I+   +G LRLGF++ELIS+ AVAGFMTGSA +
Sbjct: 213 HVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALS 271

Query: 267 ILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           IL  Q+P+L+G  K +NTR  TY+V+I TLKHL  + ++A FGLI L LL+ WKW CG  
Sbjct: 272 ILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYL 330

Query: 327 GPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILG 386
           GP+L  +Y   N++  +I +  +FYAQA RN  ++ + T + W +  G+   +  IS+LG
Sbjct: 331 GPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLG 389

Query: 387 SVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIA 446
           +VPSGLK VGV  +PSGL+ K              EHI I+KSFGRIN+YK+VPDQELIA
Sbjct: 390 TVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIA 449

Query: 447 IGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506
           IGV+NL+G+FFNAYPATGSFSRSALKAKCNV+TPLSGLFSG+CVLLALY LT AF+YIPK
Sbjct: 450 IGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPK 509

Query: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566
           A LSAVIIHAV DL+ASY+ ++  W  NP D I F+ T+L+T+F+SIE+GIYFA+ +S A
Sbjct: 510 AALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMA 569

Query: 567 MLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISAK 626
            LL+K AFP+GKFLG V+I EV++  V  D D++                G ++ E+  +
Sbjct: 570 TLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSI----------------GNNDPELPQE 613

Query: 627 YITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVHILPPPESV 686
              +S    + +V     AS +    +  +++HTKW+P D+ Y+RELNP++ +  PP  V
Sbjct: 614 ISKDSKLAKDPDVH----ASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGV 669

Query: 687 LVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEAPAFLKNL 746
           +VYR +ES+ YLNCSR ++II+D VK  TR G+++ H +KS++ W +PG W  P FL+  
Sbjct: 670 IVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLR-- 727

Query: 747 KFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAIN 806
           KF+KK      +   A    +  + D RP+LKIL +D++QV   D+T++QSL+DLRK IN
Sbjct: 728 KFFKK------YRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTIN 781

Query: 807 QYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVARV-----PRN 861
           +YADRQV FHF GI+SPW+KR L+  GFGTINE YS++ ++  +++YHV +        N
Sbjct: 782 RYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEEN 841

Query: 862 KENPD-KYSVYTASGTNLPFFHIDIPDFAKWDI 893
           ++N +   S+  ASGTN PFFHID+PDF KWDI
Sbjct: 842 QQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  514 bits (1323), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 264/541 (48%), Positives = 357/541 (65%), Gaps = 29/541 (5%)

Query: 91  FEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCV 150
           + E  V+L E +NH +    T +    YL S+ PI  W+ HYN  WFI+D+IAGIT+GCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 151 LVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQA 210
           LVPQSMSYAQ+ATL  QYGLYSS +G + Y+ FATSKD+CIGPVA+MSLQTAK IA V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 211 KYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWG 270
           K+PD    I   +IA+T+A++CG I+  +G LRLGF ++LI + AV GF +GSAFNILWG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 271 QVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRL 330
           Q+P LMGY+K VNTR  TYKVV++TLK LP T ++AV GLIPLF L+VWK+ C       
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD------ 232

Query: 331 NDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPS 390
              Y  +   L    K   FY  + R  I+II+ +   +     K+ S   + +LG +P 
Sbjct: 233 ---YALRRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAYG---AKNPS---LKVLGKIPK 283

Query: 391 GLKEVG---VFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAI 447
           G        +  +PS L+S               EH++I+KSF R+N+Y+V  DQEL AI
Sbjct: 284 GFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAI 343

Query: 448 GVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506
           GVSN++G     AYP TGSFSR+ALKA+C VRTPL  +FSG CV++A+  LT A  +IPK
Sbjct: 344 GVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPK 403

Query: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566
           ATLSAVIIHAVS L++SY+ T   +KM PLD + F+VT+ ITVF+ IE G+YFA+CW+C 
Sbjct: 404 ATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACF 463

Query: 567 MLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISAK 626
           +L++++AFP G FLG V + E++ + +    + + Y S N+      E    ++K+++ K
Sbjct: 464 LLMIRIAFPYGAFLGYVRVREISRSSITM-IEPMDYESGNDK-----ENIKLNKKQLTKK 517

Query: 627 Y 627
           Y
Sbjct: 518 Y 518

 Score =  197 bits (500), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 138/225 (61%), Gaps = 30/225 (13%)

Query: 662 WLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI- 720
           W+P+ H++TRELNP V I PPP  V+VYR S+S TY+NCSR+Y+ IID +K  T+ G+I 
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780
           +       +PWN+PGPWE P     LKFW+  + ++   +           D+RP L+IL
Sbjct: 748 VLSDALYVKPWNNPGPWEKP----KLKFWEHADPEIARKKRMA--------DKRPTLRIL 795

Query: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840
           CLDFSQVAQ D+TALQ+L+DLR  +N Y    VE+HF GIISPWV+R LI  GFG IN+E
Sbjct: 796 CLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKE 855

Query: 841 Y----SDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFF 881
           +    +D S V   +               +Y+   A G N+PFF
Sbjct: 856 FFPKVNDSSTVEVISDL-------------EYNGELALGENVPFF 887

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 127/508 (25%), Positives = 216/508 (42%), Gaps = 72/508 (14%)

Query: 117 DYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P + W+P+YN+  F  D IAG+++    +P  +S+A  +A +    GLYS  +
Sbjct: 66  DVLPYYLPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAV 125

Query: 176 GAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGII 235
             + Y+ F +   + +GP + +SL   + +  + +     D ++    IAT ++ + G+ 
Sbjct: 126 TPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSH----DLSLETVDIATMISFMSGLT 181

Query: 236 SAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIET 295
               G  RLGFL  ++S   + GF++   F ++   +   +  NKL+ T    Y    E 
Sbjct: 182 LLFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEK 241

