Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1598.266ON29429415780.0
Smik_12.1508.266ON29229412141e-169
Suva_10.1758.266ON29929711931e-166
YLR091W (GEP5)8.266ON29329311821e-164
TDEL0F039308.266ON2802843291e-35
NCAS0B050408.266ON2732802512e-24
NDAI0B020108.266ON2812862451e-23
SAKL0H16940g8.266ON3033032461e-23
Kwal_56.237778.266ON2672472381e-22
ZYRO0C01562g8.266ON2772682353e-22
KAFR0B027408.266ON2562932203e-20
KLTH0G13596g8.266ON2672232124e-19
Kpol_392.48.266ON2812951994e-17
Ecym_43048.266ON2892811562e-11
AGR082C8.266ON2662771553e-11
KLLA0F19228g8.266ON3052211465e-10
KNAG0G020608.266ON2862901377e-09
TPHA0J007608.266ON249107780.18
TBLA0A092405.680ON60038760.47
NOTE: 1 genes in the same pillar as Skud_12.159 were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.159
         (294 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...   612   0.0  
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   472   e-169
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   464   e-166
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   459   e-164
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   131   1e-35
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   101   2e-24
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...    99   1e-23
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...    99   1e-23
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    96   1e-22
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...    95   3e-22
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    89   3e-20
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    86   4e-19
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    81   4e-17
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    65   2e-11
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    64   3e-11
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    61   5e-10
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    57   7e-09
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    35   0.18 
TBLA0A09240 Chr1 (2286122..2287924) [1803 bp, 600 aa] {ON} Anc_5...    34   0.47 

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/294 (100%), Positives = 294/294 (100%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120
           DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120

Query: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180
           LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH
Sbjct: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180

Query: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240
           YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP
Sbjct: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240

Query: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQWN 294
           LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQWN
Sbjct: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQWN 294

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  472 bits (1214), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/294 (76%), Positives = 253/294 (86%), Gaps = 3/294 (1%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           M SR+  +LLP I+S+PLH+ITK AL TTL   QSDYKFKEIAVPLT+ LQV+EKAQRRQ
Sbjct: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120
           DLRT+LKALESII+QTHF+WNNPRPRHALLFQKH++FLL+HWPFENHR LVDSI AH GK
Sbjct: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120

Query: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180
           LNS+ SK TWLKADW TLFQVKN WVQTPP   +P      +LDAFTPER FLVNSLGN 
Sbjct: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPP---TPKNLSETDLDAFTPERAFLVNSLGNQ 177

Query: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240
           YKFL+ANSHLSYNHKKYP P VQIPIRNALGE+S  KQI++LFSRQL  IYTSLF ENPP
Sbjct: 178 YKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPP 237

Query: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQWN 294
           LS  N++ALMA+F+D ++DRR KRLYMRACARAYT  N+DSTIEPLTFRCTQW+
Sbjct: 238 LSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWD 291

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  464 bits (1193), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 232/297 (78%), Positives = 250/297 (84%), Gaps = 4/297 (1%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           M S+   +LLPFI+SLPLH+ITKTALTT L  I SD+KFKEIAVPLTESLQVYEKAQR Q
Sbjct: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120
           DLRTSLKALESI++QTHFQWNNPRPRHA LFQKH++FLLSHWPFENHRSLVDSI A NGK
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120

Query: 121 LNSMASKGTWLKADWTTLFQVKNTWVQT----PPASTSPAYHGGANLDAFTPERTFLVNS 176
           L S+ SKG WLKADWTTLFQVKN WV+T    P  S S A +  A LDAFT ERTFLV S
Sbjct: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKS 180

Query: 177 LGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFV 236
           LGNHYKFLV NSHLSYNHKKYP P VQIPIRNALGE+S  KQI+KLF+RQL QIYTSLFV
Sbjct: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240

Query: 237 ENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQW 293
           ENPPLS  NELALM VF D +L+RRH RLYMRACARAYT  N+DS  EPLTFRCT W
Sbjct: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  459 bits (1182), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 217/293 (74%), Positives = 249/293 (84%), Gaps = 3/293 (1%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           M S++  +LLP IES PLH+ITK ALTTTL   QSDYKFKEIAVPLT+SLQ+YEKAQRRQ
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120
           DLR SLKALESII+QTHFQWNNP PRHA LFQKH++FLL+HWPFENHR LVDSI  +NGK
Sbjct: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120

