Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1588.264ON45545520900.0
YLR090W (XDJ1)8.264ON45946117020.0
Smik_12.1498.264ON46046016710.0
Suva_10.1748.264ON45645916610.0
NDAI0B020008.264ON4334277728e-98
SAKL0H16984g8.264ON4354247562e-95
TDEL0F039108.264ON4294177536e-95
NCAS0B050308.264ON4334527502e-94
Kpol_543.408.264ON4144377301e-91
Ecym_43068.264ON4344566953e-86
AGR084C8.264ON4274516761e-83
KLTH0G13640g8.264ON4144386316e-77
KLLA0F19184g8.264ON5124436361e-76
Kwal_56.237828.264ON4143896263e-76
ZYRO0C01606g8.264ON4322935752e-68
TPHA0A017908.264ON4393075752e-68
CAGL0L12276g8.264ON4523124882e-55
KNAG0G020508.264ON4323124531e-50
SAKL0E09306g2.218ON4614123042e-29
KLTH0G08756g2.218ON4623942723e-25
KAFR0A041608.730ON3783722632e-24
KLLA0F03333g2.243ON4092482553e-23
Ecym_32812.243ON4092582511e-22
ADL257C2.243ON4102482492e-22
NDAI0D010302.243ON4112652465e-22
Kpol_1002.1222.218ON5032592485e-22
TBLA0E038102.243ON4102582403e-21
Skud_14.2532.218ON5322452415e-21
Kpol_1003.122.243ON4082582361e-20
KLTH0G09394g2.243ON4112482351e-20
Smik_14.2492.218ON5332662362e-20
NCAS0G028502.218ON4942492352e-20
Kwal_23.48302.243ON4112482314e-20
YNL077W (APJ1)2.218ON5282432335e-20
KNAG0I019002.243ON4092642297e-20
Suva_14.2622.218ON5362462301e-19
YNL064C (YDJ1)2.243ON4092582252e-19
Smik_13.4228.730ON3783672243e-19
KLLA0E07899g2.218ON4953162254e-19
Suva_14.2772.243ON4092582235e-19
TPHA0C031102.243ON4072462226e-19
Smik_14.2632.243ON4092582227e-19
ZYRO0A01496g2.243ON4122442227e-19
Skud_14.2682.243ON4102582219e-19
TDEL0C046002.243ON4112592219e-19
TPHA0C029802.218ON5542362221e-18
KAFR0J009402.243ON4112642155e-18
SAKL0E08734g2.243ON4112582148e-18
ZYRO0C15048g2.218ON4912612122e-17
CAGL0J09966g2.243ON4072582093e-17
AER427W2.218ON4702852086e-17
NCAS0G030002.243ON4102482059e-17
TDEL0C043502.218ON4622482051e-16
KNAG0M020202.218ON4602472032e-16
Ecym_53842.218ON5032441999e-16
TBLA0E036602.218ON4482411962e-15
CAGL0J10296g2.218ON4792591962e-15
NDAI0F024502.218ON5302621962e-15
Kwal_23.30612.218ON4582471821e-13
KLLA0C07260g8.730ON3682471773e-13
Kpol_1064.408.730ON3872401748e-13
Kwal_26.90248.730ON3752411731e-12
TPHA0G006308.730ON3932371684e-12
CAGL0H03707g1.398ON349711674e-12
NDAI0G042501.398ON363711631e-11
YNL007C (SIS1)1.398ON352711622e-11
SAKL0D08778g1.398ON348711612e-11
Suva_14.3411.398ON359711613e-11
SAKL0H05258g8.730ON3682431604e-11
Kwal_0.2071.398ON353711604e-11
NDAI0C026101.398ON340711594e-11
TPHA0B037601.398ON355711604e-11
NDAI0E008708.730ON3762331587e-11
TBLA0B034908.730ON3842431588e-11
KAFR0H031501.398ON359711561e-10
ZYRO0E04598g1.398ON357711561e-10
AAL008W1.398ON349711551e-10
TBLA0C014801.398ON353711542e-10
KLTH0H12100g1.398ON350711542e-10
NCAS0C048901.398ON367711542e-10
NCAS0G036101.398ON327711542e-10
Kpol_457.151.398ON357671542e-10
KLLA0D04818g1.398ON354711542e-10
TDEL0B059601.398ON369711533e-10
Smik_14.3211.398ON366711533e-10
Skud_14.3201.398ON368711533e-10
Suva_13.3978.730ON375661524e-10
KNAG0H016801.398ON363711515e-10
Ecym_12921.398ON347711481e-09
CAGL0F03729g8.730ON361661471e-09
KNAG0G028808.730ON378661472e-09
NCAS0B005308.730ON375661472e-09
ZYRO0A06226g8.730ON377661462e-09
YMR214W (SCJ1)8.730ON377661462e-09
KLTH0A03740g7.217ON395711462e-09
AER346W8.730ON367661453e-09
Ecym_62368.730ON374671453e-09
TDEL0B037908.730ON373661443e-09
KLTH0D12496g8.730ON375661444e-09
TBLA0D042407.217ON389661427e-09
Ecym_43727.217ON579691438e-09
TDEL0H022907.217ON387711392e-08
Skud_13.3838.730ON375661373e-08
TPHA0C012607.217ON380711373e-08
NDAI0E045607.217ON394711364e-08
NCAS0E029307.217ON387661364e-08
Kwal_47.181337.217ON393711364e-08
TPHA0C045902.350ON233651325e-08
KLLA0E04423g7.217ON428711356e-08
CAGL0J02750g7.217ON382711346e-08
ZYRO0F15400g2.15ON525641357e-08
Kpol_526.62.350ON228651308e-08
YMR161W (HLJ1)2.350ON224651309e-08
Kpol_1070.227.217ON380711339e-08
YNL227C (JJJ1)2.15ON590641331e-07
Suva_12.1851.113ON168641261e-07
Skud_5.1587.217ON391711321e-07
Smik_14.1062.15ON593641331e-07
Suva_8.3038.698ON664691331e-07
KNAG0B052401.297ON668661331e-07
AFR507W8.61ON474661312e-07
NDAI0F038002.15ON638661322e-07
KLTH0F09944g2.350ON233651272e-07
YFL016C (MDJ1)8.61ON5112321312e-07
SAKL0F08052g7.217ON393721302e-07
CAGL0J07370g2.15ON623661312e-07
TDEL0G028002.350ON225651272e-07
KAFR0A016201.297ON665701312e-07
TBLA0E024907.217ON366661293e-07
ZYRO0A07502g2.350ON238671263e-07
Kpol_1072.48.698ON661691303e-07
TPHA0D005508.61ON486661293e-07
TPHA0G014808.698ON660701303e-07
TDEL0E005002.15ON581641303e-07
Smik_13.3612.350ON224651253e-07
Suva_6.448.61ON5072311294e-07
Skud_13.3232.350ON224651254e-07
SAKL0D06226g1.297ON615671294e-07
NCAS0D009602.350ON224651244e-07
KNAG0L013307.217ON396711274e-07
Smik_5.1737.217ON391661274e-07
TBLA0G001702.15ON659641294e-07
YER048C (CAJ1)7.217ON391711275e-07
Kpol_529.212.15ON622661286e-07
Smik_15.4378.698ON663691286e-07
Skud_15.4208.698ON665661286e-07
KNAG0G011308.61ON500641276e-07
NCAS0G013602.15ON616661277e-07
TBLA0C027201.297ON715711277e-07
Smik_6.638.61ON5102081268e-07
TPHA0L007907.157ON446661268e-07
Kwal_23.3578singletonOFF85671149e-07
YOR254C (SEC63)8.698ON663691261e-06
AFR639W1.113ON156641181e-06
KNAG0F008602.15ON626661251e-06
NDAI0D005001.113ON190701201e-06
NCAS0A093201.297ON635711251e-06
Suva_14.1162.15ON600661251e-06
Skud_10.3191.113ON168641181e-06
KLLA0C09823g8.698ON669731251e-06
KNAG0I007407.157ON425661241e-06
Suva_13.3402.350ON225651201e-06
KLLA0D06402g1.297ON631661241e-06
Skud_14.1102.15ON596661241e-06
Kwal_23.44202.15ON592641242e-06
KAFR0A079502.15ON551641232e-06
NDAI0H031802.350ON229651202e-06
ABL194C2.15ON552661232e-06
TBLA0J018707.157ON470661232e-06
SAKL0E14234g2.15ON678661232e-06
CAGL0L00957g7.217ON373701212e-06
KNAG0I008602.350ON219651182e-06
TBLA0J009701.185ON586641223e-06
NCAS0C039508.61ON5191971213e-06
SAKL0E06050g2.350ON232651183e-06
Kpol_1027.131.297ON641661213e-06
KLTH0B08338g2.15ON590661213e-06
ZYRO0D16390g7.217ON398711204e-06
ADR124C1.297ON611681214e-06
NCAS0C012208.698ON669691214e-06
Skud_6.568.61ON5172081204e-06
Smik_9.2037.157ON432661204e-06
CAGL0H04499g2.350ON232651174e-06
Suva_5.1507.217ON391661204e-06
KAFR0L007407.217ON364711194e-06
ADR015W7.157ON436661204e-06
Kwal_14.24521.297ON607661204e-06
KAFR0B048902.350ON220651165e-06
TBLA0A011007.157ON434701195e-06
KLLA0D19602g2.15ON620661205e-06
TPHA0O019402.15ON598641205e-06
KAFR0H023108.698ON655691196e-06
ZYRO0D10934g8.698ON663691197e-06
TPHA0A028101.185ON492651188e-06
CAGL0H02827g1.297ON656771188e-06
CAGL0C04565g1.113ON175681129e-06
Ecym_56262.350ON243651149e-06
Smik_10.3851.113ON172641129e-06
SAKL0C03476g1.113ON165701119e-06
TBLA0B093802.350ON227651141e-05
KNAG0J018408.698ON650691171e-05
Smik_10.1681.297ON649671171e-05
Suva_9.2137.157ON431661161e-05
Skud_9.1817.157ON421701161e-05
KLLA0E01629g2.350ON231651131e-05
KLTH0H10032g1.297ON607661162e-05
KLLA0D13464g7.157ON433661152e-05
TBLA0D026008.61ON5102421152e-05
Ecym_11101.113ON156651092e-05
SAKL0F04444g7.157ON429661142e-05
ZYRO0F15972g1.113ON162641092e-05
ZYRO0G21230g1.297ON584671152e-05
CAGL0G07469g8.698ON668691152e-05
TDEL0A064308.698ON666731152e-05
NDAI0C002001.92ON276591113e-05
TBLA0B037308.698ON693691133e-05
YIR004W (DJP1)7.157ON432661124e-05
KAFR0B047807.157ON423641124e-05
TDEL0H032107.157ON411701124e-05
Ecym_14508.61ON492661124e-05
KLTH0F03124g1.113ON162641064e-05
NDAI0A028207.157ON482661124e-05
SAKL0H05984g8.698ON658661124e-05
AFL190C2.350ON235721085e-05
YJL073W (JEM1)1.297ON645681115e-05
Skud_10.1691.297ON644671116e-05
KLTH0D11770g8.698ON652691116e-05
Suva_6.1481.297ON642681117e-05
NCAS0A132107.157ON414661098e-05
ADL111W7.217ON578631108e-05
YJR097W (JJJ3)1.113ON172641049e-05
Ecym_44697.157ON433661081e-04
SAKL0C02904g1.92ON281781071e-04
TPHA0B041901.113ON168641031e-04
SAKL0B01276gna 1ON292551061e-04
Ecym_63181.297ON624671081e-04
CAGL0J01936g7.157ON425661071e-04
KNAG0C024501.185ON544641072e-04
ZYRO0G03850g7.157ON418641062e-04
NCAS0H005501.113ON174801022e-04
ZYRO0C01210g5.4ON433681062e-04
Kwal_26.88798.698ON656691072e-04
Kwal_33.138601.185ON578651062e-04
TDEL0C008708.61ON4702161062e-04
TDEL0C058801.113ON159641012e-04
KAFR0F018101.185ON555681062e-04
KLTH0F13398g7.157ON419661052e-04
Kwal_33.135331.113ON161701003e-04
TDEL0D016401.297ON604661053e-04
KLTH0B09570g5.4ON428741043e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.158
         (455 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   809   0.0  
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   660   0.0  
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   648   0.0  
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   644   0.0  
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    301   8e-98
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   295   2e-95
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   294   6e-95
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    293   2e-94
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   285   1e-91
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   272   3e-86
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   265   1e-83
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   247   6e-77
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   249   1e-76
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   245   3e-76
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   226   2e-68
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   226   2e-68
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   192   2e-55
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   179   1e-50
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   121   2e-29
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   109   3e-25
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   105   2e-24
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   102   3e-23
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   101   1e-22
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   100   2e-22
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...    99   5e-22
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   100   5e-22
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...    97   3e-21
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    97   5e-21
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...    96   1e-20
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    95   1e-20
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    96   2e-20
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     95   2e-20
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...    94   4e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    94   5e-20
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    93   7e-20
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    93   1e-19
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...    91   2e-19
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    91   3e-19
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    91   4e-19
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    91   5e-19
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...    90   6e-19
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...    90   7e-19
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...    90   7e-19
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...    90   9e-19
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...    90   9e-19
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    90   1e-18
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...    87   5e-18
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    87   8e-18
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    86   2e-17
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...    85   3e-17
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    85   6e-17
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...    84   9e-17
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    84   1e-16
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    83   2e-16
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    81   9e-16
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    80   2e-15
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    80   2e-15
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    80   2e-15
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    75   1e-13
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    73   3e-13
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    72   8e-13
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    71   1e-12
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    69   4e-12
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    69   4e-12
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    67   1e-11
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    67   2e-11
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    67   2e-11
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    67   3e-11
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    66   4e-11
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    66   4e-11
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               66   4e-11
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    66   4e-11
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    65   7e-11
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    65   8e-11
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    65   1e-10
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    65   1e-10
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    64   1e-10
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    64   2e-10
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    64   2e-10
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     64   2e-10
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      64   2e-10
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    64   2e-10
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    64   2e-10
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    64   3e-10
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    64   3e-10
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    64   3e-10
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    63   4e-10
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    63   5e-10
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    62   1e-09
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    61   1e-09
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    61   2e-09
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       61   2e-09
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    61   2e-09
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    61   2e-09
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    61   2e-09
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    60   3e-09
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    60   3e-09
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    60   3e-09
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    60   4e-09
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    59   7e-09
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    60   8e-09
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    58   2e-08
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    57   3e-08
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    57   3e-08
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             57   4e-08
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     57   4e-08
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    57   4e-08
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    55   5e-08
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    57   6e-08
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    56   6e-08
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    57   7e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    55   8e-08
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    55   9e-08
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    56   9e-08
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    56   1e-07
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    53   1e-07
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    55   1e-07
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    56   1e-07
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    56   1e-07
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    56   1e-07
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    55   2e-07
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      55   2e-07
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    54   2e-07
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    55   2e-07
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    55   2e-07
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    55   2e-07
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    54   2e-07
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    55   2e-07
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    54   3e-07
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    53   3e-07
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    55   3e-07
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    54   3e-07
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    55   3e-07
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    55   3e-07
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    53   3e-07
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    54   4e-07
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    53   4e-07
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    54   4e-07
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    52   4e-07
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    54   4e-07
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    54   4e-07
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    54   4e-07
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    54   5e-07
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    54   6e-07
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    54   6e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    54   6e-07
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    54   6e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    54   7e-07
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    54   7e-07
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    53   8e-07
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    53   8e-07
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    49   9e-07
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    53   1e-06
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    50   1e-06
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    53   1e-06
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    51   1e-06
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    53   1e-06
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    53   1e-06
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    50   1e-06
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    53   1e-06
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    52   1e-06
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    51   1e-06
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    52   1e-06
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    52   1e-06
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    52   2e-06
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    52   2e-06
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      51   2e-06
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    52   2e-06
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    52   2e-06
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    52   2e-06
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    51   2e-06
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    50   2e-06
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    52   3e-06
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    51   3e-06
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    50   3e-06
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    51   3e-06
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    51   3e-06
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    51   4e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    51   4e-06
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     51   4e-06
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    51   4e-06
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    51   4e-06
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    50   4e-06
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    51   4e-06
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    50   4e-06
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    51   4e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    51   4e-06
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    49   5e-06
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    50   5e-06
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    51   5e-06
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    51   5e-06
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    50   6e-06
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    50   7e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    50   8e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    50   8e-06
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    48   9e-06
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    49   9e-06
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    48   9e-06
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    47   9e-06
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    49   1e-05
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    50   1e-05
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    50   1e-05
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    49   1e-05
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    49   1e-05
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    48   1e-05
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    49   2e-05
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    49   2e-05
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    49   2e-05
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    47   2e-05
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    49   2e-05
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    47   2e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    49   2e-05
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    49   2e-05
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    49   2e-05
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         47   3e-05
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    48   3e-05
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    48   4e-05
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               48   4e-05
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    48   4e-05
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    48   4e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    45   4e-05
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    48   4e-05
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    48   4e-05
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    46   5e-05
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    47   5e-05
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    47   6e-05
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    47   6e-05
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    47   7e-05
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    47   8e-05
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    47   8e-05
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    45   9e-05
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    46   1e-04
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    46   1e-04
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    44   1e-04
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    45   1e-04
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    46   1e-04
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    46   1e-04
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    46   2e-04
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    45   2e-04
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    44   2e-04
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    45   2e-04
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    46   2e-04
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    45   2e-04
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    45   2e-04
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    44   2e-04
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    45   2e-04
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    45   2e-04
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    43   3e-04
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    45   3e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    45   3e-04
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    45   4e-04
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    44   4e-04
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    44   4e-04
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    45   4e-04
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    43   4e-04
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    44   5e-04
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    44   5e-04
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    44   5e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    44   5e-04
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    44   6e-04
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    42   6e-04
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    44   6e-04
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    44   6e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    44   6e-04
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    44   6e-04
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    42   6e-04
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    42   7e-04
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    43   8e-04
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    43   0.001
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    43   0.001
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    43   0.001
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    43   0.001
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    43   0.001
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    43   0.001
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    43   0.001
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    43   0.001
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    43   0.001
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    43   0.002
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    43   0.002
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    42   0.002
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    43   0.002
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    42   0.002
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    41   0.002
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    42   0.002
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    42   0.002
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    42   0.003
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    42   0.003
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    41   0.003
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    42   0.004
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    41   0.004
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    41   0.005
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    40   0.005
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    41   0.006
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    41   0.006
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    41   0.006
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    41   0.006
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    40   0.007
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    40   0.008
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    40   0.008
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    40   0.008
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    40   0.008
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    40   0.009
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    40   0.009
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    40   0.009
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    40   0.010
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    40   0.010
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    40   0.013
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    39   0.017
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    38   0.021
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    39   0.024
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    39   0.025
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    39   0.028
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       39   0.033
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    38   0.034
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    38   0.041
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    38   0.044
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    37   0.057
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    37   0.064
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    37   0.065
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.071
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    37   0.083
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    37   0.11 
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    36   0.12 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    36   0.12 
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    36   0.14 
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    35   0.22 
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    34   0.51 
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    34   0.57 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    34   0.69 
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    33   1.1  
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    33   1.1  
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    33   1.2  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   1.6  
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    33   1.8  
Smik_13.51 Chr13 complement(93473..95053) [1581 bp, 526 aa] {ON}...    33   2.3  
KLTH0A00726g Chr1 complement(72979..77517) [4539 bp, 1512 aa] {O...    33   2.5  
Kwal_47.17451 s47 complement(406047..406607) [561 bp, 186 aa] {O...    31   3.5  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    32   3.6  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    32   3.8  
CAGL0A00297g Chr1 complement(30179..30775) [597 bp, 198 aa] {ON}...    31   4.4  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    31   4.5  
CAGL0K09416g Chr11 complement(931067..932143) [1077 bp, 358 aa] ...    32   4.6  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    31   5.1  
Kpol_1025.42 s1025 (112594..113172) [579 bp, 192 aa] {ON} (11259...    31   5.2  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    30   5.6  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    30   6.2  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    31   6.3  
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    31   6.4  
TDEL0F02440 Chr6 (455229..455807) [579 bp, 192 aa] {ON} Anc_4.10...    30   7.2  
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    31   7.5  
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    30   8.7  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    30   9.3  
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    30   9.7  