Query: 296 LK----------HLPDTKLD-AVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKI 344
           +           HLP + L  AVF    L  + ++K                   ++ + 
Sbjct: 242 ILFLVRYGPSNYHLPTSFLSLAVF--TTLMTIRIFK------------------KKMMRR 281

Query: 345 VKWTYFYAQASRNGI--IIIVFTC----------IGWAITRGKSSSERPISIL--GSVPS 390
           +KW  F  +     I  I++ + C          IG   T G      P+S    G +P+
Sbjct: 282 IKWIVFIPEILSVVIFSIVLSYMCDLKKKYDISVIGDFNTDGFDDFRNPLSKCNRGLIPA 341

Query: 391 GLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVS 450
            L++V +     G +                E I  SKS G   +     ++EL+A+G+ 
Sbjct: 342 -LRDVSLVSALLGFL----------------ESITASKSLGGYGNTVASSNRELVALGLM 384

Query: 451 NLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLS 510
           N +G+ F   PA G + RS + A    +T ++G+F GS  L  +  L     YIP   LS
Sbjct: 385 NTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLS 444

Query: 511 AVIIHAVSDLL--ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAML 568
            +       LL  A +   ++       + I F++T L T F SIE GI     +S   +
Sbjct: 445 VITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISI 504

Query: 569 LLKVAFPAGKFLGRVEIAEVTDAYVKAD 596
           +   A    + L RV   E TD ++ A+
Sbjct: 505 VKHSAQSRIQILARV---EGTDHFINAN 529

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 120/476 (25%), Positives = 197/476 (41%), Gaps = 49/476 (10%)

Query: 107 RSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLP 165
           RS LT     DYL   FP  +W+P+Y    F+ DL AG+++    +P ++SYA  +A + 
Sbjct: 44  RSILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVE 103

Query: 166 AQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIA 225
              GLYS  I  + Y+ F +   + +GP + +SL    V+ +      + D  I+   I+
Sbjct: 104 PLSGLYSLAITPFIYAIFGSVPQMIVGPESAISL----VVGQAVEPMVNHDERISTISIS 159

Query: 226 TTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTR 285
             +  + G     +G  RLGFL  ++S   + GF+    F ++   + + +  +K++ T 
Sbjct: 160 IVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATS 219

Query: 286 AATYKVVIETLK----------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYN 335
              Y    E +           H P T + +++  I L L+ V K               
Sbjct: 220 PEHYHTPFEKILFLIKYGQHNYHAP-TAILSLYSFIILMLMKVMK--------------- 263

Query: 336 SKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEV 395
               RL K  KW  F  +     I+I++   I ++        +  ISI+G     +   
Sbjct: 264 ---KRLMKRFKWVIFVPE-----ILIVIVGTIMFSF-HFDIKHKFDISIIGDFK--VNGF 312

Query: 396 GVFHVPSG-----LMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVS 450
              H P       L+                E    SK+ G   D  V  ++EL+A+G  
Sbjct: 313 DSLHNPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSM 372

Query: 451 NLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLS 510
           N++G+ F A PA G + RS + A    +T +SG+  GS  L  +          P   LS
Sbjct: 373 NIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLS 432

Query: 511 AVIIHAVSDLLASYQTTWNFWKMNPL--DFICFIVTVLITVFASIEDGIYFAMCWS 564
            V       LL    T   F+  +    + I   +T + T+F S+E GI    C+S
Sbjct: 433 VVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYS 488

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 117/467 (25%), Positives = 198/467 (42%), Gaps = 51/467 (10%)

Query: 117 DYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           + ++   P + WLP+Y     + DL+AGITI    +P ++SYA  +A +    GLY+  +
Sbjct: 104 ELIRYYLPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAV 163

Query: 176 GAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGII 235
             + Y+ F ++  + +GP   +SL   + +   +   PD D  +   VIA TL  + G I
Sbjct: 164 SPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPILI--VIAVTL--ISGTI 219

Query: 236 SAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIET 295
               G  RLG+L  +++   + GF+         G V  +M  + L+N       ++ +T
Sbjct: 220 LLISGIFRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDILADT 269

Query: 296 LKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNS-----------KNARLHKI 344
            +H     L  VF         +WK+    +                     K   +H+ 
Sbjct: 270 PEHYNTPFLKIVF---------LWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHR- 319

Query: 345 VKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVP--- 401
            +W  F  +      I+IV T +     +   +    I ILG   S   E  +FH P   
Sbjct: 320 HRWLIFIPE------ILIVLTTVLILSYKLDFADTYDIDILGDFKS--NENSIFHNPLSN 371

Query: 402 --SGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNA 459
              GL+                E    SK+ G  ++  V  ++EL+A+G+SN++ +   A
Sbjct: 372 KNRGLIHVVFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGA 431

Query: 460 YPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSD 519
            P+ G + RS + A    +T LSG+F G   +LA+  L     YIP   LS +       
Sbjct: 432 LPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFT 491

Query: 520 LLASYQTTWNF-WKMNPLDFICFIV-TVLITVFASIEDGIYFAMCWS 564
           LL       +F W+    + +  IV T + ++F S+E  +Y    +S
Sbjct: 492 LLEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYS 538

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  116 bits (291), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 123/496 (24%), Positives = 203/496 (40%), Gaps = 48/496 (9%)

Query: 117 DYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P  +WLP+YN +  I DLIAG+++    +P ++S+A  VA +    GLYS   
Sbjct: 84  DVLPYYLPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAF 143

Query: 176 GAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGII 235
             + Y+   +   + +GP + +SL   + + ++ +  PD  T     VI      + G  
Sbjct: 144 TPFIYAILGSVPQMIVGPESAISLVVGQAVEKMISHNPDLHTLQLSAVIT----FISGGF 199