Query: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180
           LNS +S+  WLKADW TLF VKN WVQTPP   S     G +LD FTPER FL+NSLGNH
Sbjct: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPP---SLMRLSGTDLDTFTPERIFLINSLGNH 177

Query: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240
           YKFL+ANSHLSYNHKKYP P VQIP+RNALGE+S +KQIA+LF+RQL+ IY SLF+ENPP
Sbjct: 178 YKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPP 237

Query: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQW 293
           LS +NELAL AVF+D++++RR +RLYMRACARAYTT N+DST EPL F CT+W
Sbjct: 238 LSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRW 290

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  131 bits (329), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 139/284 (48%), Gaps = 27/284 (9%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           MT ++   LL  +E LPLH  T   L   L G +     K + +PL + +   E + R +
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDE----LKTVIIPLAKLVSNLE-SSRAE 55

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120
             R  +KALESII+ THF W +P P H  +FQ H+  +L HWP+E HRS+++       K
Sbjct: 56  TQR--IKALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNM-----EK 108

Query: 121 LNSMASKGTWLKADWTTLFQV---KNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSL 177
             S + +  W  +  T L      KN W++    S                +R  L +S+
Sbjct: 109 PRSTSLRYRWEDSSKTVLSMAEYSKNPWIEDNILSKK----------LTIIQRDLLFHSV 158

Query: 178 GNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVE 237
            +HY FL AN  L  N +  P P V+IP+R    ++++S+ I  LF  ++   Y  L +E
Sbjct: 159 FSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSR-IKNLFKSKVAHTYRILAIE 217

Query: 238 NPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDS 281
           NP LS  +E  L  +  D S  R+ +RLY  +C RAY     D 
Sbjct: 218 NPVLSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDG 260

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  101 bits (251), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 124/280 (44%), Gaps = 33/280 (11%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           M   +   LL  + ++PLHR T   L   +             VPL + L  YE+   ++
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSL---VDSICAH 117
           D R   K LESI + T+F WNNP P H  +FQK++  L  +WP   HR +    DSI   
Sbjct: 61  DKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGMDTKRDSIIVQ 120

Query: 118 NGKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSL 177
             K N+    G  L         +K T     P +++              E   +   +
Sbjct: 121 WAKSNN----GDAL---------LKGTMNHIQPGASA--------------EELLMFKKI 153

Query: 178 GNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVE 237
             HY FL  N+ ++ N K+  PP V +P+ N++GE     ++  LF ++++    +L   
Sbjct: 154 FQHYIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANALCAL 212

Query: 238 NPPLSADNELALMAVFHDD--SLDRRHKRLYMRACARAYT 275
           NP L+ +N   L  + + D  +  R  +RLY RA   A+ 
Sbjct: 213 NPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHV 252

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score = 99.0 bits (245), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 132/286 (46%), Gaps = 31/286 (10%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLV--GIQSDYKFKEIAVPLTESLQVYEKAQR 58
           + S++   LL  +++LPLH  T   L    +   I++   FK   +PL   +  YEKAQ 
Sbjct: 4   LNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFK---IPLLTLINSYEKAQA 60

Query: 59  RQDLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHN 118
               + S K LESII+ T+F+W N    H   FQ+ +  LL+ WP   H S +DS     
Sbjct: 61  SGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYH-SKIDS----- 114

Query: 119 GKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLV--NS 176
            K NS+    TW K+        KN   +          H          ++ F V    
Sbjct: 115 -KKNSII--LTWNKSS-----NSKNMLREL-------LSHLNYTQSLVPQKKDFQVIFKK 159

Query: 177 LGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFV 236
           +  HY FL  N  L  N K+ P P V+IP+ NA+G     K+I  L   ++ + +  L +
Sbjct: 160 IYQHYIFLSLNPSLCSNGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYLAI 218

Query: 237 ENPPLSADNELALMAVFHDDSL--DRRHKRLYMRACARAYTTVNSD 280
            NP L+ +NE  L  + +  S    R+ ++LY RAC+ +Y   N D
Sbjct: 219 TNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNED 264

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 133/303 (43%), Gaps = 40/303 (13%)

Query: 3   SRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDL 62
           +R+K  LL F+E LPL        T TL  ++   K    A+  T   ++++        
Sbjct: 2   NRVK-TLLNFLECLPLD-------TRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENS- 52