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/455 (87%), Positives = 398/455 (87%)

Query: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60
           MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA
Sbjct: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKM 120
           YEILSDPEKKSHYDLY                                      SNEYKM
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKM 120

Query: 121 YEDNXXXXXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180
           YEDN             LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE
Sbjct: 121 YEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240
           CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240

Query: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300
           EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN
Sbjct: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300

Query: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360
           MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD
Sbjct: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360

Query: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNF 420
           ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLP      CASGDANDLINNETVSNF
Sbjct: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNF 420

Query: 421 QIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455
           QIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ
Sbjct: 421 QIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/461 (69%), Positives = 359/461 (77%), Gaps = 8/461 (1%)

Query: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60
           MS SDR +RLY VLGVTRDA VQEIKTAYRKLALKHHPDKYVDQDSK+VNEIKFKEITAA
Sbjct: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKM 120
           YEILSDPEKKSHYDLY                                        EY  
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDA 120

Query: 121 YEDNXXXXXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180
           YE+              LT+KDLYMGKKL+FDLKRQV+C+KCHGSGWK K+++HVTH+VE
Sbjct: 121 YEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240
           CESC GKGSKERLKRFGPGLVASQWV+CEKC+GKGKY K PKNPKNFCPDCAG+GL SKK
Sbjct: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240

Query: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300
           E+ITV VAPGHHFNDVIT++GMADEEI K  CGDL+FHL E+QE+   KQ+FLKNF DG 
Sbjct: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300

Query: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360
            ED Y S+TISLSEALTGFEKFLTKTFDDRLLTLS+KPGRV+RPGD +KI NEGWPILD+
Sbjct: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360

Query: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASG------DANDLINN 414
             GRCGDLYVF+HIEFPPDNWFNEKSELL IKTNLP      CAS       D ++L NN
Sbjct: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLP--SSSSCASHATVNTEDDSNLTNN 418

Query: 415 ETVSNFQIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455
           ET+SNF+IIHTDDLPEG++ FKP+ Q+ AH+KARS+YC +Q
Sbjct: 419 ETISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/460 (69%), Positives = 356/460 (77%), Gaps = 5/460 (1%)

Query: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60
           MS SDR  +LY VLGVT DA VQEIKTAYRKLALKHHPDKYVDQ+SK+VNEIKFKEITAA
Sbjct: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKM 120
           YEILSDPEKKSHYDLY                                        EY  
Sbjct: 61  YEILSDPEKKSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDT 120

Query: 121 YEDNXXXXXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180
           YE++             LT+KDLYMGKKL+F+LKRQ+VCM CHGSGWK KK++HVTHEVE
Sbjct: 121 YEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240
           CESCGGKGSKERLKRFGPGLVASQWV CEKCHGKGKY K PKNPKNFCPDCAGVGLQSKK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240

Query: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300
           E+ITV VAPGHHFNDVITI+GMADEE+ K+ACGDL+FHL E+QE+   KQ+FLKNF +G+
Sbjct: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300

Query: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360
            ED Y S TISLSEALTGFEKFLT+TFDDRLLTLSIKPGRVIRPGDV+KITNEGWPI+DD
Sbjct: 301 AEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDD 360

Query: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASG-----DANDLINNE 415
            RG+ GDLYVFIHIEFPPDNWFNEKSELL IKT LP        +      D  + INNE
Sbjct: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420

Query: 416 TVSNFQIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455
           T+SNFQII+ ++LPEG+K F  + QN AH+KA+S+YCPMQ
Sbjct: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/459 (68%), Positives = 351/459 (76%), Gaps = 7/459 (1%)

Query: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60
           MS SD  +RLY VLGVTR+A VQEIKTAYRKLALKHHPDK VDQDSK++NE KFKEITAA
Sbjct: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKM 120
           YEILSDPEKKSHYDLY                                       NE++M
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDF---PNEHEM 117

Query: 121 YEDNXXXXXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180
           YE N              TMKDLYMGKKL+F+LKRQ++C KC GSGWK KK+VHVTHE+E
Sbjct: 118 YEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240
           CESCGGKGSKERLKRFGPGLVASQWV+CEKCHGKGKY K PKN KNFCPDC  VGLQ KK
Sbjct: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237

Query: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300
           EVITV V PGHHFNDV+T++GMADEEI KA CGDL FHL E+ ED   KQV +K FG GN
Sbjct: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297

Query: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360
           ++D YVS+T+SLSEALTGFEKFLT+TFDDRLLTLSIKPG+VIRPGD++KITNEGWPILD 
Sbjct: 298 LQDLYVSITVSLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDH 357

Query: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXX----XXCASGDANDLINNET 416
            RG+CGDLYVF+ IEFPPDNWFNEKSELL IKT+LP            +G  N  IN+ET
Sbjct: 358 PRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSET 417

Query: 417 VSNFQIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455
           VSNFQIIH+DDLPEG+KTF PKPQ  AH+KA S+YCPMQ
Sbjct: 418 VSNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  301 bits (772), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 174/427 (40%), Positives = 242/427 (56%), Gaps = 31/427 (7%)

Query: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           LY +LGVT  A   EIK AYRKLAL++HPDK +D + ++ NEIKFKEIT+AYEILSD EK
Sbjct: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYE-DNXXXX 128
           ++HYDLY                                        +Y  Y  DN    
Sbjct: 64  RAHYDLYGDANENEYNNQNANDFFNFETDQP----------------DYDSYAFDNDKSK 107

Query: 129 XXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVT--HEVECESCGG 186
                    L++++LY GK  +F  KR ++C++C G GW+ +K  +VT  HE+EC+ C G
Sbjct: 108 DVKIPLK--LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNG 165

Query: 187 KGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVI 246
            G KER +   PG V +  + CE CHGKG+    P + KN C +C G GL S+ + + V 
Sbjct: 166 LGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVS 225

Query: 247 VAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYV 306
           V  G    D I IE  AD+EIGK+  GD+   + E  +      V     G     D  +
Sbjct: 226 VPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEE--DTTMPSDVHFIRKG----TDFVM 279

Query: 307 SVTISLSEALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRC 365
            +++SL+EALTGF +KFL+K+ D R+LTLS+  G+VIRPG+++KI  EGWP+   A  + 
Sbjct: 280 YLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQA-SKF 338

Query: 366 GDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQIIHT 425
           GDLYV I IEFPPDNWF+EKS++  ++  LP        S   +D +N ETV+ F I+  
Sbjct: 339 GDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL-- 396

Query: 426 DDLPEGV 432
           ++LP+ +
Sbjct: 397 EELPDTL 403

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  295 bits (756), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 173/424 (40%), Positives = 238/424 (56%), Gaps = 18/424 (4%)

Query: 8   NRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDP 67
            +LY VLGV  DA   EIK AYRKLAL+HHPDK  D+  ++ +E+KFKEITAAYEILSD 
Sbjct: 2   TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61

Query: 68  EKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXX 127
           + +  YD+Y                                        +    E+N   
Sbjct: 62  DSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDE---PRQPYPEEENRSV 118

Query: 128 XXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGK 187
                     L+MK+LY GK  +F  KR V+C +C GSG + K + H    V C+SC G 
Sbjct: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178

Query: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247
           G KER+KR   G V  + V CE+C+GKG  R +P  P++ C  C G  + S+++ +TV +
Sbjct: 179 GHKERIKRVAQGFVIRETVKCERCNGKG--RTTPTKPEDHCKKCHGKCVISEEKTLTVYI 236

Query: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307
             G    D++ +EG AD+E  K   GDL F + E  E        L+  GD    D +  
Sbjct: 237 PRGSRNGDIVKLEGEADQEPDKVT-GDLLFVIEENPE----TSTNLERRGD----DLHTR 287

Query: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367
           + ISLSEA+TGFEK +T T DDR+L L I  G+VIRPG+ +++ NEGWP LDD+  + GD
Sbjct: 288 LKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKFGD 346

Query: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQIIHT-D 426
           +YV +HIEFPPDNWF+EKS++  ++T LP       A  D  DL N ETV ++ ++ + D
Sbjct: 347 MYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNARVA--DTGDLNNTETVIDYSVVKSAD 404

Query: 427 DLPE 430
           +LP+
Sbjct: 405 ELPD 408

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  294 bits (753), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 165/417 (39%), Positives = 228/417 (54%), Gaps = 21/417 (5%)

Query: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           LY +LGV  DA   EIK AYRK AL+HHPDK  D+  ++ +E++FKEI AAYE+L D EK
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXXXX 129
           ++ YD Y                                       N Y  Y +      
Sbjct: 64  RARYDKYGDADGSDFFNGPNEFEDAAFMNFFHSFGSNP-------QNAYDHYGEQKVDRS 116

Query: 130 XXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTH--EVECESCGGK 187
                   ++M D Y GK  +F  KR +VC +C GSGW+ ++  HV    +VEC+ CGG+
Sbjct: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGGQ 175

Query: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247
           G K+R++R  PG   ++ + C  C GKGK    P N KN C  C G G+ ++ + +TV +
Sbjct: 176 GFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSL 235

Query: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307
             G   +D I ++G AD+E+GK+  G+L F + E  E    + V L+  G     D    
Sbjct: 236 PRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTE--CPEGVDLQRHG----FDLITH 289

Query: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367
           +T+SL+EA+TGF K LTKT D R+L L I PG+VIRPG++++I +EGWPI        GD
Sbjct: 290 LTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSGD 346

Query: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQIIH 424
           LYV +HIEFPPDNWF+E+S+L  +K  LP       A  D  D  N ETV+N  I+ 
Sbjct: 347 LYVVVHIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVED--DPGNTETVTNINIVE 401

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  293 bits (750), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/452 (40%), Positives = 247/452 (54%), Gaps = 33/452 (7%)

Query: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKD--VNEIKFKEITAAYEILSDP 67
           LY VLGV  +A   +IK AYRKLAL+HHPDK V+ +S D   +EIKFKEI+AAYEILSD 
Sbjct: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63

Query: 68  EKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXX 127
           +K++HYDLY                                          + YED    
Sbjct: 64  DKRAHYDLYGSEEEQQRQQRQYDPFESFFNFEQDEEPS-------------RHYED--PK 108

Query: 128 XXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK--RVHVTHEVECESCG 185
                     +T+++LY GK  +F  KR V+C  C G GW+ +K  +V V  EVEC+ C 
Sbjct: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168

Query: 186 GKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITV 245
           G+G  E+++   PG    +   C++C GKGK+     + KN C  C G GL ++ +V+TV
Sbjct: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228

Query: 246 IVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSY 305
            V  G    D I +   AD+E+GK   GDL F + E Q     K V L+  G   M    
Sbjct: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQR--CPKDVQLERKGSNFM---- 282

Query: 306 VSVTISLSEALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGR 364
             + ISL+EALTGF +KF+TKTFD R+L LSI PG+VIRPG+++KI  EGWP+  +A  +
Sbjct: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEAT-K 341

Query: 365 CGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQIIH 424
            GDLY+ ++IEFPPDNWF EKS+L  IK  LP          D  D +N E +  F+++ 
Sbjct: 342 FGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSD--DPLNTELLLKFEVLE 399

Query: 425 TDDLPEGVKTFKPKPQNPA--HKKARSAYCPM 454
           T  LP+ +K  + + +N A  H + R    P 
Sbjct: 400 T--LPDTLKEGQDQGENNAESHGEYRGEGSPQ 429

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  285 bits (730), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 169/437 (38%), Positives = 234/437 (53%), Gaps = 44/437 (10%)

Query: 1   MSDSDRNNR---LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEI 57
           MSD+D ++     Y +LGV  DA  +EIK  YRKLAL++HPDK +D+  K +NEIKFK+I
Sbjct: 1   MSDTDGSSEDRDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDI 60

Query: 58  TAAYEILSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNE 117
           TAAY+ LSD +K++ YD                                        +N 
Sbjct: 61  TAAYQTLSDEDKRNEYD--------------------------NKKNFEPYFESDFANNH 94

Query: 118 YKMYEDNXXXXXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK--RVHV 175
              Y                L   +LY GK ++F+  R  +C  C+G GW+TKK  + +V
Sbjct: 95  DGNYNSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYV 154