Query: 236 SAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIET 295
               G  RLGFL  ++S   + GF++     ++   + +    +K++      Y    E 
Sbjct: 200 LFFFGLCRLGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEK 259

Query: 296 LK----------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIV 345
           +           H P T L     L   F+L + K       PR                
Sbjct: 260 ILFLVTYAPNNYHGPTTALS----LSCFFILIMTKIIKKKLMPR---------------C 300

Query: 346 KWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPS-GLKEV--GVFHVPS 402
           +W  F        I++++   I  +I + +      IS +G   + GL ++   +     
Sbjct: 301 RWIVFVPD-----ILLLIIGTIFLSI-KYRFKHNYSISTVGDFNTKGLDKLLNPLSAENR 354

Query: 403 GLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPA 462
           GL+ +              E    SKS G   D  +  ++EL+A+G  NL  +   + PA
Sbjct: 355 GLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPA 414

Query: 463 TGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL- 521
            G + RS + A    +T +SG F G  VLL +  L     YIP   LS V       LL 
Sbjct: 415 FGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLE 474

Query: 522 -ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFL 580
            A     ++F      + + F +TVL T+F S+E GI     +S   ++   A    + L
Sbjct: 475 EAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKSRIQIL 534

Query: 581 GRVEIAEVTDAYVKAD 596
            RV   + T  +V +D
Sbjct: 535 ARV---QGTSRFVNSD 547

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 120/482 (24%), Positives = 197/482 (40%), Gaps = 43/482 (8%)

Query: 117 DYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D LK   P  +WLP Y    F  D+IAGIT+    +P ++SYA  +A +    GLYS  I
Sbjct: 75  DRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAI 134

Query: 176 GAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGII 235
             + Y  F +   + +GP + +SL    V+ +   K    +  +    I+  +  L G I
Sbjct: 135 TPFVYCVFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAI 190

Query: 236 SAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIET 295
               G  RLGFL  ++S   + GF++     ++   +   +   KL+ T    Y    E 
Sbjct: 191 LLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEK 250

Query: 296 LKHL----PDT--KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTY 349
           ++ L    P+   K  A+  L    +L   ++       +L  RY           K   
Sbjct: 251 VQFLFKYGPENLHKPTAILSLCSFIILMTLRFL----KKKLMKRY-----------KSVI 295

Query: 350 FYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVP-SGLKEVGVFHVPSG----- 403
           F+ +     I++IV + +  ++       +  IS+LG    SG  ++   + P G     
Sbjct: 296 FFPE-----ILLIVISSLIISVNFNL-KKDFDISMLGDFSTSGFDKL---NNPLGKDNRS 346

Query: 404 LMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPAT 463
           L  +              E    SKS G I D  +  ++EL+A+G  NL+G+ F A P+ 
Sbjct: 347 LCHELLSVGLMCAILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSF 406

Query: 464 GSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL-- 521
           G + RS + A    +T +SG   G   L  +  L     Y P   LS +       LL  
Sbjct: 407 GGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEE 466

Query: 522 ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLG 581
           A     ++       + I F +  + T+  S+E GI     +S   ++   A    + L 
Sbjct: 467 APSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILT 526

Query: 582 RV 583
           RV
Sbjct: 527 RV 528

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 117/477 (24%), Positives = 191/477 (40%), Gaps = 47/477 (9%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYAYS 181
            P  +WLP Y FN    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
              +   + +GP + +SL   + +  +   + D  + I    I+  +  + G I    G 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISIVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +K + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 302 ------TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQAS 355
                  K  A+F      +L V +                   +L K  K   F+    
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVMRLL---------------KKKLMKRHKSAVFFPD-- 313

Query: 356 RNGIIIIVFTCIGWAITRGKSSSER-PISILGSVP----SGLKEVGVFHVPSGLMSKXXX 410
              I+++V   I   I+   S  +R  ISI+G         LK   + H    LM     
Sbjct: 314 ---ILLVVIVTI--LISMKLSLKQRYGISIVGDFSMDNFDKLKN-PLTHSRRKLMPDLFS 367

Query: 411 XXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
                      E    SKS G   +  V  ++EL+A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF 530
           + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL        F
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 531 WKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEI 585
                   +   F VT  +T+F SIE GI    C  C   +L +   + K   R++I
Sbjct: 488 HLQCGGYSELFVFAVTFGVTIFYSIESGI----CIGCVYSILNIIKHSAK--SRIQI 538

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 117/482 (24%), Positives = 191/482 (39%), Gaps = 32/482 (6%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYAYS 181
            P  +WLP Y+ +  + D IAG ++    +P +MSY+  VA +P   GL +     + Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + I E Q K+   D ++    +   L  + G I    G 
Sbjct: 130 VFGSVPHMIVGPESAISLVVGQAI-EKQMKH---DKSLDVVNLCLILTFISGAILFCFGI 185

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPD 301
           +R G+L  ++S   + GF++     ++   +   +   K+ N     Y        H P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPF 237

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIII 361
            KL  +F   P    +V           +         RL ++ K   F  +      I+
Sbjct: 238 QKLIFLFHYAP-GNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVPE------IL 290

Query: 362 IVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSG-----LMSKXXXXXXXXX 416
           IV   +              I I+G +  G  +   F  P       L S+         
Sbjct: 291 IVVALVTLGSYHFSFKLRYNIDIVGDIEVG--DTSKFRNPLSKKNLSLFSELFHAGFMVA 348

Query: 417 XXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 476
                E    SKS G   +  V  ++EL+A+G  NL+G+ F A P+ G + RS + A   
Sbjct: 349 LLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSG 408

Query: 477 VRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNFWKMN 534
             T +SG+F G    +    L  A  +IP   LS +       L   A     ++F    
Sbjct: 409 AATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRG 468