Query: 63  RTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLN 122
               K+LE I++ T+F WNN  P H   F+++++ L  HWP+E HR L+         + 
Sbjct: 53  ----KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIR 108

Query: 123 SMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGA--NLDAFTPER---------- 170
            M +     K   +++   +N W +  P     A++     N  A   E+          
Sbjct: 109 HMWNDNN--KKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLP 166

Query: 171 -------TFLVNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLF 223
                  T L + +  HY FL  N  L    KK P P V+IP++  LG+     +I  LF
Sbjct: 167 KISQLELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMK-PLGQDIPLVRIRNLF 225

Query: 224 SRQLTQIYTSLFVENPPLSADNELALMAVF----HDDSL-DRRHKRLYMRACARAYTTVN 278
            R+    +  L  ENP LS +NE  L+ +     H  S+ +R+ KRLY RAC  +Y    
Sbjct: 226 KRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICE 285

Query: 279 SDS 281
             S
Sbjct: 286 DRS 288

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 96.3 bits (238), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 112/247 (45%), Gaps = 27/247 (10%)

Query: 38  KFKEIAVPLTESLQVYEKAQRRQDLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYF 97
           K  E  +   ESL+  E A R+ + +   K LE+II  T+F W N  P+H   F++H+  
Sbjct: 19  KLIEKRLERAESLRFLELA-RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNE 77

Query: 98  LLSHWPFENHRSLVDSICAHNGKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAY 157
           L   WP+E HR++          L   + K   ++  W+      N  V       S  +
Sbjct: 78  LRDFWPYECHRTI----------LGMQSPKSQSIRFLWSA----GNPRVLAAMRYGSYGW 123

Query: 158 H---GGANLDAFTPERTFLVNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELS 214
           +   GG  L     ERT   + +  H+ FL     L  N K    P V+IP++  LG+  
Sbjct: 124 NREGGGERLTEL--ERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQNI 180

Query: 215 LSKQIAKLFSRQLTQIYTSLFVENPPLSADNELALMAVFHDDSL------DRRHKRLYMR 268
              +I  LF R++  ++  L V+NP LSA+NE  LM +     L       R  KRLY R
Sbjct: 181 ADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQR 240

Query: 269 ACARAYT 275
           AC  AY 
Sbjct: 241 ACRGAYV 247

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 122/268 (45%), Gaps = 30/268 (11%)

Query: 13  IESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRTSLKALESI 72
           I  LPLH  T+  L        S YK   +A  ++E    +EK           K LE++
Sbjct: 17  IRQLPLHIETQKVLE--FYCRNSSYKSLLVAQDISE----FEK-------HNDHKYLEAL 63

Query: 73  IFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMASKGTWLK 132
           I +THF W+NP P     FQ +H  L +HWP+E  RSL+            +   G  L 
Sbjct: 64  IQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELA 123

Query: 133 ADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPER-TFLVNSLGNHYKFLVANSHLS 191
              + L   K+ W                 ++  +PE+ T L++S+ + Y FL +++ L 
Sbjct: 124 L--SNLRFEKHRWADE------------NIIERLSPEQGTQLLHSIFHQYFFLKSHARLC 169

Query: 192 YNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPLSADNELALMA 251
           YN++K P P V+IP+R  +G      +I  LF R+   ++  L  EN PLS  NE  L+ 
Sbjct: 170 YNNRKIPVPIVEIPLR-PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNE-QLLG 227

Query: 252 VFHDDSLDRRHKRLYMRACARAYTTVNS 279
                S  R  +RLY RA  RAY   N 
Sbjct: 228 EIITKSETRSMRRLYQRASRRAYVVTNE 255

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 124/293 (42%), Gaps = 48/293 (16%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           +T  ++  +   IE LPLH+ T   L  TL       +   +A+PL   +  YE   +  
Sbjct: 12  VTKEVRDKITNAIEGLPLHQKTLLQLQDTL------KRNDALAIPLLRDVVSYETTGKS- 64

Query: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120
                 K LESII++ +FQW N  P H       +  L S+WP E H      I   N +
Sbjct: 65  ------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERH------IKFKNAE 112