Query: 176 THEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVG 235
             E+EC+ C G+G K    +  PG   +Q V+C  C G GKY K P +PKNFC DC G  
Sbjct: 155 PPEIECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKC 214

Query: 236 LQSKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKN 295
           L    + I V +  G    D I ++G ADEE+GK   GDL F +NE           L+ 
Sbjct: 215 LIKIDDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE----IIDSNNDLER 270

Query: 296 FGDGNMEDSYVSVTISLSEALTGFE-KFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEG 354
           +G+  +  ++    ISL+EA+TGFE KF+ KTFDDR L LS   G+VIRPGD+L++ NEG
Sbjct: 271 YGNHLINHTH----ISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEG 326

Query: 355 WPILDDARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINN 414
           WP +D      G+LYV + IEFPPDNW NEK++++ I+  LP          +  D IN+
Sbjct: 327 WP-MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILP---NEKTKRNNIVDPINS 382

Query: 415 ETVSNFQIIHTDDLPEG 431
           E +S F+I+ +    EG
Sbjct: 383 EYISTFEIVKSLPQEEG 399

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  272 bits (695), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 239/456 (52%), Gaps = 36/456 (7%)

Query: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           LY VLG+  +A  QE+K AYR LAL +HPDK  D+  +  +E KFKEI+AAY+ILSD +K
Sbjct: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXXXX 129
           +S YD Y                                      +  Y  YED      
Sbjct: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYG-------AGRYGQYEDAEQKTS 117

Query: 130 XXXXXXX---XLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGG 186
                      L+ K LY+GK  +F LKR V+C KC G G +  KR      ++C  C G
Sbjct: 118 QKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLR--KRAAHCMPMKCGICDG 175

Query: 187 KGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVI 246
           +G KER+ R  PG ++ + V C++C GKG      ++P + C  C G  +  +  ++T+ 
Sbjct: 176 RGFKERVSRISPGFISRERVPCDECDGKGTV--VSRDPSDNCKKCHGKCVIVENSILTLY 233

Query: 247 VAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNME---- 302
           V  GH   D I I+G AD E GK   GDL F ++E  +             D  +E    
Sbjct: 234 VPRGHRHADTIRIDGQADMEAGKET-GDLVFEIDEITDP------------DAELERKGT 280

Query: 303 DSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDAR 362
           D + S+TISL+EALTGF + + +TFDDRLL ++I  G+V+RPG+ LK TNEGWPI + + 
Sbjct: 281 DLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGS- 339

Query: 363 GRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCA-SGDANDLINNETVSNFQ 421
            R GDLYV ++IEFP DNW NEKSEL  IK  LP       +  GD +D  N E ++++ 
Sbjct: 340 -RFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYY 398

Query: 422 IIH-TDDLPEGVKTFKPKPQNPAHKKARSAY-CPMQ 455
           +I  +  LP+ +     +  N  + +  +A  CP+Q
Sbjct: 399 VIQDSSRLPDYLAQEGQQRSNQQYGERNTASECPVQ 434

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  265 bits (676), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/451 (37%), Positives = 234/451 (51%), Gaps = 33/451 (7%)

Query: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           LY VLG+   A  QE+K AYR+LAL++HPDK  D+  ++ +E KFKEI+AAY +LSD +K
Sbjct: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXXXX 129
           ++ YD +                                       + Y+  ED+     
Sbjct: 65  RAEYDQF----------GTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVG 114

Query: 130 XXXXXXXXL--TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGK 187
                   L  T K LY+GK  +F  +R+V+C +C GSG   +KR      + CE C G+
Sbjct: 115 RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGL--RKRAAARPMIRCEGCEGQ 172

Query: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247
           G KER+ R GPGL++ + V C  C GKGK  + P    + C  C G  +  ++ +I+V V
Sbjct: 173 GYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVYV 230

Query: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307
             G    D +   G +D E GK   GDL F ++E        Q  + +  +    D Y +
Sbjct: 231 PRGSQHGDRLRYPGQSDMEPGKET-GDLVFVIDE--------QTDVSSSLERKGTDLYCT 281

Query: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367
           + ISL+EALTGF + +T+TFD+R+L ++I  G+V+RPG+ LK TNEGWPI D A  R GD
Sbjct: 282 MKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA--RFGD 339

Query: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQII--HT 425
           +YV + IEFP DNWFNEK+EL  I+  LP        S    D  N E V  + II  HT
Sbjct: 340 MYVQVLIEFPKDNWFNEKAELDAIRNILP--GLADAPSTKTEDPSNTEEVRAYSIIANHT 397

Query: 426 DDLPEGVKTFKPKPQNPAHKK-ARSAYCPMQ 455
             LP+ +           H+  A +  CPMQ
Sbjct: 398 -GLPDYLDRENQGYSRQQHESTAGTPECPMQ 427

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  247 bits (631), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 160/438 (36%), Positives = 220/438 (50%), Gaps = 39/438 (8%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV  DA   EIK AYR+LAL+HHPDK  D+  +D +EIKFKE+ AA          
Sbjct: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAA---------- 53

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYK-MYEDNX--XX 127
             Y+L                                       SN Y+  YE       
Sbjct: 54  --YELLSNEEKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSP 111

Query: 128 XXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGK 187
                     LTM++LY GK +RF  KR VVC +C G+G + + R    H   C  C G 
Sbjct: 112 RTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGH 167

Query: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247
           G K+RL+R GPG V  + V C+KC G GK  +S    ++ C  C G  +  + + + V +
Sbjct: 168 GVKQRLRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYI 223

Query: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307
             G    D + ++G ADEE GK   GDL F + E      +    L+  G     D Y  
Sbjct: 224 PRGSRHGDRVVLKGEADEEPGKIP-GDLVFDIAEN-----SASSSLERRG----SDLYAK 273

Query: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367
           +TISLS+ALTGFEK +  T D RLL L +  G+V+RPG+ ++I NEGWP LDD   + GD
Sbjct: 274 ITISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGD 332

Query: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCAS---GDANDLINNETVSNFQIIH 424
           +YV I IEFPPD+WF+E+S++  ++  LP        S     A+D  N ET   F I+ 
Sbjct: 333 MYVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVK 392

Query: 425 T-DDLPEGV-KTFKPKPQ 440
           + ++LP+ + +  +P PQ
Sbjct: 393 SAEELPQYLSEESEPGPQ 410

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  249 bits (636), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 154/443 (34%), Positives = 223/443 (50%), Gaps = 25/443 (5%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y VLGV +DA   EI+ AYRKLALK+HPDK +D+  ++ +E  FKE+TAAYEILSDPE K
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYK-MYEDNXXXXX 129
           S YD+Y                                      S   +  Y +      
Sbjct: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193

Query: 130 XXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGS 189
                   +T + LYMGK + F LKR+ +C  C G+G +  K+     E+ C SC G+G 
Sbjct: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLR--KKHFQKPEISCTSCNGQGF 251

Query: 190 KERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAP 249
           KER+ R   G +     +C+ C GKG+YRK  K+  + C  C+G GL ++++  TV +  
Sbjct: 252 KERITRLAGGYMVKDHTVCDACKGKGRYRK--KSASDTCKHCSGKGLINEEKSQTVYIPR 309

Query: 250 GHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVT 309
           G    D   +  MAD E GK   GD+   ++E            K+  +    D + ++ 
Sbjct: 310 GSRHGDEFRLPQMADMEYGKET-GDVIIVIDEDSS---------KSHLERKSNDLHTTLN 359

Query: 310 ISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLY 369
           ISL +ALTGF   + +T+D+R L +++  G+VIRPG+  K   EGWP+ +      GD+Y
Sbjct: 360 ISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG--DSFGDMY 417

Query: 370 VFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQIIHTDD-- 427
           V I+IEFP DNWFNEKSE+  ++  LP          D    +N E V ++ ++H+ D  
Sbjct: 418 VQINIEFPKDNWFNEKSEITALRNILPGLKSKDTKDPDP---LNTEDVLSYSVLHSHDEL 474

Query: 428 ---LPEGVKTFKPKPQNPAHKKA 447
              L E  + +  K Q   H  A
Sbjct: 475 PDYLAEEKEKYNRKQQEEPHASA 497

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  245 bits (626), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 150/389 (38%), Positives = 205/389 (52%), Gaps = 34/389 (8%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV  DA   EIK AYR+LAL+HHPDK  D+  ++ +EIKFKE+ AAYE+LS+ EK+
Sbjct: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYED---NXXX 127
            +YD Y                                      S  Y+  ED   +   
Sbjct: 64  RNYDTYGDTNGYSDSYGGFQDGDFASFFGNFA------------SGRYEDEEDFRAHARP 111

Query: 128 XXXXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGK 187
                     LTM+DLY GK +RF   R VVC +C G+G + + R    H   C  C G 
Sbjct: 112 RTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCEGH 167

Query: 188 GSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIV 247
           G K+RL+R GPG V  + V C KC G GK  +S    ++ C  C G  +  + + + V +
Sbjct: 168 GVKQRLRRLGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYI 223

Query: 248 APGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS 307
             G   ND I +EG ADEE GK   GDL F ++E      +    L+  G     D +  
Sbjct: 224 PRGSRHNDRIVLEGEADEEPGKLT-GDLVFDISED-----STTSNLERRG----SDLHTK 273

Query: 308 VTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367
           + ISLS+ALTGFEK +  T D R L L I  G+VIRPG+ + + NEGWP LDD   + G+
Sbjct: 274 IIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGKKFGN 332

Query: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLP 396
           +YV I+IEFPPD+W++E+ E+  ++  +P
Sbjct: 333 MYVQINIEFPPDHWYSERGEIEALRNIIP 361

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  226 bits (575), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/293 (40%), Positives = 171/293 (58%), Gaps = 13/293 (4%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           ++M D Y GK  +F  KR++VC KC GSGW+ ++      +  C+SC G+G KE+L+R  
Sbjct: 123 VSMADCYNGKVFKFQSKRKIVCEKCEGSGWR-RRSGGPPPQTNCKSCQGRGYKEQLRRVA 181

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           PG+VA Q V C  CHGKGKY   P + KN C  C G G+  + + +TV +  G    D I
Sbjct: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
             EG AD+E+GK+  GDL F ++E  E     ++  + +      D   +++ISL+EA+T
Sbjct: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNISISLAEAIT 295

Query: 318 GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
           G ++ LTKT D R+L LS   G+VI PG ++K+  EGWP+   A  + GDLYV + I FP
Sbjct: 296 GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHAT-KFGDLYVLVDIVFP 354

Query: 378 PDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQIIHTDDLPE 430
            DNWF EKS+LL I+  LP          D     N E VS+ +++  D LP+
Sbjct: 355 RDNWFAEKSDLLKIRNILPSEAANNDVKADPG---NTEQVSDMKLV--DQLPD 402

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/67 (62%), Positives = 52/67 (77%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
          LY  LGV++DA   EIK AYRKLAL+HHPDK  D   ++ +E++FKEITAAYE+LSD EK
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 70 KSHYDLY 76
          +S YD Y
Sbjct: 63 RSKYDTY 69

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  226 bits (575), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 183/307 (59%), Gaps = 20/307 (6%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK--RVHVTHEVECESCGGKGSKERLKR 195
           +T+KDLY GK +R+D+KR V+C KC G GW+++K  + +V    EC++C G G K+  ++
Sbjct: 117 VTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQ 176

Query: 196 FGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
             PG    Q ++C+ C GKG+Y K P + KNFC  C G G+    E ITV +  G    D
Sbjct: 177 IAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKD 236

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
            I I+  AD+E+GK   GDL F L E  ++    Q  LK +GD   +D    +TISL++A
Sbjct: 237 TIIIDNKADQELGKFKTGDLIFVLEEIDDE----QTALKRYGD---KDLITELTISLADA 289

Query: 316 LTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHI 374
           +TGF EK + KT D RLL LSI  G+VIR GD+LK+  EGWP+  +A  R GDLY+  +I
Sbjct: 290 ITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT-RSGDLYIKFNI 348

Query: 375 EFPPDNWFNEKSELLGIKTNLPXXXXXXC-ASGDA------NDLINNETVSNFQIIHTDD 427
           EFP DNW +E ++++ I+  LP          GD       N  +N+E +SN+  +   D
Sbjct: 349 EFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVK--D 406

Query: 428 LPEGVKT 434
           LP+ + T
Sbjct: 407 LPDIIDT 413

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 45/71 (63%), Gaps = 5/71 (7%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKY--VDQDSKDVN---EIKFKEITAAYEIL 64
          LY +L V       E+K  YRKLALK+HPDK    D D  DV    E+KFKEI +AYEIL
Sbjct: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 65 SDPEKKSHYDL 75
          SD EK+  YDL
Sbjct: 72 SDEEKRKQYDL 82

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  192 bits (488), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 173/312 (55%), Gaps = 26/312 (8%)

Query: 142 DLYMGKKLRFDLKRQVVCMKCHGSGWKT-----KKRVHVTHEVECESCGGKGSKERLKRF 196
           +LY GKK+ F+LKR+  C +C G+GWK+     KK+        CE C G+G ++RL++ 
Sbjct: 130 ELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCEGQGVRQRLRQL 189

Query: 197 GPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDC---AGVGLQSKKEVITVIVAPGHHF 253
            PG V ++ + C +C GKGK R  PK+ KN CPDC     VG+  + +V+T+ +  G   
Sbjct: 190 APGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKVVTINIKKGTLD 249

Query: 254 NDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLS 313
            D I ++G ADE++     GDL   + E +E  +     ++     N  D  +   I L+
Sbjct: 250 GDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYD---IVR-----NGYDLIIKKQIDLA 301

Query: 314 EALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG-----RCGD 367
           +A+ GF EK L +T+D R+L  S K G+VIRP D+++I NEGWP  +DA       + GD
Sbjct: 302 DAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLKNGD 361

Query: 368 LYVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINNETVSNFQII---- 423
           LYV + I FPPDNW  E ++   ++  +P       +S     ++N E ++  +I+    
Sbjct: 362 LYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINVSEIVKEIP 421

Query: 424 HTDDLPEGVKTF 435
           + D+LP+   T+
Sbjct: 422 NCDELPKFQDTY 433

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (69%), Gaps = 5/69 (7%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-----DQDSKDVNEIKFKEITAAYEILS 65
          YG+LGV +DA   EIK AYRKLAL+HHPDK       +  S D+ ++ FKE+TAAY++LS
Sbjct: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 66 DPEKKSHYD 74
          D   ++ YD
Sbjct: 64 DASLRAEYD 72

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  179 bits (453), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 166/312 (53%), Gaps = 26/312 (8%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKR--VHVTHEVECESCGGKGSKERLKR 195
           +T+KDLY GK ++F L R V+C  C G+ W+ +K   ++    + C  C G G  ERL  
Sbjct: 120 VTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVG 179

Query: 196 FGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
             P     Q + C KC GKG+Y   P + KN C  C G GL  +K+ + V +  G   ++
Sbjct: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNM------EDSYVSVT 309
            I  +   DE++     GD+ F L    E          N GD ++       D ++++ 
Sbjct: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDE---------PNGGDPDILVTKEGTDLHMNIE 290

Query: 310 ISLSEALTGFE-KFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDL 368
           I L EA++G + +FLTKTFDDR+L L++  G+V+RPGD + I  EGWP   +     GD+
Sbjct: 291 IPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGT-EFGDM 349

Query: 369 YVFIHIEFPPDNWFNEKSELLGIKTNLPXXXXXX--CASGDANDLINNETVSNFQIIHTD 426
           +V +++EFPPDNW +E++++  +   LP          +GDAN   N E V +++I+   
Sbjct: 350 FVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDAN---NAEFVKDYEILKAT 406

Query: 427 DLPEGVKTFKPK 438
           D  EG ++   K
Sbjct: 407 D--EGTRSSNTK 416

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (76%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          Y +LGV RD+   EI+ AYRKLALK HPDK +D + K  NE+KFKEIT AYEILS+
Sbjct: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  121 bits (304), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 172/412 (41%), Gaps = 47/412 (11%)

Query: 4   SDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEI 63
           S +N  LY  L ++ DA  QEIK AYR  ALK HPDK  +  S+D ++ KF+EI  AYEI
Sbjct: 3   SVKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDK--NNHSED-SKRKFQEICKAYEI 59