Query: 535 PLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVK 594
             + + F +TVL T F S+E GI     +S   ++        + L RV     TD +V 
Sbjct: 469 YNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRRV---SGTDQFVN 525

Query: 595 AD 596
           AD
Sbjct: 526 AD 527

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 112/480 (23%), Positives = 191/480 (39%), Gaps = 40/480 (8%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYAYS 181
            P + WLP YN + F +D I+GI++    +P ++SYA  +A +    GLYS  I    Y 
Sbjct: 114 LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYG 173

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKY---PDGDTTITGPVIATTLALLCGIISAA 238
              +   + +GP   +SL   + + ++   Y      D  I+   I+ T+  L G++   
Sbjct: 174 ILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFI 233

Query: 239 VGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIE---- 294
            G LRLGFL  ++S   +  F++     ++   +   M  N ++      Y    E    
Sbjct: 234 CGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHTAFEKIMF 293

Query: 295 TLKHLPDT--KLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYA 352
            +K+ P+   K   V  ++   +LY  ++           +Y  K+  L        F  
Sbjct: 294 IIKYAPNNFHKPTTVLSVVCFSILYFVRYC--------KKKYIIKHKSL-------IFLP 338

Query: 353 QASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSK----- 407
           +      I+IV    G             ISI+G V S    +   ++ + L S      
Sbjct: 339 E------ILIVVISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELF 392

Query: 408 --XXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGS 465
                           E    SKS G   +  +  ++EL+A+GV NL  +     P+ G 
Sbjct: 393 PILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGG 452

Query: 466 FSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQ 525
           + RS + A    +T +SG+  G   +L +  L     +IP   LS +       L+    
Sbjct: 453 YGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEAP 512

Query: 526 TTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRV 583
               F W+     + I F +T   T+F S+E GI     +S   ++   A    + LGR+
Sbjct: 513 GEVKFHWRCKGYNELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQILGRI 572

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 136/568 (23%), Positives = 237/568 (41%), Gaps = 59/568 (10%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYAYS 181
            P  +W+P Y +   I+D +AGI++    +P ++SYA  +A +    GLYS  I  + Y+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + +  +++     D+ +    I+  L  + G     +G 
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSVELLKSH----DSALEIINISVVLTFISGAALLILGI 204

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLK---- 297
           LRLGFL  ++S + + GF++     ++   +   +  NKL+           E ++    
Sbjct: 205 LRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFLIK 264

Query: 298 ------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFY 351
                 H P   L A+   + LF + + K            R+ +K+       +W  F 
Sbjct: 265 YAPTNYHKPTALLSAI-AFVTLFSIRLLK-----------KRWMAKH-------RWLAFI 305

Query: 352 AQASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVP-----SGLMS 406
            +     +II ++    W   +     +  I I+G   +    +     P       +M 
Sbjct: 306 PEILMV-VIISIYLSATWEFKK-----QYGILIVGDFNT--HAIDKLKNPISKENRKIMP 357

Query: 407 KXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSF 466
           +              E +  SKS G   D  +  ++EL+A+G  N++ + F A P+ G +
Sbjct: 358 QLLNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGY 417

Query: 467 SRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASY 524
            RS + A    +T +SG+F GS  L+ +  L     YIP   LS +       LL  A  
Sbjct: 418 GRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPS 477

Query: 525 QTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRV- 583
           +  ++F      +   F +TVL T+  S+E GI     +S   ++   A    + LGRV 
Sbjct: 478 ELKFHFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQ 537

Query: 584 ---EIAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQ 640
              E A + D Y+  DSD +  + E N  +    E     K       TN+    E   +
Sbjct: 538 GTREFANI-DEYL--DSDPIGDI-ETNKFVLEEIEGCLIVKIPEPLTFTNTDDLKERLNR 593

Query: 641 TKGFASPSSSIGQP--RIKYHTKWLPFD 666
            + F S  +  G P  R K +TK + FD
Sbjct: 594 LERFGSVKAHPGGPGGRSKDYTKCVIFD 621

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 112/476 (23%), Positives = 189/476 (39%), Gaps = 43/476 (9%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYAYS 181
            P  +WLP Y FN    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
              +   + +GP + +SL   + +  +     +    ++   I+T +  + G I    G 
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLHKEN----VSLIDISTVITFVSGTILLFSGI 220

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +K + +    Y    E +  L D
Sbjct: 221 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 280

Query: 302 ---------TKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYA 352
                    T + +   LI LFL  + K                   +L K  K   F+ 
Sbjct: 281 YAPAQYHIPTAIFSGCCLIVLFLTRLLKR------------------KLMKYHKSAIFFP 322

Query: 353 QASRNGIIIIVFTCIGWAITRGKSSSERPISILGSVP-SGLKEVG--VFHVPSGLMSKXX 409
                 I+++V   I  ++ +        ISI+G        E+   +      L+    
Sbjct: 323 D-----ILLVVIVTILISM-KFNLKHRYGISIIGDFSMDNFDELKNPLTRPRRKLIPDLF 376

Query: 410 XXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRS 469
                       E    SKS G   +  V  ++EL+A+G  N++ + F A PA G + RS
Sbjct: 377 SASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRS 436

Query: 470 ALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWN 529
            + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL        
Sbjct: 437 KINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIK 496

Query: 530 F-WKMNPL-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRV 583
           F  +     +   F VT   T+F SIE GI     +S   ++   A    + L RV
Sbjct: 497 FHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARV 552

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 115/504 (22%), Positives = 205/504 (40%), Gaps = 45/504 (8%)

Query: 94  SAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVP 153
           S  SL+ Y    +   L L     Y+    PI+ W P Y+      DL+AGI++    +P
Sbjct: 20  STPSLRSYRAIKVDQPLKLN-TKSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIP 78