Query: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180
             +++ +  W++   T +             STS                  ++  + NH
Sbjct: 113 PEAISLRNAWMRNKATAV-----------DLSTSDG----------------VIKPILNH 145

Query: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240
           +++L  N       KK   P +++P+ N  G      ++  L  +++  +  SL  +NP 
Sbjct: 146 FRYLRVNED-RLCKKKVGLPILEVPL-NVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPM 203

Query: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQW 293
           LS   E  L ++ +D    R  KR+Y+R+C+RAYT  ++      +TF    W
Sbjct: 204 LSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSSNITFHIIDW 256

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 103/223 (46%), Gaps = 32/223 (14%)

Query: 65  SLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSM 124
           S K+LESI+  T+F W N    H   F++H+  L  HWP+E HRS+          L+  
Sbjct: 45  SSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSI----------LSMD 94

Query: 125 ASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTP------ERTFLVNSLG 178
             K   ++  W++          +P   +  +Y   A+     P      +RT   + + 
Sbjct: 95  TPKTQSIRFLWSS---------NSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVF 145

Query: 179 NHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVEN 238
            H+ FL +  HL    K    P V+IP++  LG+     ++  LF R++  ++  L +++
Sbjct: 146 QHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALDS 204

Query: 239 PPLSADNELALMAVF------HDDSLDRRHKRLYMRACARAYT 275
           P LS  NEL+L  +        D S  R  KRLY RAC  AYT
Sbjct: 205 PALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYT 247

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 81.3 bits (199), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 134/295 (45%), Gaps = 32/295 (10%)

Query: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60
           +  R+K +LL  +E LPLH+ T   L   +    +D  F E  V +   L  YE ++   
Sbjct: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHV--ADLPFMEEYVGI---LNEYEISKINS 61

Query: 61  DLRTSLKALESIIFQTHFQWNNPR-PRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNG 119
            +    +ALE I+ +TH  WNN + P H   F+ H+  LL HWP+E H  +++      G
Sbjct: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121

Query: 120 KL-----NSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLV 174
            L     N+      + K+      Q+ N W           ++          +R  + 
Sbjct: 122 SLIYLCLNNDDRFFNFYKS------QINNKW-----------FNSVDQYKLTDEQRVSIY 164

Query: 175 NSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSL 234
           N +     FL  ++ +S  +K   P  V++P++  +G    + +I  LF++++  I+  L
Sbjct: 165 NDIFKQIFFLKRHTTISEVNKNMVP-IVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKLL 222

Query: 235 FVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFR 289
            + +P +S  +E  +M +  D   +RR  RLY R+   +Y  V  D+    +T+R
Sbjct: 223 SLSSPAISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSY--VFDDTNPIEITYR 275

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 117/281 (41%), Gaps = 30/281 (10%)

Query: 9   LLPFIESLPLHRITKTALTTTLVGI-QSDYKFKEIAVPLTESLQVYEKAQRRQDLRTSLK 67
           +L  +  LPLH  TK  +   +  + + ++K  ++  P+   L           L   + 
Sbjct: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL-----------LSGEVS 56

Query: 68  ALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLV-------DSI----CA 116
            L  +IF  +F+  NP+  H   F+++   L   WP+E H  L+       DS       
Sbjct: 57  YLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSR 116

Query: 117 HNGKLNSMA--SKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLV 174
           +N K+  +    +  WL+ D    F + + + +          H          ER  L+
Sbjct: 117 NNAKVLDIMRYDRHLWLR-DREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALL 175

Query: 175 NSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSL 234
             + +HY F+ +   L   HK  P P V++ + + LGE     +I  LF ++      +L
Sbjct: 176 KLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFRKRSKATLKTL 233

Query: 235 FVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYT 275
             + PPLS + E  L ++  +   DR   RLY  +C  AYT
Sbjct: 234 LHDFPPLSREVESLLHSIIKE--CDRSMGRLYKWSCNGAYT 272

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/277 (22%), Positives = 117/277 (42%), Gaps = 33/277 (11%)

Query: 12  FIESLPLHRITKTALTTTLVGIQSDYKFKEIAV--PLTESLQVYEKAQRRQDLRTSLKAL 69
            +  LPLHR T   +   L   Q+ Y  + I +  PL + L+           +   + L
Sbjct: 8   IVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR-----------KGGHQGL 56