Query: 64  LSDPEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYED 123
           L D +KK  YD Y                                      ++    + D
Sbjct: 60  LGDAKKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFND 119

Query: 124 NXXXXXXXXXXXXXLT------------MKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK 171
           +             ++            +++LY GKK +  L R  +C  C G+G     
Sbjct: 120 DTMFFTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGG---- 175

Query: 172 RVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDC 231
               T    C +C G+G   + +R GP +V +    C+ C G G + +     K+ C +C
Sbjct: 176 ----TSSSACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRR----KDVCSEC 226

Query: 232 AGVGLQSKKEVITVIVAPGHHFNDVITIEGMADEEI----GKAAC--GDLRFHLNERQED 285
            G G   ++++  + V PG H    I +   ADE +    GK     GD+   + + +  
Sbjct: 227 KGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHP 286

Query: 286 WFAKQVFLKNFGDGNMEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPG 345
            F     + N  D  M D +V     L  +L G E  +        L + + PG +++PG
Sbjct: 287 LFQ----IHNDTDLVMNDCHV----DLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPG 338

Query: 346 DVLKITNEGWPILDDARGRCGDLYVFIHIEFPPD---NWFNEKSELLGIKTN 394
            V  + + G P    ++G  G+LY+   ++FP        N+ SELLG   N
Sbjct: 339 CVKCVESMGMP-HPQSQGF-GNLYIRFQVDFPDKLQLETINKVSELLGKDEN 388

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 97/394 (24%), Positives = 154/394 (39%), Gaps = 54/394 (13%)

Query: 7   NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
           N+ LY +LGV+  A  Q+IK AYR  ALKHHPDK       + +++KF++I  AYEIL D
Sbjct: 6   NSELYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKD 62

Query: 67  PEKKSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXX 126
             K+  YD +                                      S     + D+  
Sbjct: 63  ERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGS----FFNDDMS 118

Query: 127 XXXXXXXXXXXLTMKDLYMGKKLRFDLK-----------------RQVVCMKCHGSGWKT 169
                       + ++L  G  ++  LK                 R  +C KC G G   
Sbjct: 119 FFGKRQGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGG-- 176

Query: 170 KKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCP 229
                     +C +CGG+G +   KR GP +V +    C  C G+G + K     K+ C 
Sbjct: 177 ------LKASQCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQ----KDICR 225

Query: 230 DCAGVGLQSKKEVITVIVAPGHHFNDVITIEGMADEEIGK------AACGDLRFHLNERQ 283
           DC G G   ++ +  + V  G      + + G ADE +G          GD+   L +  
Sbjct: 226 DCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLP 285

Query: 284 EDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIR 343
              F +        D ++   +  V +  S  L G   ++      +LL + + PG +++
Sbjct: 286 HKAFWRHR------DASLVLDHCKVDLKTS--LCGGPVWVDSHPSGKLLKIDVLPGEILK 337

Query: 344 PGDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
           PG +  +   G P    + GR G+LY+   + FP
Sbjct: 338 PGAIKCVEGMGMP---KSGGRFGNLYIRFDVAFP 368

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  105 bits (263), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 100/372 (26%), Positives = 157/372 (42%), Gaps = 30/372 (8%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-DQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +LGV +DA+ +EIK+AYR+L+ K+HPDK   D+++ +    KF E+  AY++LSD EK
Sbjct: 24  YKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEAHN----KFIEVGEAYDVLSDSEK 79

Query: 70  KSHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXXXX 129
           ++ YD Y                                                     
Sbjct: 80  RNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRPRG 139

Query: 130 XXXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGS 189
                   +++ D Y G++ +++L+    C KCHG+G K  K   VT    C  C G+G 
Sbjct: 140 QNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGK---VTR---CPDCQGRGV 193

Query: 190 KERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAP 249
             ++ + G      Q V C++C G G+  K+P      CP C G  +    +  TV +  
Sbjct: 194 IVQVIQMGIMTQQIQHV-CDRCSGSGEIIKNP------CPHCHGHKVAKMDKEFTVKLPN 246

Query: 250 GHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDS-YVSV 308
           G   N V    G A E+      GDL F   E           + N G     D  Y + 
Sbjct: 247 GAQRNYVDIKHGEA-EKGADFDAGDLMFEFRENS---------MNNMGYRRRGDHLYRTE 296

Query: 309 TISLSEALTGFEKFLTKTFD-DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGD 367
            +S+ EAL G  +   + FD D+ + L     +V+  G++  +   G PIL+    + GD
Sbjct: 297 VLSVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGD 356

Query: 368 LYVFIHIEFPPD 379
           L++   I  P +
Sbjct: 357 LFIDYVILMPQE 368

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  102 bits (255), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 120/248 (48%), Gaps = 25/248 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T++ L+ G+  +  L +Q++C  C G G K           +C +C G+G K   ++ GP
Sbjct: 120 TLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVK------KCTACSGQGFKFVTRQMGP 173

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++    V CE CHG G+      +PK  C  C+G  + ++++V+ V + PG      I 
Sbjct: 174 -MIQRFQVECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRIV 228

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+  G    GD+ F ++E+    F +        DGN  D +    I L  A+ G
Sbjct: 229 FQGEADQSPGIIP-GDVVFVVSEQPHPVFKR--------DGN--DLHYDAEIDLLSAIAG 277

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            + F  K      L + I PG VI PG V  I  +G PI     G  G+L +  +I+FPP
Sbjct: 278 GQ-FAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPI--PKYGGYGNLLIKFNIKFPP 334

Query: 379 DNWFNEKS 386
            ++ ++++
Sbjct: 335 AHFTDDET 342

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LGV+  AD  +IK AYRK ALK HPDK   +++ +    KFKEIT+AYEILS
Sbjct: 3  KDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE----KFKEITSAYEILS 58

Query: 66 DPEKKSHYDLY 76
          D +K+  YD +
Sbjct: 59 DSQKREVYDQF 69

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 126/258 (48%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L + V+C  C G G K+          +C SCGG G K   ++ GP
Sbjct: 123 TLENLYKGRTAKLALNKTVLCKSCEGRGGKS------GSVKKCSSCGGHGVKFVTRQMGP 176

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      CE C+G+G       +PK+ C +C+G  + ++++++ V + PG      + 
Sbjct: 177 -MIQRFQTTCEACNGEGDVI----DPKDRCRECSGKKISNERKILEVNIEPGMKNGQKVV 231

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD++ G+   GD+ F +NE++   F +          N ++ +    I L  A+ G
Sbjct: 232 FQGEADQQPGQIP-GDVVFVVNEQEHPKFVR----------NGDNLHYEAQIDLLTAVAG 280

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            +  L     D  L + I PG VI PG V  I  +G PI     G  G+L +  +++F P
Sbjct: 281 GQFALEHVSGD-WLKVDIVPGEVIAPGMVKVIEGKGMPI--QKYGSYGNLLIKFNVKF-P 336

Query: 379 DNWFNEKSELLGIKTNLP 396
            + F   ++L  ++  LP
Sbjct: 337 KSHFASDADLKKLEEILP 354

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 4/69 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LGV+ DA+  +IK AYRK ALK+HPDK    ++ D    KFK++TAAYEILS
Sbjct: 3  KDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD----KFKQMTAAYEILS 58

Query: 66 DPEKKSHYD 74
          D +K+  YD
Sbjct: 59 DSQKREVYD 67

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 119/248 (47%), Gaps = 25/248 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L + V+C +C G G K           +C SC G+G K   +  GP
Sbjct: 124 TLENLYKGRAAKLALNKTVLCKRCEGRGGKA------GSVKKCTSCNGQGVKFVTRHMGP 177

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      CE C+G+G    +     + C DC G  + S+++++ V + PG      I 
Sbjct: 178 -MIQRFQTTCEVCNGEGDVIPA----ADRCKDCDGKKIASERKILEVNIQPGMKHGQKIV 232

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD++ G+   GD+ F +NE++   F +          N ++ +    I L  A+ G
Sbjct: 233 FQGEADQQPGQIP-GDVVFVVNEQEHPRFVR----------NGDNLHYEAEIDLLTAIAG 281

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            +  L     D  L + I PG VI PG V  I  +G PI     G  GDL +  +++FP 
Sbjct: 282 GQFALEHVSGD-WLKIDIVPGEVIAPGMVKVIEGKGMPI--QKYGSYGDLLIKFNVKFPK 338

Query: 379 DNWFNEKS 386
            ++ +E++
Sbjct: 339 SHFADEEA 346

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 50/69 (72%), Gaps = 4/69 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LGV+ DA+  +IK AYRK ALK+HPDK   +++ D    KFK+IT AYEILS
Sbjct: 3  KDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD----KFKQITGAYEILS 58

Query: 66 DPEKKSHYD 74
          D +K+  YD
Sbjct: 59 DSQKREMYD 67

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score = 99.4 bits (246), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 129/265 (48%), Gaps = 32/265 (12%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L +Q++C  C G G K K  V      +C SC G+G K   ++ GP
Sbjct: 125 TLEELYKGRTAKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGVKFVTRQMGP 178

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            L   Q   CE CHG G       +PK+ C  C    + ++++++ V + PG      + 
Sbjct: 179 MLQRFQ-AECEVCHGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQKVV 233

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD +      GD+ F ++++  + F +       GD    D      I L  A+ G
Sbjct: 234 FKGEAD-QAPDIIPGDVIFVVSQKPHEHFQRA------GD----DLVYEAEIDLLTAIAG 282

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E F  K      L ++I PG VI PG    I+++G PI     G  G+L V  +I+FPP
Sbjct: 283 GE-FAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPI--PKYGGYGNLIVKFNIKFPP 339

Query: 379 DNWFNEKS-----ELLG--IKTNLP 396
           +++ +E+S     E+L    KTN+P
Sbjct: 340 NHFTDEESLKKLEEILPPRTKTNIP 364

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ + Y +LGV+  A   EIK AYRK ALK+HPDK   +++ +    KFKE +AAYE+LS
Sbjct: 3  KDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAE----KFKEASAAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DDEKREMYDQF 69

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  100 bits (248), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 118/259 (45%), Gaps = 48/259 (18%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++KDLY GKK +  L R  +C+ C G G   K +        C +C G GS  + +R GP
Sbjct: 174 SLKDLYYGKKTKLRLDRTRLCVLCMGQGSMKKSK--------CFTCNGLGSLTQTRRMGP 225

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++ +    C  C G G + K      + C  C+G G   ++++  V + PG     VI 
Sbjct: 226 -MIQTFSQSCPDCQGSGMFVKR----SDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVII 280

Query: 259 IEGMADEEIG------KAACGDLRFHLNERQEDWFAK----QVFLKNFGDGNMEDSYVSV 308
           + G ADE +       K   GD+   +N+ +++ F       + L NF            
Sbjct: 281 LPGEADEVVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNF------------ 328

Query: 309 TISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP----------IL 358
           +++LS+AL G   F++      L+ + I PG ++ PG +  + N G P          I+
Sbjct: 329 SVNLSKALCGGTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSII 388

Query: 359 DDARGRCGDLYVFIHIEFP 377
           + ++   G+LYV   I+FP
Sbjct: 389 NISK---GNLYVKFDIKFP 404

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
          LY +L ++ +AD ++IK AYR LALK+HPDK    +  + +++ F++I+ AYE+L D EK
Sbjct: 7  LYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDVEK 63

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 64 RKLYDQY 70

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 120/258 (46%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L +Q++C  C G G K           +C SCGG+G K   K+ GP
Sbjct: 124 TLEELYKGRTAKLALNKQILCKSCEGRGGKADAV------KKCSSCGGQGIKFVTKQMGP 177

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK  C  C G  + ++++++ V + PG      I 
Sbjct: 178 -MIQRFQTECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIEPGMKDGQRIV 232

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G +D+       GD+ F +NE+    F +         GN  D      I L  A+ G
Sbjct: 233 FKGESDQAP-DIIPGDVVFVVNEKPHKHFQRS--------GN--DLVYLAEIDLLTAIAG 281

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E F  +      L ++I  G VI PG    I  +G PIL    G  G+L +  +I+F P
Sbjct: 282 GE-FALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILK--YGGYGNLIIQFNIKF-P 337

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F ++S L  ++  LP
Sbjct: 338 ENHFTDESNLKKLEEILP 355

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ + Y +LGV+  A   EIK  YRK ALK+HPDK    ++ +    KFKE +AAYE+LS
Sbjct: 3  KDTKFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAE----KFKECSAAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          DPEK+  YD Y
Sbjct: 59 DPEKRDVYDQY 69

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 108/245 (44%), Gaps = 25/245 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LYMGK  +  L R  +C  C G G   K          C++C G+G + +  R GP
Sbjct: 190 TLKELYMGKTAKLGLNRTRICQVCDGHGGLKK--------YACKTCKGQGVQTQTNRMGP 241

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            LV S    C  C G G + +S    K+ C  C G+G   +++++ V V PG   N +I 
Sbjct: 242 -LVQSWSQTCADCGGAGIFVES----KDICQQCQGLGFVKQRKILQVAVQPGSCHNQLIV 296

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKN-----FGDGNMEDSYVSVTISLS 313
           + G  DE I     G    H      D     + LK+       D N+   Y    + L 
Sbjct: 297 LTGEGDEVISSKGGG----HEKIIPGDVVITILRLKDPRFQIVDDYNL--IYKKCKVDLM 350

Query: 314 EALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP-ILDDARGRCGDLYVFI 372
            +L G   ++      +L+ L I PG V++PG    + N G P  ++  R   G +YV  
Sbjct: 351 TSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYVKF 410

Query: 373 HIEFP 377
            + +P
Sbjct: 411 EVTYP 415

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          N  LY  L VT  A   EIK AYR  ALK+HPDK    +  + ++ KF+EI  AYE L D
Sbjct: 4  NTSLYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKD 60

Query: 67 PEKKSHYDLY 76
             +S YD Y
Sbjct: 61 NHLRSLYDQY 70

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 122/258 (47%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L +Q++C  C G G K           +C SCGG+G K   ++ GP
Sbjct: 122 TLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVK------KCSSCGGQGVKFVTRQMGP 175

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK+ C +C G  + ++++V+ V V PG      +T
Sbjct: 176 -MIQRFQTECDVCHGSGDII----DPKDRCKECKGNKVANERKVLEVHVEPGMREGQKVT 230

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+       GD+ F + E+    F      K  GD    D      + L  A+ G
Sbjct: 231 FKGEADQAP-DIIPGDVIFVVTEKPHKHF------KRSGD----DLLYEAEVDLLTAIAG 279

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            + F  +      L ++I PG VI PG    I  +G P+     G  G+L +   I+F P
Sbjct: 280 GD-FAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPV--QKYGGYGNLIITFKIKF-P 335

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F ++++L  ++  LP
Sbjct: 336 ENHFADEAKLKALEDILP 353

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV+ +A   EIK  YRK ALK+HPDK    +  D    KFKE + AYE+LS
Sbjct: 3  KETKFYDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTDEAAEKFKECSGAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 59 DSQKREIYDQY 69

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 116/248 (46%), Gaps = 25/248 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +QV+C  C G G K           +C SC G+G K   ++ GP
Sbjct: 123 SLEELYKGRTAKLALNKQVLCKTCEGRGGKE------GAVKKCASCNGQGVKFITRQMGP 176

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ C+G G       +PK+ C  C G  + ++++++ V + PG      I 
Sbjct: 177 -MIQRFQAECDACNGTGDIV----DPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQKIV 231

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+  G    GD+ F +++R    F ++      GD    + Y    + L  A+ G
Sbjct: 232 FQGEADQAPG-VIPGDVIFVISQRPHKHFERK------GD----NLYYQAEVDLLSAIAG 280

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E F  +      L + I PG VI PG    I  +G P+     G  GDL V   + FP 
Sbjct: 281 GE-FAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPV--QKYGGFGDLIVTFKVNFPT 337

Query: 379 DNWFNEKS 386
           +++ +E+S
Sbjct: 338 NHFADEES 345

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV  DA+  +IK  YRK ALK HPDK    ++ D    KFKE+T AYE+LS
Sbjct: 3  KETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAAD----KFKELTVAYEVLS 58