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYP 213
            ++S + +A +    GL+S  I    Y+ F +   + +GP  V+SL   +       K  
Sbjct: 79  FAISLSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSHK-- 136

Query: 214 DGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
             D+ +T  VIA T     G I  ++G  R+GF+   IS   + GF+   A  +L  ++ 
Sbjct: 137 SVDSLVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELL 192

Query: 274 ALMGYNKLVNTRAATYKVVIET-------LKHLPD------TKLDAVFGLIPLFLLYVWK 320
             +    L     A       T       LK+ P+       KL  +   I +   YV K
Sbjct: 193 PELQLEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKK 252

Query: 321 WWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSER 380
           ++    G +L   +      +   +  +Y+   +S  G  II        +   K+  + 
Sbjct: 253 YFTEKRGSKLCRFFPDLLLVVAGFIYLSYYNDWSSTMGTRII------GNLPPNKNHFKV 306

Query: 381 PISILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVP 440
           PI+        L ++       GL                       K+ G   D  +  
Sbjct: 307 PITSFKEFKE-LFDISFLVAILGLFDSATAF----------------KAIGEKFDIDISS 349

Query: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500
           ++EL+++G+ N++ + F+A PA G + RS L   C+ +TP++G+      +  +  + GA
Sbjct: 350 NRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGA 409

Query: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIY 558
           F Y+P   L+ +I +   +LL    +   F W +    + + F+  V+ T+  S + G+ 
Sbjct: 410 FHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVS 469

Query: 559 FAMCWSCAMLLLKVAFPAGKFLGR 582
             +  +   LL        + LGR
Sbjct: 470 IGVGLTMIRLLKHTTQSRVQILGR 493

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 130/530 (24%), Positives = 214/530 (40%), Gaps = 49/530 (9%)

Query: 79  SDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFI 138
           +DV     S    + S VS  E         +TLK   D +    P  +W+P Y+    +
Sbjct: 39  NDVQSTSTSTVGLKFSTVSFPE------NERVTLK---DTIPYYLPCFSWIPTYSVKKCM 89

Query: 139 ADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVM 197
            D IAG+++    +P +MSYA  VA +P   GLYS       Y+   +   + +GP + +
Sbjct: 90  GDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYTVLGSVPQMIVGPESAI 149

Query: 198 SLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVA 257
           SL   + I   +A+  + D  +    I   +  + G++    G LRLGFL  ++S   + 
Sbjct: 150 SLILGQAI---EARLSE-DPKLKAINICLVITFISGLVLLTGGLLRLGFLENVLSRALLR 205

Query: 258 GFMTGSAFNILWGQVPALMGYNKLVNTRAATY----KVVIETLKHLPDT--KLDAVFGLI 311
           GF++G    ++   +   +  N +  TR   Y    + V+  +K+ P+   K  A+  L+
Sbjct: 206 GFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKPTAILSLV 265

Query: 312 PLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAI 371
              +L   + +   YG +                KW            I++V     +  
Sbjct: 266 AFVILMSLRIFKKRYGKKF---------------KWLVLLPD------ILVVVALSIFVS 304

Query: 372 TRGKSSSERPISILGSVPS-GLKEVG--VFHVPSGLMSKXXXXXXXXXXXXXXEHIAISK 428
            +    S   I I+  +P   +K +     +V                     E    SK
Sbjct: 305 YKMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFMVAMLGFFESATASK 364

Query: 429 SFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGS 488
           S G   +  +  ++ELIA+G  N++G+ F   PA G + RS + A    +T +SG F G 
Sbjct: 365 SLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGL 424

Query: 489 CVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVL 546
             L  +  L     YIP   LS +       LL        F W+     +   F VT+L
Sbjct: 425 VTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLL 484

Query: 547 ITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKAD 596
            T+F S+E GIY     S   ++   A    + LGRV     T+ ++ AD
Sbjct: 485 ATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRV---PGTETFINAD 531

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 96/441 (21%), Positives = 171/441 (38%), Gaps = 38/441 (8%)

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYP 213
            S+S + +A LP   GLYS  I    Y    T     +GP  V+SL   +       +  
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 214 DGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
           +  +T+        +  + G I  A+G  R+GF+   +S   + GF++  A  +L  ++ 
Sbjct: 61  EPLSTVA------VIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELL 114

Query: 274 AL----------MGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWC 323
                       +    +  T    ++ ++E      DT              + W    
Sbjct: 115 PELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSL 160

Query: 324 GTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPIS 383
            T+   +  RY  ++       K   F+ +     I+I+V   I  + T+ K S  + I 
Sbjct: 161 FTFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQ-KWSELKGIK 214

Query: 384 ILGSVPSGLKEVGVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQE 443
           I+G +P     + V         +              E   + KS    ++     ++E
Sbjct: 215 IIGDIPPNSDHIKVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASSNRE 274

Query: 444 LIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFY 503
           L+++GV NL+ + F+A PA G + RS +   C  +T  SG+F     ++ +  L  AF +
Sbjct: 275 LVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNAFHH 334

Query: 504 IPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIYFAM 561
           +P   L+ +I      LL        F W +    +   FI+ V+ T+  S + G+   M
Sbjct: 335 LPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVTMGM 394

Query: 562 CWSCAMLLLKVAFPAGKFLGR 582
           C +   LL        + LGR
Sbjct: 395 CLTMIRLLKHSTRSRVQILGR 415

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 5/140 (3%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYAYS 181
            P ++W+PHY++  F  DL+AGI++    +P ++SYA  +A +    GLYS  I    Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL    V+ +   K+   D+ I+   I   +  + G++   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 242 LRLGFLVELISLNAVAGFMT 261
           +RLGFL  ++S   + GF++
Sbjct: 190 VRLGFLGNILSKALLRGFIS 209