Query: 70  ESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMASKGT 129
           + ++F  HFQ     P H  L ++H   L   WP+E H SL+         + S + +  
Sbjct: 57  QRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLAL-----SDVRSQSLRRL 111

Query: 130 WLKADWTTLFQV---KNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNHYKFLVA 186
           W       L Q+   ++ W++        A            +R  +++ +   Y FL  
Sbjct: 112 WEDGQEEVLQQMQYCRHHWLREGDVPERYALTQA--------QREEVLHRVFAQYMFLKQ 163

Query: 187 NSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPLSADNE 246
              L ++ ++ P P V+I +   LG      ++  LF  +   +   L+ E+P L+   E
Sbjct: 164 RPAL-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAE 221

Query: 247 LALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTI 283
             ++ +   +   R  +R+Y+RAC RAY  +++D+ +
Sbjct: 222 EDMLRII-AECPTRAMRRIYLRACRRAY-VLDADAQL 256

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 95/221 (42%), Gaps = 16/221 (7%)

Query: 67  KALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMAS 126
           K LE +++  HF   N  P+H  + +++   L   WP+E   S+++    +      + S
Sbjct: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110

Query: 127 KGTWLKADWTTLFQVK----NTWVQTPPASTSPAYHGGANLDAFTPERTF---------L 173
           +      D+ +  + K      W QTP         G   L +                 
Sbjct: 111 RNNKDALDFLSFNRHKWLRPKNW-QTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKET 169

Query: 174 VNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTS 233
           +  +  HY FL  N  L    KK   P V+I ++    +++   +I  LF +++  I   
Sbjct: 170 LRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIA-DIRIDNLFKKKVKLISDL 227

Query: 234 LFVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAY 274
           L+ +NP L++D E  L ++ +D  L+RR KRLY    +R+Y
Sbjct: 228 LYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSY 268

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 115/290 (39%), Gaps = 42/290 (14%)

Query: 5   IKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRT 64
           ++  LL  + SLPLH +T   L+  +   +S  + K +A    E+LQ +      +   T
Sbjct: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVA----ETLQNFHDVPSTKK-HT 58

Query: 65  SLKALESIIFQTHFQWNNP------RPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHN 118
             K L +++ Q + QW+N        P H   F++    L+  WP E+H SL  S   H 
Sbjct: 59  QYKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGH- 117

Query: 119 GKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLG 178
                       LK  W T     N          + A     N++     R  L     
Sbjct: 118 ----------ATLKHAWVT----NNKHALQMSFDAAAANPTSGNIELRGSLRQIL----- 158

Query: 179 NHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVEN 238
           +HY+ L  N  + +   K   P  +IP+ N  GE   + + A L  R++  +   L  E 
Sbjct: 159 SHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRVLIEEL 216

Query: 239 PPLSADNELA-LMAVFHDDS--------LDRRHKRLYMRACARAYTTVNS 279
           P L     +A L A+   D           R+ +RLY RA A  YT  ++
Sbjct: 217 PALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLAST 266

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 6   KGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRTS 65
           K ++L  +  LPLH       T  L+  Q   K  + +  L E L  Y  A   +     
Sbjct: 18  KQIILDGLNRLPLH-----PNTLDLLQKQVHTKLTKNS-ELIELLFDYNNAFINKQKPGQ 71

Query: 66  LKALESIIFQTHFQWNNPRPR--HALLFQKHHYFLLSHWPFENHRSL 110
           LK L+ IIF+TH  +NN      H   F+  + +L  +WP+E H  L
Sbjct: 72  LKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDIL 118

>TBLA0A09240 Chr1 (2286122..2287924) [1803 bp, 600 aa] {ON}
           Anc_5.680 YOR076C
          Length = 600

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%)

Query: 156 AYHGGANLDAFTPERTFLVNSLGNHYKFLVANSHLSYN 193
           A+  G NLD  T E   L  S+G HY  +V N   S N
Sbjct: 279 AFESGFNLDGQTKEHALLARSMGVHYLIIVMNKMDSVN 316

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.132    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,145,213
Number of extensions: 1277386
Number of successful extensions: 3208
Number of sequences better than 10.0: 26
Number of HSP's gapped: 3262
Number of HSP's successfully gapped: 30
Length of query: 294
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 185
Effective length of database: 40,982,805
Effective search space: 7581818925
Effective search space used: 7581818925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)