Query: 66 DPEKKSHYD 74
          D +K+  YD
Sbjct: 59 DSQKRDIYD 67

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 113/266 (42%), Gaps = 41/266 (15%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LYMGK  +  L R  +C  C G G   K          C+ C G+G + + KR GP
Sbjct: 193 TLKELYMGKTAKLGLNRTRICHVCDGHGGLRK--------YTCKPCKGQGIQTQTKRMGP 244

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            LV S    C  C G G + K+    K+ C  C G+G   +++++ V V PG   N +I 
Sbjct: 245 -LVQSWSQTCADCGGAGTFVKN----KDICEQCQGLGFIKQRKILQVTVQPGSCHNQLIV 299

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVT--------- 309
           + G  DE I     G         +E      V +       ++D    +T         
Sbjct: 300 LTGEGDEVISTKGGG---------REKVIPGDVVITIL---RLKDPKFQITDNCDLICKK 347

Query: 310 --ISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP-ILDDARGRCG 366
             + L  +L G   ++      +L+ + I PG V++PG    + N G P  ++  R   G
Sbjct: 348 CEVDLMTSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFG 407

Query: 367 DLYVFIHIEFP----PDNWFNEKSEL 388
            LYV   + +P    P+N    KS L
Sbjct: 408 HLYVKFDVTYPERLEPENAAKVKSIL 433

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          N  LY  L VT  A   EIK AYR  ALK+HPDK    +  + ++ KF+EI  AYE+L D
Sbjct: 4  NTSLYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKD 60

Query: 67 PEKKSHYDLY 76
             +S YD Y
Sbjct: 61 NHLRSLYDQY 70

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 111/249 (44%), Gaps = 29/249 (11%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY GK  +  L R  +C+ C+G G              CESC G G + + +R GP
Sbjct: 161 TLRELYNGKMAKLALNRTRLCLPCNGFGG--------LQRTTCESCQGDGFQTQTRRMGP 212

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            +V +    C  C G G + K    P + CP C G G   ++++  V V PG      + 
Sbjct: 213 -MVQTWTQTCASCDGAGCFIK----PNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVI 267

Query: 259 IEGMADEEI------GKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISL 312
           ++G ADE +       K   GD+   + + +++    Q+        N +       + L
Sbjct: 268 MQGEADEIMLNNLVKEKVIPGDVVITIKQSRDENNCFQMI------NNKDLLMNGCPVDL 321

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG----RCGDL 368
             +L G E ++      +L+ L I PG +++P     I   G P L+D +     R GDL
Sbjct: 322 VTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDL 381

Query: 369 YVFIHIEFP 377
           Y+   I++P
Sbjct: 382 YIQFKIQYP 390

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          R+ +LY  L V   A   +IK AY+KLALK+HPDK  +  S+D ++ KF+ +  AYEIL+
Sbjct: 3  RDTKLYETLNVPITATTLDIKKAYKKLALKYHPDK--NNHSED-SKTKFQAVCQAYEILN 59

Query: 66 DPEKKSHYD 74
          D + ++ YD
Sbjct: 60 DKQSRAIYD 68

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score = 93.6 bits (231), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 115/248 (46%), Gaps = 25/248 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +Q++C  C G G K           +C SC G+G K   ++ GP
Sbjct: 124 SLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVK------KCSSCNGQGIKFITRQMGP 177

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ C G G       +PK+ C  C G  + ++++++ V + PG      I 
Sbjct: 178 -MIQRFQAECDVCSGTGDII----DPKDRCKSCNGKKIDNERKILEVHIEPGMKDGQKIV 232

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+  G    GD+ F +++R    F ++      GD    D      + L  A+ G
Sbjct: 233 FQGEADQAPGIIP-GDVVFVISQRPHKHFERK------GD----DLLYQAEVDLLSAIAG 281

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E F  +      L +SI PG VI PG    I  +G PI     G  G+L V   I FP 
Sbjct: 282 GE-FAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPI--QKYGGYGNLIVTFKINFPT 338

Query: 379 DNWFNEKS 386
           +++ +E+S
Sbjct: 339 NHFADEES 346

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ + Y +LGV+ DA+  +IK AYRK ALK HPDK   +++ D    KFKE+T AYEILS
Sbjct: 3  KDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAAD----KFKELTVAYEILS 58

Query: 66 DPEKKSHYD 74
          D +K+  YD
Sbjct: 59 DSQKRDIYD 67

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 107/243 (44%), Gaps = 21/243 (8%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LYMGK  +  L R  +C  C G G   K          C++C G+G + + +R GP
Sbjct: 186 TLKELYMGKTAKLGLNRTRICSVCDGHGGLKK--------CTCKTCKGQGIQTQTRRMGP 237

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            LV S    C  C G G + K+    K+ C  C G+G   +++++ V V PG   N +I 
Sbjct: 238 -LVQSWSQTCADCGGAGVFVKN----KDICQQCQGLGFIKERKILQVTVQPGSCHNQLIV 292

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLK--NFGDGNMEDSYV-SVTISLSEA 315
           + G  DE I     G    H      D     + LK  NF   N  +       I    +
Sbjct: 293 LTGEGDEVISTKGGG----HEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTS 348

Query: 316 LTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP-ILDDARGRCGDLYVFIHI 374
           L G   ++      +L+ L I PG +++PG    + + G P  ++  R   G LYV   +
Sbjct: 349 LCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDV 408

Query: 375 EFP 377
            +P
Sbjct: 409 TYP 411

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +N  LY  L VT  A   EIK AYR  ALK+HPDK    +  + ++ KF+EI  AYEIL 
Sbjct: 3  QNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILK 59

Query: 66 DPEKKSHYDLY 76
          D   ++ YD Y
Sbjct: 60 DNRLRALYDQY 70

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score = 92.8 bits (229), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 125/264 (47%), Gaps = 30/264 (11%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +T+++LY GK  +  L +Q++C  C G G K K  V      +C SC G+G K   ++ G
Sbjct: 121 VTLEELYRGKTSKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMG 174

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P ++      C+ CHG G       +PK+ C  C G  + S+++++ V V PG      +
Sbjct: 175 P-MIQRFQTECDVCHGAGDIV----DPKDRCKSCNGKKVASERKILEVHVDPGMKNGQKV 229

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
             +G AD+       GD+ F +NE+    F +       GD  + ++ V     L  A+ 
Sbjct: 230 VFKGEADQAP-DVIPGDVVFVINEKPHKHFQRS------GDNLVYEAEV----DLLTAIA 278

Query: 318 GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
           G E F  +      L ++I PG VI PG    I  +G P+     G  G+L +   ++FP
Sbjct: 279 GGE-FAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAK--YGGYGNLIIKFTVKFP 335

Query: 378 PDNWFNEKS-----ELLGIKTNLP 396
             ++  E++     E+L  +T LP
Sbjct: 336 EPHFTTEENLKKLEEILPQRTPLP 359

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY VLGV+  A   EIK AYRK+ALK HPDK   +++ +    KFKE ++AYE+LS
Sbjct: 3  KDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D +K+  YD +
Sbjct: 59 DADKRDTYDQF 69

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 107/246 (43%), Gaps = 28/246 (11%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LYMGK  +  L R  +C  C G G   K          C++C G+G + + K  GP
Sbjct: 197 TLRELYMGKTAKLGLNRTRICHVCEGHGGLQK--------YTCKTCKGQGVQTQTKCMGP 248

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            LV S    C  C G G + +S    K+ C  C G+G   +++++ V V PG   N +I 
Sbjct: 249 -LVQSWSQTCADCGGAGIFVES----KDICQQCQGLGFIKQRKILQVTVQPGTSHNQLIV 303

Query: 259 IEGMADEEIGKAAC------GDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISL 312
           + G  DE I K         GD+   +   ++  F  QV        N    Y    + L
Sbjct: 304 LTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKF--QV------TDNCSLIYKKCKVDL 355

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP-ILDDARGRCGDLYVF 371
             +L G   ++      +L+ L I PG V++P     I   G P  ++  R   G LYV 
Sbjct: 356 MTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVK 415

Query: 372 IHIEFP 377
             + +P
Sbjct: 416 FDVSYP 421

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          N  LY  L VT  A   EIK AYR  AL++HPDK    +  + ++ KF+EI  AYE+L D
Sbjct: 4  NTSLYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKD 60

Query: 67 PEKKSHYDLY 76
             +S YD Y
Sbjct: 61 NHLRSLYDQY 70

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 121/258 (46%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +Q++C +C G G K K  V      +C SC G+G K   ++ GP
Sbjct: 123 SLEELYKGRTAKLALNKQILCKECEGRGGK-KGAVK-----KCTSCNGQGIKFVTRQMGP 176

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK+ C  C G  ++++++++ V V PG      I 
Sbjct: 177 -MIQRFQTECDVCHGTGDI----IDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 231

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD +      GD+ F ++ER    F +        DG+  D      I L  A+ G
Sbjct: 232 FKGEAD-QAPDVIPGDVVFIVSERPHKSFKR--------DGD--DLVYEAEIDLLTAIAG 280

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E  L     D  L + I PG VI PG    I  +G PI     G  G+L +   I+F P
Sbjct: 281 GEFALEHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPI--PKYGGYGNLIIKFTIKF-P 336

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F  +  L  ++  LP
Sbjct: 337 ENHFTSEENLKKLEEILP 354

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV   A   EIK AYRK ALK+HPDK   +++ +    KFKE +AAYEILS
Sbjct: 3  KETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASAAYEILS 58

Query: 66 DPEKKSHYDLY 76
          DPEK+  YD +
Sbjct: 59 DPEKRDIYDQF 69

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 98/367 (26%), Positives = 146/367 (39%), Gaps = 41/367 (11%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y +L V +DA  +EIK+AYR+L+ K+HPDK  +  S++ +  KF E+  AY++LSDPEKK
Sbjct: 25  YAILEVDKDASEKEIKSAYRQLSKKYHPDK--NSGSEEAHH-KFIEVGEAYDVLSDPEKK 81

Query: 71  SHYDLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEYKMYEDNXXXXXX 130
             YD +                                            +         
Sbjct: 82  KIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQRQRGP 141

Query: 131 XXXXXXXLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSK 190
                  L++K  Y G  + F L     C  CHGSG    K        +C  C G+G  
Sbjct: 142 MIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGKL------AQCPDCQGRGVI 195

Query: 191 ERLKRFGPGLVASQWV--MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVA 248
            ++ R G   + +Q +  MC +C G G+        KN C  C G  +  K +   V V 
Sbjct: 196 IQVLRMG---IMTQQIQQMCGRCGGTGQI------IKNQCKTCHGKKVIKKNKFFHVDVP 246

Query: 249 PGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSV 308
           PG   N + T  G A E+      GDL     E+  +        +  GD    + Y + 
Sbjct: 247 PGAPRNYLDTRAGEA-EKGPDFDAGDLVIEFKEKDTENMG----YRRRGD----NLYRTE 297

Query: 309 TISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNE-----GWPILDDARG 363
            +S  EAL G  +   + FD+       KP ++ RP  V+    E     G+ +    +G
Sbjct: 298 VLSAEEALYGGWQRTIEFFDEN------KPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKG 351

Query: 364 RCGDLYV 370
             GDLY+
Sbjct: 352 H-GDLYI 357

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/316 (25%), Positives = 138/316 (43%), Gaps = 36/316 (11%)

Query: 140 MKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPG 199
           + DL+ GK+ +  L R  +C +C G G K           +C  C G G     KR GP 
Sbjct: 173 LYDLFHGKRAKLALNRTRLCQRCQGYGGKKA--------TQCRGCQGTGLFTTTKRMGP- 223

Query: 200 LVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITI 259
           +V +    C++C G GKY +S    K+ C +C+G G   +++   V V PG    + I +
Sbjct: 224 MVQTWQTTCKECSGTGKYIRS----KDACTECSGNGFIKERKFFDVEVLPGMRNGNEIIL 279

Query: 260 EGMADE----EIGKAAC--GDLRFHLN-ERQEDWFAKQVFLKNFGDGNMEDSYVSVTISL 312
            G ADE    E GK     GD+   +   R E+   +  +L +  D  +++      + L
Sbjct: 280 PGEADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDN----FEVDL 335

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFI 372
             +L G    +          + +  G +++PG +  + N+G P+  D+ G  G+LY+  
Sbjct: 336 KTSLCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPV--DSNGNFGNLYIRF 393

Query: 373 HIEFPP---DNWFNEKSELL----GIKTNLPXXXXXXCASGDANDLINNETVSNFQIIHT 425
            ++FP     +  N+ SE+L     I + L           +++D+   + +S F    T
Sbjct: 394 RVKFPEQLKSDTINKLSEILVQDENISSILSDSINNKSYKINSSDIAEEQVLSTFT---T 450

Query: 426 DDLPEGVKTFKPKPQN 441
           +DL    K  K    N
Sbjct: 451 EDLQSKFKNAKRDSPN 466

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 5/72 (6%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIK-FKEITAAYEIL 64
          +N +LY +L V   A  QEIK AYRK ALKHHPDK    ++     IK F++I+ AYE L
Sbjct: 3  KNTKLYDILEVNTTATEQEIKKAYRKKALKHHPDK----NNHSAESIKLFQDISHAYETL 58

Query: 65 SDPEKKSHYDLY 76
          S+  K+  YD Y
Sbjct: 59 SNSNKRELYDQY 70

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 120/258 (46%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +Q++C +C G G K K  V      +C  C G+G K   ++ GP
Sbjct: 123 SLEELYKGRTAKLALNKQILCKECEGRGGK-KGAVK-----KCTGCNGQGIKFVTRQMGP 176

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK+ C  C G  ++++++++ V V PG      I 
Sbjct: 177 -MIQRFQTECDACHGTGDIV----DPKDRCKSCNGKKIENERKILEVHVEPGMKDGQKIV 231

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD +      GD+ F ++ER    F +        DG+  D      I L  A+ G
Sbjct: 232 FKGEAD-QAPDVIPGDVVFLVSERPHKHFKR--------DGD--DLVYEAEIDLLTAIAG 280

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E  L     D  L + I PG VI PG    I  +G P+     G  G+L V   I+F P
Sbjct: 281 GEFALEHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPV--PKYGGYGNLIVKFTIKF-P 336

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F  +  L  ++  LP
Sbjct: 337 ENHFTTEENLKKLEEILP 354

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV+  A   EIK AYRK ALK HPDK   +++ +    KFKE ++AYE+LS
Sbjct: 3  KETKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DSEKREVYDQF 69

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 110/246 (44%), Gaps = 25/246 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L +Q++C  C G G K           +C SC G+G K   ++ GP
Sbjct: 122 TLEELYKGRTAKLALNKQILCKTCEGRGGKA------GAVKKCTSCNGQGIKFVTRQMGP 175

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK+ C DC G  + ++++V+ V V PG      I 
Sbjct: 176 -MIQRFQTECDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEPGMREGQKIV 230

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD +      GD+ F + E+    F      K  GD    D      I L  A+ G
Sbjct: 231 FKGEAD-QAPDVIPGDVIFVVVEKPHKHF------KRAGD----DLLYEAEIDLLTAIAG 279

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E F  +      L +S  PG VI  G    I  +G P+     G  G+L V   I+FP 
Sbjct: 280 GE-FAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPV--PKYGGYGNLIVTFKIKFPE 336

Query: 379 DNWFNE 384
           +N+  E
Sbjct: 337 NNFATE 342

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV+ +A   EIK  YRK ALK+HPDK   +++ +    KFKE +AAYE+LS
Sbjct: 3  KETKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE----KFKECSAAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 59 DSQKREVYDQY 69

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 120/258 (46%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +Q++C  C G G K K  V      +C SC G+G K   ++ GP
Sbjct: 123 SLEELYKGRTAKLALNKQILCKGCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMGP 176

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK+ C  C G  ++++++++ V V PG      I 
Sbjct: 177 -MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 231

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD +      GD+ F ++ER    F +        DG+  D      I L  A+ G
Sbjct: 232 FKGEAD-QAPDVIPGDVVFIVSERPHKNFKR--------DGD--DLVYEAEIDLLTAIAG 280

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E  L     D  L + I PG VI PG    I  +G PI     G  G+L +   I+F P
Sbjct: 281 GEFALEHVSGD-WLKVGIVPGEVISPGMRKVIEGKGMPI--PKYGGYGNLVIKFTIKF-P 336