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 78/190 (41%), Gaps = 9/190 (4%)

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           E    SKS G   +     ++ELIA+G  N++G+ F A P+ G + RS +      +T +
Sbjct: 358 ESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVM 417

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNP--LDFI 539
           SG   G   LL    L     Y P   LS +       LL    +   F        +  
Sbjct: 418 SGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELT 477

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDA 599
            F +T + T+  S+E G+     +S  +++   A    + L ++   E +D +V  D   
Sbjct: 478 VFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKL---EGSDEFVNVD--- 531

Query: 600 VSYVSENNNR 609
             Y+   N R
Sbjct: 532 -DYIKNYNGR 540

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 88/197 (44%), Gaps = 7/197 (3%)

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           E    SKS G   D  +  ++EL+A+G  NL+G+ F A P+ G + RS + A     T +
Sbjct: 369 ESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVM 428

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNFWKMNPLDFI 539
           SG+F G   L+    L  A  +IP   LS +       L   A     ++F      + +
Sbjct: 429 SGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELL 488

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADS-- 597
            F +TVL T F S+E GI     +S    +        + LGR+     T+ +V AD   
Sbjct: 489 TFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRI---SGTNRFVNADEFY 545

Query: 598 DAVSYVSENNNRISTLE 614
            A S  SE   R+  +E
Sbjct: 546 SASSLDSEFGPRLDHME 562

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 5/141 (3%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYAYS 181
            P  +WLP Y+   FI DLIAG ++    +P +MSY+  VA +P   GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL    V+ +   K    D ++    +   L  + G I  + G 
Sbjct: 145 VFGSVPHMIVGPESAISL----VVGQAIEKLTKHDASLNVTNLCVVLTFISGSILFSFGL 200

Query: 242 LRLGFLVELISLNAVAGFMTG 262
           +R GFL  ++S   + GF++ 
Sbjct: 201 MRFGFLDSVLSRALLRGFISA 221

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 5/146 (3%)

Query: 117 DYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P  +W+P Y ++ F+ DL+AGIT+    +P ++SYA  +A +    GLYS   
Sbjct: 76  DVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAF 135

Query: 176 GAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGII 235
             + Y+ F +   + +GP + +SL   + + +++A     +  I+   I+  +  + G+ 
Sbjct: 136 TPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRAH----NHEISTMSISVLVTFISGMF 191

Query: 236 SAAVGFLRLGFLVELISLNAVAGFMT 261
               G  R GFL  ++S   + GF++
Sbjct: 192 LFVFGICRFGFLGNVLSRALLRGFIS 217

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 80/177 (45%), Gaps = 5/177 (2%)

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           E    +KS G   ++ +  ++EL+A+G  NL  +   A PA G + RS + +    +T +
Sbjct: 366 ESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVM 425

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNFWKMNPLDFI 539
           SG+  G  VLL +        YIP   LS +       LL  A     ++F      + +
Sbjct: 426 SGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELL 485

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKAD 596
            F VTVL T F S+E G+     +S   ++   A    + L RV   E T  ++ +D
Sbjct: 486 VFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQILARV---ESTGQFINSD 539

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 119/268 (44%), Gaps = 26/268 (9%)

Query: 38  KNNENNGVFSDN---DLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEES 94
           ++ + + VF DN   D +S+   +R  V    G   S  E F P +VS +++  S     
Sbjct: 25  RSVDQHEVFPDNFDYDKDSSKYQSRTHV----GTSNSASEVF-PVNVSRFESFNSMSNND 79

Query: 95  AVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQ 154
           +V    Y N++I      +    YL    P  +WLP Y FN    D+IAGI++    +P 
Sbjct: 80  SV----YDNNTI-----FETVPYYL----PCFSWLPEYTFNKLWGDIIAGISLASFQIPL 126

Query: 155 SMSY-AQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYP 213
           ++SY   +A +P   GLYS  I  + Y    +   + +GP + +SL   + +  +   + 
Sbjct: 127 ALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITL-HK 185

Query: 214 DGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
           D  + I    I+  +  + G I    G  R GFL  ++S   + GF++     ++   + 
Sbjct: 186 DNVSLID---ISVVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALI 242

Query: 274 ALMGYNKLVNTRAATYKVVIETLKHLPD 301
           + +  +K + +    Y    E +  L D
Sbjct: 243 SELKLDKFLLSLPQHYHTPFEKVLFLID 270

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 73/166 (43%), Gaps = 8/166 (4%)

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS + A    ++ +
Sbjct: 379 ESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVM 438

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKM--NPLDFI 539
           SG+F G   L+ +  L     YIP   LS +       LL        F        +  
Sbjct: 439 SGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELF 498

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEI 585
            F VT  +T+  SIE GI    C  C   +L +   + K   R++I
Sbjct: 499 VFAVTFGVTILCSIEAGI----CIGCVYSILNIIKHSAK--SRIQI 538

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 81/177 (45%), Gaps = 5/177 (2%)

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           E    SKS G   D  V  ++EL+A+G  NL+G+ F A P+ G + RS + A    +T +
Sbjct: 381 ESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVV 440

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNFWKMNPLDFI 539
           SG   G+  +  +  L     YIP   LS +       LL  A     ++       + I
Sbjct: 441 SGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELI 500

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKAD 596
            FI+TVL T F S+E GI     +S   ++        + LG++     T+ +V AD
Sbjct: 501 SFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKL---AGTNKFVNAD 554

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 72/147 (48%), Gaps = 5/147 (3%)

Query: 117 DYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P  +WLP Y+   F  D IAG+++    +P +MSYA  +A +    GLY+   
Sbjct: 91  DVLPYYLPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAF 150

Query: 176 GAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGII 235
             + Y+ F +   + +GP + +SL   + I E   ++   D +++   +   +  + G++
Sbjct: 151 TPFFYAIFGSVPQMIVGPESAISLVVGQAI-EPMIRH---DPSLSSLDLCVIITFISGVV 206

Query: 236 SAAVGFLRLGFLVELISLNAVAGFMTG 262
               G  R GFL  ++S   + GF++ 
Sbjct: 207 LFTFGVFRFGFLDNVLSRAFLRGFISA 233

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 5/180 (2%)

Query: 123 FPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYAYS 181
            P   WLP Y F+    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGF 241
            F +   + +GP + +SL   + +  +   + D  + I    I+  +  + G I    G 
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISIVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +K + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 270

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 75/166 (45%), Gaps = 8/166 (4%)

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS + A    ++ +
Sbjct: 379 ESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVI 438

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKM--NPLDFI 539
           SG+F G   L+ +  L     YIP   LS +       LL    +   F        +  
Sbjct: 439 SGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELF 498

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEI 585
            F VT  +T+F SIE GI    C  C   +L +   + K   R++I
Sbjct: 499 VFAVTFGVTIFYSIEAGI----CIGCVYSILNIIKHSAK--SRIQI 538

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 2/144 (1%)

Query: 428 KSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSG 487
           KS     D  V  ++EL+++G+ N++G+ F++ PA G + RS L   C  +TP++G+F  
Sbjct: 337 KSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVS 396

Query: 488 SCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTV 545
              +  +  L G F Y+P   L+ +I     +LL        F W ++   + I F   V
Sbjct: 397 LSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVV 456

Query: 546 LITVFASIEDGIYFAMCWSCAMLL 569
           L T+  S + G+   +  +   LL
Sbjct: 457 LSTLIWSPQFGLVMGLGLTMIRLL 480

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 78/175 (44%), Gaps = 7/175 (4%)

Query: 94  SAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGITIGCVLVP 153
           S +SL+ Y    +   L       Y+    PI+ WLP Y++     D++AG+T+    +P
Sbjct: 20  STMSLRSYRAIKVDKPLR-HDTKSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIP 78

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYP 213
            ++S   +A +    GLY+  I    Y+ F +   + +GP  V SL   +       K  
Sbjct: 79  LAISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASLVVGQSCDAWAHKSL 138

Query: 214 DGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNIL 268
           +   T+        +  + G++  A+G  RLGF+   IS   + GF +  A  +L
Sbjct: 139 EPLMTV------AVIGCISGVLVFAMGIFRLGFIDNAISKAFLKGFTSALAVVML 187

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 93/216 (43%), Gaps = 20/216 (9%)

Query: 432 RINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL 491
           +++ Y V  D+ELIA G+SNL+   F +      ++ S L  +    +P +G       +
Sbjct: 500 QMDKYDV--DKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTI 557

Query: 492 LALYCLTGAFFYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVF 550
           + +        +IP   + ++I     +LL  +   TW+  K+   +++  +V VL    
Sbjct: 558 VVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGI 615

Query: 551 ASIEDGIYFAMCWSCAMLLL---KVAFPAGKFLGRVEIAEVTDAYVKAD-----SDAVSY 602
                GI   +  +C   L+   K+    G+F G+V  + V    +++       D +  
Sbjct: 616 VDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYV 675

Query: 603 VSENN----NRISTLEENGEDEKEISAKYITNSSKK 634
           +   N      I ++EE  +   E+S +   NSSK+
Sbjct: 676 LKLQNLLFFGTIISIEEKIDKLLEMSDR---NSSKR 708

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 73/167 (43%), Gaps = 8/167 (4%)

Query: 433 INDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLL 492
           ++ Y V  D+ELIA G SNL+  F  +      ++ S L  +    +P++G+       +
Sbjct: 555 VDKYDV--DKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFI 612

Query: 493 ALYCLTGAFFYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFA 551
            +        +IP   + ++I     +L+  +   TW   K+ P +++   + V+     
Sbjct: 613 VMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWG--KLQPFEYLTIWIIVITMGVV 670

Query: 552 SIEDGIYFAMCWSCAMLLL---KVAFPAGKFLGRVEIAEVTDAYVKA 595
               GI   +  +C   L+   ++    G++ G+V  + V   Y+++
Sbjct: 671 DFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQS 717

>KLTH0G15752g Chr7 (1373153..1376047) [2895 bp, 964 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 964

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 58/134 (43%), Gaps = 3/134 (2%)

Query: 267 ILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           I W    A++G+   +N    T K  +E +K LP   L  + GL+P   L +       +
Sbjct: 400 IFWAIPVAVVGFISNINFLIETLKF-LEFIKKLPKVLLGLITGLLPTVALAILMSLVPIF 458

Query: 327 GPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILG 386
             +L       + +  ++    ++YA       + IVFTC   A++  KS  + P S + 
Sbjct: 459 IKKLGSISGCMSIQEQELYCQAWYYAFNVVQ--VFIVFTCASSAVSTIKSIMDDPSSAMT 516

Query: 387 SVPSGLKEVGVFHV 400
            + + L +   F++
Sbjct: 517 LLAANLPKSSNFYI 530

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 69/168 (41%), Gaps = 8/168 (4%)

Query: 432 RINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL 491
           +++ Y V  D+ELIA G SN       +      ++ S L  +    +P +G    +  +
Sbjct: 497 QMDKYDV--DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTI 554

Query: 492 LALYCLTGAFFYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVF 550
             +        +IP   + ++I     +LL  +   TWN  K+N  +++  ++ V     
Sbjct: 555 CIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWN--KLNRFEYLTVVIIVFTMGI 612

Query: 551 ASIEDGIYFAMCWSCAMLLL---KVAFPAGKFLGRVEIAEVTDAYVKA 595
                GI   +  +C   L+   K+    G++ G V  + V   YV+ 
Sbjct: 613 FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1150