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F  +  L  ++  LP
Sbjct: 337 ENHFTTEENLKKLEEILP 354

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV+  A   EIK AYRK ALK+HPDK   +++ +    KFKE ++AYEILS
Sbjct: 3  KETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DSEKREVYDQF 69

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 112/244 (45%), Gaps = 25/244 (10%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +T+++LY G+  +  L +Q++C  C G G K           +C SC G+G K   ++ G
Sbjct: 124 VTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVK------KCTSCNGQGVKFITRQMG 177

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P ++      C+ C G G       NPK+ C  C+G  + ++++++ V V PG      I
Sbjct: 178 P-MIQRFQTECDACDGTGDII----NPKDRCKACSGKKVANERKILEVHVDPGMKDGQKI 232

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
             +G AD +      GD+ F ++ER    F +          + +D      I L  A+ 
Sbjct: 233 VFKGEAD-QAPDIIPGDVIFVVSERPHKHFRR----------DSDDLVYEADIDLLTAIA 281

Query: 318 GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
           G E F  +      L + I PG VI PG    I  +G P+L    G  G+L V  +I FP
Sbjct: 282 GGE-FAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVL--KYGGFGNLLVKFNIVFP 338

Query: 378 PDNW 381
            D++
Sbjct: 339 KDHF 342

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV+  A   EIK AYRK ALK+HPDK   +++ +    KFKE ++AYE+L 
Sbjct: 3  KETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE----KFKEASSAYEVLM 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DAEKREAYDQF 69

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score = 89.7 bits (221), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 120/258 (46%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +Q++C  C G G K K  V      +C SC G+G K   ++ GP
Sbjct: 124 SLEELYKGRTAKLALNKQILCKGCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMGP 177

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       +PK+ C  C G  ++++++++ V V PG      I 
Sbjct: 178 -MIQRFQTECDVCHGTGDIV----DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIV 232

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+       GD+ F ++ER    F +        DG+  D      I L  A+ G
Sbjct: 233 FKGEADQAP-DVIPGDVVFLVSERPHKSFKR--------DGD--DLVYEAEIDLLTAIAG 281

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E  L     D  L + I PG VI PG    I  +G P+     G  G+L +   ++F P
Sbjct: 282 GEFALEHVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPV--PKYGGYGNLIIKFTVKF-P 337

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F  +  L  ++  LP
Sbjct: 338 ENHFTAEENLKKLEEILP 355

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  + Y +LGV+  A   EIK AYRK ALK+HPDK   +++ +    KFKE ++AYEILS
Sbjct: 3  KETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DSEKRDVYDQF 69

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score = 89.7 bits (221), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 116/259 (44%), Gaps = 26/259 (10%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +T+++LY G+  +  L +Q++C  C+G G K           +C SC G+G K   ++ G
Sbjct: 123 VTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAV------KKCSSCNGQGYKFVTRQMG 176

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P ++      CE C G G       +PK+ C  C G  + ++++++ V V PG      I
Sbjct: 177 P-MIQRFQTECEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDPGMKDGQKI 231

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
             +G AD +      GD+ F ++E+    F +       GD    D      I L  A+ 
Sbjct: 232 VFKGEAD-QAPDVIPGDVIFVVSEKPHKNFQR------VGD----DLVYEAEIDLLTAVA 280

Query: 318 GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
           G E  L     D  L ++I PG VI PG    +  +G PI     G  G+L V   I FP
Sbjct: 281 GGEFSLEHVSGD-WLKVAIVPGEVISPGMRKVVEGKGMPIAK--FGGYGNLLVTFKINFP 337

Query: 378 PDNWFNEKSELLGIKTNLP 396
           P N F     L  ++  LP
Sbjct: 338 P-NHFTSDENLKKLEEILP 355

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++++ Y +LGV+  A   EIK AYRK ALK+HPDK    ++ +    KFKE+++AYE+LS
Sbjct: 3  KDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAE----KFKEVSSAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DSEKRQVYDQF 69

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 108/236 (45%), Gaps = 27/236 (11%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+ +LY GK+ +  L+R   C+KC G G    K         C  C G+GS  + K+FGP
Sbjct: 240 TLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIK--------SCSKCNGRGSLTQTKKFGP 291

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            +  +    C+ C G G +     + ++ C +C G G  ++K++  V + PG     +I 
Sbjct: 292 -MTQTFTQTCDGCGGNGTF----ADAQDICNECQGEGFLNEKKIFEVEITPGMTDGQLII 346

Query: 259 IEGMADEEIG------KAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISL 312
           + G ADE I       +   GD+   +N   +  F K V          +  Y +  I+L
Sbjct: 347 LTGEADEVISTNLGKERVIPGDIILTINLLPDPTF-KVV-------QGADLLYANYKINL 398

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDL 368
             +L G   ++     + L+ ++I PG +I+ G +  + N G P +D + G   D+
Sbjct: 399 LTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSNDI 454

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 5/69 (7%)

Query: 9  RLYGVLGVTRDADVQEIKTAYRKLALKHHPDK-YVDQDSKDVNEIKFKEITAAYEILSDP 67
          +LY +L V  D+D   IK AYR LALK+HPDK  + ++SK +    F++I+ AY +LS+ 
Sbjct: 6  QLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQM----FQKISEAYVVLSNK 61

Query: 68 EKKSHYDLY 76
          +K+  YD Y
Sbjct: 62 DKRQMYDKY 70

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 122/264 (46%), Gaps = 30/264 (11%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +++++LY GK  +  L +Q++C  C G G K K  V      +C SC G+G K   ++ G
Sbjct: 121 VSLEELYKGKTSKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMG 174

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P ++      C+ CHG G       + K+ C DC G  + ++++++ V V PG      +
Sbjct: 175 P-MIQRFQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQKV 229

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
             +G AD +      GD+ F ++E+    F +       GD    D      I L  A+ 
Sbjct: 230 VFKGEAD-QAPDIIPGDVIFVISEKPHKHFQR------VGD----DLIYEAEIDLLTAVA 278

Query: 318 GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
           G E F  +      L +SI PG VI P     +  +G PI     G  G+L +   I+FP
Sbjct: 279 GGE-FALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPI--QKYGGYGNLIIKFSIKFP 335

Query: 378 PDNWFNEKS-----ELLGIKTNLP 396
            +++ +E +     E+L  +  LP
Sbjct: 336 ENHFADEDTLKKLEEILPARKPLP 359

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          R  +LY +LGV+  A   EIK AYRK ALK+HPDK   +++ +    KFKE ++AYE+LS
Sbjct: 3  RETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 66 DPEKKSHYDLY 76
          D EK+  YD +
Sbjct: 59 DSEKRDIYDQF 69

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 119/258 (46%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L +Q++C  C G G K           +C SC G+G K   ++ GP
Sbjct: 124 TLEELYKGRTAKLALNKQILCKSCEGRGGK------AGAVKKCSSCNGQGFKFITRQMGP 177

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ C+G G       + K+ C  C G  + ++++++ V + PG      I 
Sbjct: 178 -MIQRFQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIEPGMKDGQKIV 232

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+        D+ F ++ER  + F ++      GD    D Y    + L  A+ G
Sbjct: 233 FQGEADQAPDVVPG-DVVFVVSERPHERFNRK------GD----DLYYEAEVDLLTAIAG 281

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E F  +      L + I PG VI PG    I  +G P+     G  G+L V   I+FPP
Sbjct: 282 GE-FAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPV--QKYGGFGNLIVKFKIKFPP 338

Query: 379 DNWFNEKSELLGIKTNLP 396
            N F +++ L  ++  LP
Sbjct: 339 -NHFADEASLKQLENILP 355

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 4/69 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY ++GV+  AD  +IK AYRK ALK+HPDK   +++ +    KFKEI++AYEILS
Sbjct: 3  KDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAE----KFKEISSAYEILS 58

Query: 66 DPEKKSHYD 74
          D +K+  YD
Sbjct: 59 DSQKREMYD 67

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 118/261 (45%), Gaps = 30/261 (11%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+ +LY GK  +  L R+ +C  C G G   ++         C++C G+G +   +R GP
Sbjct: 172 TLAELYDGKITKLGLNRRRMCQSCQGQGSLRRR--------TCKTCRGQGQQTETRRTGP 223

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            +V +    C  C+G G Y K      + C +C G     ++++  V V+ G      I 
Sbjct: 224 -MVQTWTQTCPDCNGLGTYTKQA----DVCHECRGESYIKERKIFDVEVSKGMCHGQTIV 278

Query: 259 IEGMADEEIG------KAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISL 312
           + G ADE I       K   GD+   +++ ++  F +   +  +G    +    S +I L
Sbjct: 279 LPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFHR---VNRYG---CDLVMGSCSIDL 332

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFI 372
           S +L G + ++      +LL +SI PG +I P  +  I   G P      G+ G+LY+  
Sbjct: 333 STSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGK-GNLYIQF 391

Query: 373 HIEFP----PDNWFNEKSELL 389
            +E+P    PD     +S LL
Sbjct: 392 QLEYPVGLEPDTIGRLQSVLL 412

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 50/72 (69%), Gaps = 5/72 (6%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDK-YVDQDSKDVNEIKFKEITAAYEIL 64
          R+ RLY  L V+ DA + EIK AY+ +ALK+HPDK +  +D+K+    KF+E+  AYEIL
Sbjct: 3  RDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKN----KFQEVCKAYEIL 58

Query: 65 SDPEKKSHYDLY 76
          +D +K+  YD Y
Sbjct: 59 ADEDKRVMYDRY 70

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 116/258 (44%), Gaps = 26/258 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  +  L +Q++C  C G G K           +C SC G+G K   ++ GP
Sbjct: 121 SLEELYKGRTAKLALNKQILCKSCEGRGGKE------GAVKKCSSCNGQGIKFVTRQMGP 174

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ CHG G       + K+ C  C G  + ++++++ V + PG      I 
Sbjct: 175 -MIQRFQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKIV 229

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD+       GD+ F ++E+    F +       GD    D      I L  AL G
Sbjct: 230 FKGEADQAP-DVIPGDVVFVISEKPHKHFQRA------GD----DLIYEAEIDLLTALAG 278

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            +  L     D  L + I PG VI PG    +  +G PI     G  G+L +  +I+F P
Sbjct: 279 GQFALEHVSGD-WLKVDIVPGEVIAPGARKIVEGKGMPI--QKYGGYGNLLIKFNIKF-P 334

Query: 379 DNWFNEKSELLGIKTNLP 396
           +N F  +  L  ++  LP
Sbjct: 335 ENHFTSEENLKKLEEILP 352

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 49/71 (69%), Gaps = 4/71 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY  LGV+  A   EIK AYRK ALK+HPDK   +++ +    KFKE+++AYEILS
Sbjct: 3  KDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE----KFKEVSSAYEILS 58

Query: 66 DPEKKSHYDLY 76
          D +K+  YD +
Sbjct: 59 DSQKREVYDQF 69

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 117/285 (41%), Gaps = 30/285 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY GK +R  L R  +C  C G G         +    C +C G+G   + KR G 
Sbjct: 140 TLEELYGGKVVRLALTRTRLCTLCAGRGG--------SRASTCTACSGQGICSQTKRQGS 191

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            LV +    C  C G G   K      + C  C G G   +++V  V + PG      + 
Sbjct: 192 -LVQTWSSTCRVCSGSGTIVKDC----DTCTSCGGAGYLRERKVFEVEIRPGMRAGSEVV 246

Query: 259 IEGMADEEI----GKAAC--GDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISL 312
             G ADE +    GK     GDL   + E            +  GD N+      + + L
Sbjct: 247 FPGEADEVVNTPYGKEQVLPGDLAITIEE-----ATPATRYQCRGDANL--LLTELHVDL 299

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFI 372
             +L G   ++      +L+ L I PG ++ PG +  I + G P  DD   + G L++  
Sbjct: 300 RTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDP-SQYGHLFIKF 358

Query: 373 HIEFP---PDNWFNEKSELLGIKTNLPXXXXXXCASGDANDLINN 414
           H++FP    D+     ++ L   TN+        A G    +++N
Sbjct: 359 HVDFPKTLADSTITAIAQALDADTNVRTRTPPAAADGCEEHVLSN 403

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ RLY VLGV       E+K +Y+  AL++HPDK       + ++ +F++I  AY +L 
Sbjct: 3  KDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLG 59

Query: 66 DPEKKSHYDLY 76
          D   +  YD Y
Sbjct: 60 DERLRKIYDRY 70

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 112/248 (45%), Gaps = 25/248 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  +  L +Q++C  C G G K K  V      +C SC G+G K   ++ GP
Sbjct: 126 TLEELYKGRTAKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGVKFVTRQMGP 179

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++      C+ C G G       +PK+ C  C    + ++++++ V + PG      I 
Sbjct: 180 -MIQRFQAECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQNIV 234

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTG 318
            +G AD +      GD+ F + ++    F +          + +D      I L  A+ G
Sbjct: 235 FKGEAD-QAPDVIPGDVIFVVAQKPHKHFQR----------SGDDLVYEAEIDLLTAIAG 283

Query: 319 FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEFPP 378
            E  L     D  L +SI PG VI PG    I  +G PI     G  G+L V   ++FP 
Sbjct: 284 GEFALEHVSGD-WLKVSILPGEVISPGSKKVIEGKGMPI--PKYGGHGNLIVHFTVKFPQ 340

Query: 379 DNWFNEKS 386
            ++ +E S
Sbjct: 341 KHFADEDS 348

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY VLGV+  A   EIK AYRK ALK+HPDK   ++  +    KFKE++AAYEILS
Sbjct: 3  KDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAE----KFKEVSAAYEILS 58

Query: 66 DPEKKSHYD 74
          D EK+  YD
Sbjct: 59 DSEKREIYD 67

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 110/248 (44%), Gaps = 29/248 (11%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+  LY GK  +  L R+ VC  C G G   K R        C++C G+G + R ++ GP
Sbjct: 145 TLSSLYEGKNTKLGLNRRRVCKACKGRG-SMKVRT-------CKACRGRGQQSRSRQMGP 196

Query: 199 GLVASQWVM-CEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
             +   W   C  C+G G + K      + C DC G G   ++++  V V PG      I
Sbjct: 197 --MMQTWTQTCSDCNGMGTFTKD----SDVCRDCEGEGCIRERKIFDVEVKPGMCQGQQI 250

Query: 258 TIEGMADEEIGK------AACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTIS 311
            + G ADE I           GD+   + + ++  F  Q   +N  D  + +      I 
Sbjct: 251 ILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKF--QRVNRNGCDLMVRN----CKIP 304

Query: 312 LSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGR--CGDLY 369
           L  +L G +  +    + +L+ ++I PG +I+P     I N G P  ++ R     G+LY
Sbjct: 305 LVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYEEKRAPEGYGNLY 364

Query: 370 VFIHIEFP 377
           +   +EFP
Sbjct: 365 IQFQVEFP 372

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ RLY VL V+ +A   EI+ AYR LALKHHPDK    +  + ++ KF E+  AYEIL 
Sbjct: 3  KDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILI 59

Query: 66 DPEKKSHYDLY 76
          D +K+S YD Y
Sbjct: 60 DEKKRSLYDQY 70

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 101/247 (40%), Gaps = 35/247 (14%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T++DLY GK ++  L+R   C +C                  C SC G G+  R++R GP
Sbjct: 122 TLQDLYRGKVIKLALRRTAPCERCSLGAANV-----------CSSCNGSGNITRIERVGP 170

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            L  +    C  C G+G+           C  C G    +++ V  V V PG H    I 
Sbjct: 171 -LTQTWSSTCNACQGQGRMSVD-------CSQCGGAQYLNERVVFKVHVKPGMHDGQTIV 222

Query: 259 IEGMADE-------EIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYV-SVTI 310
           ++G AD+        +  A  GD+   + E  +  F +    K       E+ +V  V +
Sbjct: 223 LDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKR------ENLFVDQVKV 276

Query: 311 SLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
            L+ ALTG    L       L+ ++I PG  +    +  +   G PI  D  G+ GDLY+
Sbjct: 277 DLTTALTGGNVLLEDHPSGNLMKINILPGEFLPENCIKCVEGLGMPI--DDTGQRGDLYI 334

Query: 371 FIHIEFP 377
                 P
Sbjct: 335 RFCTHSP 341

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 3/65 (4%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
          LY VLGV  DA   EIK AYRKLAL++HPDK    +  +     F++I+ AY +L D  +
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDK---NNGDEKCHEAFQKISHAYGVLGDVAQ 60

Query: 70 KSHYD 74
          +  YD
Sbjct: 61 RQRYD 65

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 103/244 (42%), Gaps = 27/244 (11%)

Query: 140 MKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPG 199
           +K+LY GK  +  L R  +C +C G G  T           C  C G+G   + +R GP 
Sbjct: 163 LKELYSGKVAKLGLTRTRLCHRCSGHGSMTSS--------VCGECRGQGVYSQTRRHGP- 213

Query: 200 LVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITI 259
           LV +    C  C G G + KS     + C  C G G   ++++  V + PG      I +
Sbjct: 214 LVQTWSSSCRNCSGAGTFVKS----NDVCQTCRGTGYIRERKIFEVEIKPGLSNKSEIIL 269

Query: 260 EGMADEEI----GKAAC--GDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLS 313
            G AD+ I    GK     GD+   + E+           + F + ++        + L 
Sbjct: 270 PGEADQVISTVYGKQQVIPGDVIIIVQEQ-----CSTGRYRRFRESDL--VLTRCVVDLR 322

Query: 314 EALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIH 373
            +L G   ++      R + L + PG ++ PG +  + N G P  D+   + GDLY+   
Sbjct: 323 TSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNP-SQYGDLYIKFC 381

Query: 374 IEFP 377
           + FP
Sbjct: 382 VNFP 385

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ R Y +L V+     QE+K +Y+  AL++HPDK    +S    +  F++IT AY ILS
Sbjct: 3  KDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDKNGHSESA---KQAFQQITEAYGILS 59

Query: 66 DPEKKSHYDLY 76
          D  K+  YD Y
Sbjct: 60 DERKRKIYDRY 70

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 105/241 (43%), Gaps = 24/241 (9%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+KDLY GK+ +  L+R  +C  C G G   +          C  C G G+     R GP
Sbjct: 167 TIKDLYRGKRSKLRLERSKLCSICKGDGGVKRSM--------CNQCHGDGNITETTRLGP 218

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            ++ +    C  C+G G    S +     C  C GVG  ++ ++  V + PG      I 
Sbjct: 219 -MLQTFTHTCNICNGNGWVIISQET----CQGCNGVGFYNEMKIFDVEIYPGMKDGTQIV 273

Query: 259 IEGMADEEIGKAAC--GDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEAL 316
                DE + K     G++  H+NE +++ F      K   DG  +  Y +  I L  +L
Sbjct: 274 FNNEGDEIVNKRRVIPGNVIIHINEIEDNKF------KRVNDG-QDLYYWNYEIDLFTSL 326

Query: 317 TGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEF 376
            G   ++    +++L+ + I PG +I  G V  + + G P   +     G LY+   +++
Sbjct: 327 CGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMP--KNKGNEYGILYIQFQVKY 384

Query: 377 P 377
           P
Sbjct: 385 P 385

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 3/68 (4%)

Query: 9  RLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPE 68
          RLY  L +   A   +IK AYR  AL++HPDK    +  + ++ KF++I+ AY IL D  
Sbjct: 6  RLYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSILRDEN 62

Query: 69 KKSHYDLY 76
          ++  YD Y
Sbjct: 63 QRKMYDKY 70

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 104/259 (40%), Gaps = 47/259 (18%)

Query: 140 MKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPG 199
           + DLY GKK +  L R  VC  C G G     RV       C +C G+G   + +R GP 
Sbjct: 159 LSDLYQGKKTKLGLNRMRVCSSCDGKGG---MRV-----ASCRTCKGQGEVVKTRRVGP- 209

Query: 200 LVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITI 259
           +V +    C  CHG G + K      + C  C G G+  ++++  V V  G   N VI +
Sbjct: 210 MVQTMSSTCNSCHGTGTFIKD----SDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVL 265

Query: 260 EGMADEEIG------KAACGDLRFHLNERQEDWFA----KQVFLKNFGDGNMEDSYVSVT 309
            G ADE I       K   GD+   ++  +   F       + LKN              
Sbjct: 266 PGEADEVIETSHGLIKVQPGDVVIVIDLVKNTQFQVVNDHDLVLKN------------CE 313

Query: 310 ISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPIL----------- 358
           + L   L G E  +      +++ LSI P  +++P     +   G P +           
Sbjct: 314 VPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAG 373

Query: 359 DDARGRCGDLYVFIHIEFP 377
            D  G  G+LYV   ++FP
Sbjct: 374 TDIDGY-GNLYVQFQVKFP 391

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ RLY +L V  DA    IK A+   AL+ HPDK    +  + ++ +F+EI+ AYE+LS
Sbjct: 3  KDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLS 59

Query: 66 DPEKKSHYDLY 76
          DP+ +  YD Y
Sbjct: 60 DPKSREMYDRY 70

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 113/262 (43%), Gaps = 36/262 (13%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LY GKK +  L R   C  C+G G          + + C  C GKG     K  GP
Sbjct: 180 TLKELYQGKKCKLGLNRTRSCHSCNGMGG--------MNTIICNECQGKGINTETKMLGP 231

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
            +V S    C  C G G +  S    ++ C +C G G   ++ + TV V PG   N  I 
Sbjct: 232 -MVQSWSSTCFNCSGMGYFIDS----QSGCKECQGEGYLRERTIFTVTVKPGMRNNQKIV 286

Query: 259 IEGMADEEI-------GKAACGDLRFHLNERQ-----EDWFAKQVFLKN---FGDGNMED 303
           ++G AD+ +        K   GD+   +N+ +      D    Q   KN   F   N +D
Sbjct: 287 LKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKFHFEIINEKD 346

Query: 304 SYV-SVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWP--ILDD 360
             + +  I L  +L G E ++      +L+ L I P  +++P  +  + N G P  I D+
Sbjct: 347 LLLRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDE 406

Query: 361 ARGR-----CGDLYVFIHIEFP 377
                     GDLY+   +++P
Sbjct: 407 TNNGEEYLPNGDLYIQFKVKYP 428

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 4  SDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEI 63
          ++ N RLY +L V   A + EIK AY+KLALK+HPDK    +  + +++KF+EI  AYE+
Sbjct: 8  NNNNTRLYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEV 64

Query: 64 LSDPEKKSHYDLY 76
          L D +KK  YD Y
Sbjct: 65 LHDKDKKLLYDTY 77

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 106/247 (42%), Gaps = 34/247 (13%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           T++++Y GK+ +  LKR  +C  C G G K            C +C GKG + + KR GP
Sbjct: 149 TLEEMYNGKRAKLALKRTRLCQTCQGEGSK--------KATSCYACRGKGMQTQTKRQGP 200

Query: 199 GLVASQW-VMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
             +   W   C  C G G   K    P + C  C G G   ++++  + V  G      +
Sbjct: 201 --IMQTWSSTCGTCGGSGTIVK----PSDICNGCHGQGWVRERKIFEIEVQKGMENGQTV 254

Query: 258 TIEGMADEEI------GKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVS-VTI 310
            +   ADE +       +   GD+   L         +Q+  ++   G+     +S   +
Sbjct: 255 VVPAEADEVVISKYGSERVIPGDVIIIL---------EQLPHRSLKRGHDSSLLLSECQV 305

Query: 311 SLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
            L  +L G   ++      ++L + + PG +++PG +  + + G P    ++G  GDL++
Sbjct: 306 DLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQSMGMP---KSKGGYGDLFI 362

Query: 371 FIHIEFP 377
              + FP
Sbjct: 363 KFKVIFP 369

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 3/73 (4%)

Query: 4  SDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEI 63
          S  NN LY  LGV  +A  QEIK AYR  ALKHHPDK       + +++KF++I  AYEI
Sbjct: 3  SAMNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYEI 59

Query: 64 LSDPEKKSHYDLY 76
          L D +K+  YD +
Sbjct: 60 LGDDKKREMYDRF 72

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 107/247 (43%), Gaps = 29/247 (11%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +++K  Y+G +  F L    +C  C GSG +  K         C  CGG G   ++ R G
Sbjct: 137 ISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGK------TETCPDCGGSGQIMKVFRAG 190

Query: 198 PGLVASQWVM--CEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
           P     Q V   C +C G+G+        K+ C  C GV +  K +V T  V PG   N 
Sbjct: 191 P---IEQRVRQPCSRCQGRGQL------IKHVCKKCKGVKVVQKSKVFTAKVEPGMERNH 241

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
           +  ++G + E+      GDL  +  E ++D    +        GN    Y +  +S  EA
Sbjct: 242 IHVMQGQS-EKHPDIEPGDLYQYFRESEKDSMGYRR------RGNT--LYRTEILSFKEA 292

Query: 316 LTGFEKFLTKTFD-DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHI 374
           L G  +   + FD ++ L LS   G  ++ G+   I + G PI   A  + GDL +  ++
Sbjct: 293 LQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPI-PSATDKFGDL-IIDYV 350

Query: 375 EFPPDNW 381
              P  W
Sbjct: 351 ILLPGEW 357

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV + A  +EIK+AYR+L+ K+HPDK       D     F E+  AY++LSDPEK+
Sbjct: 22 YAILGVDKQASEKEIKSAYRQLSKKYHPDK---NPGNDEAHHHFIEVGEAYDVLSDPEKR 78

Query: 71 SHYD 74
            YD
Sbjct: 79 QIYD 82

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 108/240 (45%), Gaps = 36/240 (15%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           LT+KD Y G  + F L     C  CHGSG +  K        +C  CGG+G   ++ R G
Sbjct: 158 LTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGKV------KKCPDCGGRGVVIQVIRMG 211

Query: 198 PGLVASQWVM--CEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
              + +Q V   C +C G G+        +N C  C+G  +Q K++ I+V    G   N 
Sbjct: 212 ---IVTQQVQQRCNRCAGSGEI------IQNKCKVCSGAKVQKKEKDISVSFDSGIERNH 262

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFG-DGNMEDSYVSVTISLSE 314
           +   +G A++  G    GDL     E  E          N G     +D + +  ++L E
Sbjct: 263 ISVQQGEAEKGPGIEP-GDLIVEFFEVPE---------ANMGYRRRGKDLFRTEVLTLQE 312

Query: 315 ALTG----FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
           A+ G      +FL  T   + L L   P  ++  G+V KI   G PIL  ++G+ GDLY+
Sbjct: 313 AINGDWSRDIQFLDPT---KKLQLKRSPMDIVMNGEVEKIPGFGMPIL-GSKGKFGDLYI 368

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 48/67 (71%), Gaps = 5/67 (7%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-DQDSKDVNEIKFKEITAAYEILSDPEK 69
          Y +LG++++ + +EIK+AYR+L+ K HPDK   D+D+ +    KF EI  AYE+LSDPEK
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDAHN----KFIEIGEAYEVLSDPEK 80

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 81 RRMYDQF 87

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 98/241 (40%), Gaps = 25/241 (10%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           LT+K  Y G  L F L     C  CHGSG +  K  H      C  C G+G   ++ R G
Sbjct: 147 LTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKTTH------CSECRGQGVVIQVVRMG 200

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P L      MC  C GKG+        KN C  C G  ++ K +   V V  G   + V 
Sbjct: 201 P-LTQKIQQMCGACQGKGQV------IKNKCKRCHGAKVERKAKHFHVDVPAGAPRDFVD 253

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
              G AD+       GD+    +E   D    +    +         Y +  +SL EAL 
Sbjct: 254 VKAGEADKGP-DFDSGDVFIKFSESSRDNMGYRRRGPHL--------YRTEVLSLKEALL 304

Query: 318 GFEKFLTKTFD-DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEF 376
           G  K   + FD ++ L L    G  +R G++ ++   G P      G+ GDL+V   +  
Sbjct: 305 GGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPT--GGHGKHGDLFVDYVVVI 362

Query: 377 P 377
           P
Sbjct: 363 P 363

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%), Gaps = 5/65 (7%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-DQDSKDVNEIKFKEITAAYEILSDPEK 69
          YG+LGV++DA  +EIK+AYR+L+ K HPDK   D+D+      KF E+  AYE+LSD +K
Sbjct: 27 YGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHH----KFIEVGEAYEVLSDDQK 82

Query: 70 KSHYD 74
          +  YD
Sbjct: 83 RQIYD 87

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 100/237 (42%), Gaps = 31/237 (13%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           L++++ + G  + F +  +  C  C GSG +  K        +C+ CGG G   ++ R G
Sbjct: 163 LSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGKVD------KCKECGGNGFVVQVIRMG 216

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P +       C KCHG G         KN C  C G  L +K + I V V  G   + + 
Sbjct: 217 P-VTQQMHTQCPKCHGAGS------TIKNHCKKCHGQKLVTKSKEINVKVPAGAPRDFLK 269

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFG---DGNMEDSYVSVTISLSE 314
            +E   D+E+  A  GDL     E  ++         N G    GN  D + +  +   +
Sbjct: 270 IVENGGDKEL-NAEAGDLLVQFQEIAQN---------NLGYRRRGN--DLFRTEALVFKD 317

Query: 315 ALTGFEKFLTKTFD-DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
           A+ G        FD  R + +S KPG  +   ++ K+   G PI      R GDLY+
Sbjct: 318 AMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPI--QGSDRFGDLYI 372

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ ++A  + IK+AYR+L+ K+HPDK  +Q+ ++ +   F EI  AYE+LSDPEK+
Sbjct: 31 YKILGIPKEASEKAIKSAYRQLSKKYHPDK--NQNDEEAHN-HFIEIGEAYEVLSDPEKR 87

Query: 71 SHYDLY 76
            YD +
Sbjct: 88 RTYDQF 93

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LG++  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILS
Sbjct: 3  KETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREVYDQY 67

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGVT  A+ QEIK  YRK ALK+HPDK            KFK+I+ AYEILS
Sbjct: 3  KETKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILS 56

Query: 66 DPEKKSHYDLY 76
          D  K+  YD Y
Sbjct: 57 DSNKREIYDQY 67

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREIYDQY 67

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LGV+  AD  E+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREIYDSY 67

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREIYDQY 67

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 101/243 (41%), Gaps = 26/243 (10%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           LT+K+ Y G  + F+L     C  C GSG +  K   VT   +C  C G G   ++ R G
Sbjct: 141 LTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGK---VT---KCPDCKGHGVVVQIVRMG 194

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P     Q  MC KC G+G         KN C  C G  +  K +   V V PG   N V 
Sbjct: 195 PVTQQIQQ-MCGKCQGRG------STIKNKCKHCHGEKVVRKPKSFHVDVPPGAPRNFVE 247

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
             +G +D+     A GDL    +E   D        +  GD    D + +  +SL EAL 
Sbjct: 248 VKQGESDKGPDFDA-GDLFIKFSETSRDNLG----YRRRGD----DLFRTEALSLREALK 298

Query: 318 -GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHIEF 376
            G+E+ +      R + +      V   G++ +I   G P       + GDLY+   +  
Sbjct: 299 GGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP---KEHNKFGDLYIDYVVIV 355

Query: 377 PPD 379
           P D
Sbjct: 356 PDD 358

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV++ A  ++IK+AYR+L+ K+HPDK  D DS      KF E+  AYE+LSDPEK+
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSA---HNKFIEVGEAYEVLSDPEKR 78

Query: 71 SHYDLY 76
            YD Y
Sbjct: 79 KIYDQY 84

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LGV+  A   E+K  YRK ALK+HPDK     S D    KFKEI+ A+EIL+
Sbjct: 3  KDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDK----PSGDAE--KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREVYDTY 67

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QEIK  YRK AL++HPDK         N  KFK+I+ AYEILS
Sbjct: 3  KETKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTG------NTEKFKQISEAYEILS 56

Query: 66 DPEKKSHYDLY 76
          D  K+  YD Y
Sbjct: 57 DSNKREVYDQY 67

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QEIK  YRK ALK+HPDK         N  KFKEI+ A+EILS
Sbjct: 3  KETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTG------NTEKFKEISEAFEILS 56