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 8/168 (4%)

Query: 432 RINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL 491
           +++ Y V  D+ELIA G SNL+   F +      ++ S L  +    T  +GL       
Sbjct: 622 QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTA 679

Query: 492 LALYCLTGAFFYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVF 550
           + L+       +IP   + ++I     +L+  +   TW   K+   ++I  ++ V     
Sbjct: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGI 737

Query: 551 ASIEDGIYFAMCWSCAMLLL---KVAFPAGKFLGRVEIAEVTDAYVKA 595
                GI   +  +C   L+   K+    G+F G V  + V   YV++
Sbjct: 738 YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQS 785

>ZYRO0B11814g Chr2 (940104..940790) [687 bp, 228 aa] {ON} similar to
           uniprot|P26364 Saccharomyces cerevisiae YER170W ADK2
           Mitochondrial adenylate kinase catalyzes the reversible
           synthesis of GTP and AMP from GDP and ADP may serve as a
           back-up for synthesizing GTP or ADP depending on
           metabolic conditions 3' sequence of ADK2 varies with
           strain background
          Length = 228

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 632 SKKIETNVQTKGFASPSSS---IGQPRIKYHTKWLPFD-HKYTRELNPDVHILPPPESVL 687
           +K + TN++  G+ SP ++    G PR     + L  D   Y  ELN  V  L  PESV+
Sbjct: 72  AKLVVTNLKQSGWLSPDATWLLDGFPRTSIQAEILNNDLQNYKAELNLVVE-LDVPESVI 130

Query: 688 VYRLSESYTYLNCSRHYNI 706
           + R+   + ++   R YN+
Sbjct: 131 LERIENRFVHVPSGRVYNL 149

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON}
           similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1010

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 128/625 (20%), Positives = 236/625 (37%), Gaps = 127/625 (20%)

Query: 39  NNENNGVFS-DNDLESNSVANRNAVNDAKGVKGSKIE---------YFDPSDVS------ 82
           +NE +G F  ++ LE  +     AV D   + GS I            D +DVS      
Sbjct: 102 SNEFDGTFEFEDQLEDLAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPP 161

Query: 83  -----LYDNSVSQFEESAVSLKEYY----------NHSIRSH--LTLKGAGDYLKSVFP- 124
                L   S+ +F+   VSL+             N S+R     T +  G+Y+ +V   
Sbjct: 162 NTQRDLEYGSIDEFDHQYVSLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILG 221

Query: 125 -IINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFF 183
            ++N L   ++   I  +     +   L P  +S   ++++ +Q  +YS   G  A+   
Sbjct: 222 LLLNILDALSYGMIIFPITE--PLFSHLGPSGLSMFYMSSVVSQL-VYSC--GFSAFGNA 276

Query: 184 ATSKDVCIGPVAVMSLQTAKVIAEVQAKYP-DGDTTITGPVIATTLA-LLCGIISAAVGF 241
             S+ + I P          + A + A  P + D  +T  ++   ++ ++ G++   +G 
Sbjct: 277 VGSEMIEITPF------YHSMAASIMASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGR 330

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHL-P 300
           L+LG +V     + + G + G  + ++      + G+   V TRA+ ++   E L  L  
Sbjct: 331 LKLGKIVGFFPRHILIGCIGGVGYFLV------ITGFE--VTTRASKFEYSFEFLSSLLT 382

Query: 301 DTKLDAVFGLIPLF--LLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNG 358
           D ++   +GL  L   LL V +  C             KN+    +V  T++ A      
Sbjct: 383 DPEILGKWGLPALMAVLLVVIQRAC-------------KNS----LVLPTFYIAALLLFH 425

Query: 359 IIIIVFTCI--------GWAITRGKSSSE----------RPIS---ILGSVPS--GLKEV 395
            I+ +   +        GW      ++            + +S   +L  VP+   L   
Sbjct: 426 FIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFF 485

Query: 396 GVFHVPSGLMSKXXXXXXXXXXXXXXEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP  + +                 +A+S    +++      D+ELIA G SN L  
Sbjct: 486 GILHVPINVPA-----------------LAMSIGLDKLD-----VDKELIAHGYSNFLSG 523

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
              +      ++ S L  K      L+GL   +     +        YIP   + ++I  
Sbjct: 524 MIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFL 583

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571
              +LL  +   TW   K+N  ++   +  V          GI   +  +C   L+   K
Sbjct: 584 LGYELLKEALVDTWG--KLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTK 641

Query: 572 VAFPAGKFLGRVEIAEVTDAYVKAD 596
           +    G+F G+V  + V   Y++  
Sbjct: 642 LQTINGEFDGQVARSTVRRDYIQTQ 666

>CAGL0I01914g Chr9 (159798..160229) [432 bp, 143 aa] {ON} some
           similarities with uniprot|P17123 Saccharomyces
           cerevisiae YHR152w SPO12
          Length = 143

 Score = 30.8 bits (68), Expect = 6.7,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 28/65 (43%)

Query: 53  SNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTL 112
           SNS  N + V D +G+ GS   Y D S +     ++     +  + K   N  +     +
Sbjct: 20  SNSKTNTDVVTDIQGLDGSDARYTDTSSLDQSQANIFNISSNKTNQKSNTNFCVGKKTKI 79

Query: 113 KGAGD 117
            GAG+
Sbjct: 80  GGAGN 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,279,268
Number of extensions: 4457610
Number of successful extensions: 19311
Number of sequences better than 10.0: 105
Number of HSP's gapped: 19907
Number of HSP's successfully gapped: 125
Length of query: 893
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 774
Effective length of database: 39,836,145
Effective search space: 30833176230
Effective search space used: 30833176230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)