Query: 66 DPEKKSHYDLY 76
          D  K+  YD Y
Sbjct: 57 DSNKREVYDQY 67

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 101/233 (43%), Gaps = 24/233 (10%)

Query: 139 TMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGP 198
           ++K+ Y G  L+F +    +C  CHGSG    K        +C  C G+G   ++ R G 
Sbjct: 146 SLKNYYNGYVLKFSINLNDICDHCHGSGSNDGK------STKCPDCQGRGVTVQVIRMGM 199

Query: 199 GLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVIT 258
                Q V C KC GKG+  K+P      C  C G  +  K +   + +  G     V  
Sbjct: 200 MTQQIQQV-CGKCGGKGQIIKNP------CKTCHGSKVVQKPKDFEIELPAGAPRKFVHA 252

Query: 259 IEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEAL-T 317
             G AD+     + GD+     E  +D    +    +         Y +  ++ +EAL  
Sbjct: 253 EHGAADKHPDYDS-GDVYIEFTENDKDNMGYRRRGPHL--------YRTEVLNATEALYG 303

Query: 318 GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
           G+E+ L      +++T+  +P ++I+ G+  +I   G P L + R   GDL++
Sbjct: 304 GWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMP-LGNGRKGFGDLFI 355

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L + +DA  ++I++AYR+L+ K+HPDK  + + +D +  KF E+  AYEILSDPEK+
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDK--NPNDEDAHH-KFIEVGQAYEILSDPEKR 80

Query: 71 SHYDLY 76
            YD +
Sbjct: 81 QRYDQF 86

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 99/243 (40%), Gaps = 28/243 (11%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G   +F L     C  CHG+G +  K         C  C G G   ++ R G
Sbjct: 157 LSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGK------TKVCPDCKGSGIIIQIIRMG 210

Query: 198 PGLVASQWVM--CEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
              + +Q +   C +C G+G         KNFC  C G  +Q K +   V V PG   N 
Sbjct: 211 ---MMTQQIQQPCGRCRGQGHL------IKNFCKVCNGAKVQQKLKDFKVYVPPGSPRNH 261

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
           V    G A E+      GD+    NE   D        +  G+      Y    ISL+EA
Sbjct: 262 VEVKAGQA-EKNPNYEPGDVIIEFNELPLDNLG----YRRRGNNLFRTEY----ISLNEA 312

Query: 316 LTG-FEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHI 374
           L G +E+ L      + + L   P   I  G++  +   G PI  + + + GDLY+   +
Sbjct: 313 LYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPI-PNKKNKFGDLYIDYKV 371

Query: 375 EFP 377
             P
Sbjct: 372 IIP 374

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 45/65 (69%), Gaps = 4/65 (6%)

Query: 11 YGVLGVTRDADVQ-EIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
          Y +LG+ ++   + EIK+AYRKL+ K+HPDK  +++ KD  +  F ++  AY++L DP+K
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDK--NKNDKDAQQ-NFIKVGEAYDVLGDPDK 82

Query: 70 KSHYD 74
          K  YD
Sbjct: 83 KRQYD 87

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILS
Sbjct: 3  KETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56

Query: 66 DPEKKSHYDLY 76
          D  K+  YD Y
Sbjct: 57 DKNKREVYDQY 67

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  Y+K ALK+HPDK            KFKEI+ AYEILS
Sbjct: 3  KETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILS 56

Query: 66 DPEKKSHYDLY 76
          D  K+  YD Y
Sbjct: 57 DSSKREIYDQY 67

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A   E+K  YRK ALK+HPDK            KFKEI+ A+EILS
Sbjct: 3  KETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56

Query: 66 DPEKKSHYDLY 76
          DP K+  YD Y
Sbjct: 57 DPNKREVYDTY 67

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A   EIK  YRK ALK+HPDK            KFKEI+ A+EILS
Sbjct: 3  KETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56

Query: 66 DPEKKSHYDLY 76
          D  K+S YD Y
Sbjct: 57 DSNKRSVYDQY 67

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LGV+  A   E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+
Sbjct: 3  KDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTG------DAEKFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREIYDNY 67

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +L V   A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP+K+  YD Y
Sbjct: 57 DPQKREIYDQY 67

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP  +  YD Y
Sbjct: 57 DPNTREVYDQY 67

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 42/67 (62%), Gaps = 6/67 (8%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
          LY +L V+  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILSD EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEK 60

Query: 70 KSHYDLY 76
          +  YD Y
Sbjct: 61 REVYDQY 67

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ +LY +LG++  A   EIK  YRK ALK+HPDK     + D    KFKEI+ A+EILS
Sbjct: 3  KDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDK----PTGDTE--KFKEISEAFEILS 56

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 57 DAQKREVYDTY 67

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQE 284
           K+F     G G  S+K  I + + PG      IT +G  D          L+F L E+  
Sbjct: 201 KSFKITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEKPH 260

Query: 285 DWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRP 344
           ++F +Q            D   ++ +S  E+L GF K   +T D +  T+ I   + I+P
Sbjct: 261 EFFTRQ----------DNDLIYTLPLSFKESLLGFSK-QVQTIDGK--TIPITRTQPIQP 307

Query: 345 GDVLKITNEGWPILDDARGRCGDLYVFIHIEFP 377
                   +G  +  +   R GDL +   I++P
Sbjct: 308 TQTSTYPGQGMTLSKNPSQR-GDLIIKFKIDYP 339

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 57 DSQKREIYDQY 67

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 57 DSQKREIYDQY 67

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 57 DAQKREIYDQY 67

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L + +DA  +EIK+AYR+L+ K+HPDK    D       KF EI  AYE+LSDPEKK
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEA---HHKFIEIGEAYEVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 99/243 (40%), Gaps = 30/243 (12%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G  + F L     C  CHGSG    K        +C  C G+G   ++ R G
Sbjct: 146 LSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGKL------AQCPDCQGRGIIVQVVRMG 199

Query: 198 PGLVASQWV--MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
              + +Q +  +C +C G G+        KN C  C G  +  K +   V V PG   N 
Sbjct: 200 ---IMTQQIQQICGRCAGTGQV------IKNQCKTCHGKKVTKKNKFFHVDVPPGAPRNY 250

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
           + T  G A E+      GDL     E   +    +    N         Y +  +S +EA
Sbjct: 251 MDTRAGEA-EKGPDFDAGDLVIEFREMDTENMGYRRRGHNL--------YRTEVLSAAEA 301

Query: 316 L-TGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHI 374
           L  G+E+ +    +++ + LS     V+  G++  +   G P    +R   GDLY+   +
Sbjct: 302 LYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMP--KGSRDH-GDLYIDYVV 358

Query: 375 EFP 377
             P
Sbjct: 359 VMP 361

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+  A+ QE+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTG------DTEKFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          D +K+  YD Y
Sbjct: 57 DKQKREIYDQY 67

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 6/71 (8%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +  +LY +LGV+ + +  E+K  YRK ALK+HPDK            KFKEI+ A+EIL+
Sbjct: 3  KETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILN 56

Query: 66 DPEKKSHYDLY 76
          DP K+  YD Y
Sbjct: 57 DPNKREVYDKY 67

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214w SCJ1
          Length = 361

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+++DA  +EIK+AYR+L+ K+HPDK       +    KF E+  AY+IL DPEK+
Sbjct: 22 YAILGLSKDASDKEIKSAYRQLSKKYHPDK---NPGDEEAHHKFIEVGEAYDILGDPEKR 78

Query: 71 SHYDLY 76
            YD++
Sbjct: 79 KTYDVH 84

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 25/234 (10%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +++K+ Y G ++ F++    +C  CHGSG     +V V     C +C G+G   ++ R G
Sbjct: 134 VSLKEFYSGGEVEFEIPLNDICDSCHGSG-SADGKVKV-----CPACQGRGVVVQVIRMG 187

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P       +  +     G+     K  +N C  C G  +  K +        G   N + 
Sbjct: 188 P-------ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNHID 240

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
              G +D+       GD+    NE +++    +    N         Y +  I+ +EA+ 
Sbjct: 241 KKSGESDKS-PDMESGDIIIEYNESEKENLGYRRRGNNL--------YRTEIITANEAIN 291

Query: 318 GFEKFLTKTFDD-RLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
           G      +  D+ + + LS   G ++  GD+ +I   G PI+       GDLY+
Sbjct: 292 GGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIM--GSKNFGDLYI 343

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV +DA  ++IK+AYR+++ K HPDK    D       KF EI  AYE+LSD EK+
Sbjct: 21 YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEA---HHKFIEIGEAYEVLSDSEKR 77

Query: 71 SHYDLY 76
          + YD +
Sbjct: 78 ATYDRF 83

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 96/241 (39%), Gaps = 26/241 (10%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +T+   Y G      L     C  CHGSG +  +         CE+C G+G   ++ + G
Sbjct: 140 VTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQF------ATCETCQGRGVIIQVIQMG 193

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
                 Q V C  C GKG      K  K+ C  C G  +    +   + V  G   N  +
Sbjct: 194 FMTQQIQQV-CGACQGKG------KTIKHVCKICRGARVVKTPKTFEISVPAGAQRNYNV 246

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDS-YVSVTISLSEAL 316
              G A E++     GDL F   E   +         N G     D  Y +  +   EAL
Sbjct: 247 VKSGQA-EKVPDMQSGDLVFVFEENSHE---------NLGYRRRGDHLYRTEVLHWKEAL 296

Query: 317 TGFEKFLTKTFDDRLLTLSIKPGRVIR-PGDVLKITNEGWPILDDARGRCGDLYVFIHIE 375
            G  +     FDD+   +  +   V+  PG++ ++ N G P L +++G+  + Y  + IE
Sbjct: 297 LGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKL-NSKGKSTNAYGDLFIE 355

Query: 376 F 376
           +
Sbjct: 356 Y 356

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ +DA  +EIK+AYR+L+ K HPDK  +  ++D ++ KF E+  AYE+LSDP+K+
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDK--NPGNEDAHQ-KFIEVGEAYEVLSDPQKR 79

Query: 71 SHYDLY 76
            +D +
Sbjct: 80 QTFDQF 85

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 106/249 (42%), Gaps = 32/249 (12%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +++KD Y G +L F L    +C  CHG+G    K         C  C G+G   +L R G
Sbjct: 143 ISLKDYYTGYELNFTLNVNDLCDHCHGTGSDDGKL------TPCPDCQGRGVIIQLIRMG 196

Query: 198 PGLVASQWV--MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPG--HHF 253
              + +Q +  MC +C GKG+  K        C  C G  +  +K+   V +  G   H+
Sbjct: 197 ---MMTQQIQQMCGRCGGKGQLFKKQ------CRKCHGNKVMPQKKEFQVKLPKGAKRHY 247

Query: 254 NDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLS 313
            DV    G AD+     A GDL    NE  +     +   +N         Y +  ++++
Sbjct: 248 MDV--KHGEADKNPDLEA-GDLLIEFNENDKSNMGYRRRGQNL--------YRTEVLNVT 296

Query: 314 EAL-TGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFI 372
           EAL  G+++ +      + L +  +   V+  G+V +I   G P     +   GDL++  
Sbjct: 297 EALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFI-D 355

Query: 373 HIEFPPDNW 381
           ++   P  W
Sbjct: 356 YVVIMPKQW 364

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ +DA  +++K+AYR+L+ K+HPDK    +S      +F E+  AYE+LSDPEK+
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESA---HQRFIEVGEAYEVLSDPEKR 77

Query: 71 SHYDLY 76
            +D Y
Sbjct: 78 GIFDQY 83

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 99/245 (40%), Gaps = 32/245 (13%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE-CESCGGKGSKERLKRF 196
           L++KD Y G  + F+L    +C  C GSG +  K       VE C  CGG+G   ++ R 
Sbjct: 146 LSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGK-------VETCPDCGGQGILIQIIRM 198

Query: 197 GPGLVASQWVM--CEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFN 254
           G   + +Q +   C +C G+G         KN C  C G  +  K +   V V  G   +
Sbjct: 199 G---IMTQRIQQPCGRCSGRGHI------IKNQCKACGGHKVVKKPKSFQVEVPAGAPRD 249

Query: 255 DVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDS-YVSVTISLS 313
            V      AD+     A GD+     E  ++         N G     D  + +  +S  
Sbjct: 250 HVEVRHQEADQSTDMEA-GDIFVEFTESDKN---------NMGYRRRGDHLFRTEVLSAR 299

Query: 314 EALTGFEKFLTKTFDD-RLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFI 372
           EAL G      +  DD + + L    G ++  G++ +I   G P     +   GDL+V  
Sbjct: 300 EALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKS-FGDLFVEY 358

Query: 373 HIEFP 377
            +  P
Sbjct: 359 AVVMP 363

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L + +DA  +EIK+AYR+L+ K+HPDK  +  S++ ++ KF E+  AY++LSDPEKK
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 101/247 (40%), Gaps = 38/247 (15%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G  + F L     C  CHGSG    K        +C  C G+G   ++ R G
Sbjct: 148 LSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKL------AQCPDCQGRGVIIQVLRMG 201

Query: 198 PGLVASQWV--MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
              + +Q +  MC +C G G+        KN C  C G  +  K +   V V PG   N 
Sbjct: 202 ---IMTQQIQQMCGRCGGTGQI------IKNECKTCHGKKVTKKNKFFHVDVPPGAPRNY 252

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
           + T  G A E+      GDL     E+  +        +  GD    + Y +  +S +EA
Sbjct: 253 MDTRVGEA-EKGPDFDAGDLVIEFKEKDTENMG----YRRRGD----NLYRTEVLSAAEA 303

Query: 316 LTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNE-----GWPILDDARGRCGDLYV 370
           L G  +   +  D+       KP ++ RP  V+    E     G+ +   ++G  GDLY+
Sbjct: 304 LYGGWQRTIEFLDEN------KPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKGY-GDLYI 356

Query: 371 FIHIEFP 377
              +  P
Sbjct: 357 DYVVVMP 363

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y +LG+  DA   EIK AYRK A+  HPDK+ D       + KF+ I  AY++LS
Sbjct: 3  KDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGQAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DPE +S YD +
Sbjct: 60 DPELRSRYDEF 70

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV R+A  ++IK+AYR+L+ K+HPDK     +   N   F E+  AYE LSDPEK+
Sbjct: 23 YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPEKR 79

Query: 71 SHYDLY 76
            YD Y
Sbjct: 80 RIYDQY 85

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 93/236 (39%), Gaps = 28/236 (11%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE-CESCGGKGSKERLKRF 196
           LT++  Y G  + F L     C  C  +G +  K       VE C  C  +G   ++ R 
Sbjct: 139 LTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGK-------VERCTQCSVRGVIVQVGR- 190

Query: 197 GPGLVASQWV-MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
             G +  Q+  +C +  G       PK     C  C G     K +   V V PG    D
Sbjct: 191 -QGFMTQQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAP-RD 243

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
            + ++    E++     GD+   + E   D    +    N         + +  +SL EA
Sbjct: 244 FVAVQQGEAEKVPDMDPGDIYVKVFENTRDNMGYRRQGANL--------FRTEVLSLKEA 295

Query: 316 LTGFEKFLTKTFD-DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
           L G  K   +  D  + +  S K G+ ++ G+V ++   G P+ D A    GDLYV
Sbjct: 296 LHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSA--GFGDLYV 349

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
          Ashbya gossypii AER346W
          Length = 374

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 5/67 (7%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-DQDSKDVNEIKFKEITAAYEILSDPEK 69
          Y +LGV R A  ++IK+AYR+L+ K+HPDK   D+D+ +    +F E+  AYE LSDPEK
Sbjct: 23 YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDAHN----RFIEVGEAYEALSDPEK 78

Query: 70 KSHYDLY 76
          +  YD +
Sbjct: 79 RKIYDQF 85

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 103/244 (42%), Gaps = 31/244 (12%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE-CESCGGKGSKERLKRF 196
           L +K  Y G  + F +     C  C GSG +  K       VE C  CGG+G   ++ R 
Sbjct: 146 LNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGK-------VEKCGQCGGRGMVVQVIR- 197

Query: 197 GPGLVASQ-WVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
             G +  Q   MC+KC G+G+        KN C  C G  +  K +   V V  G   + 
Sbjct: 198 -QGFITQQIQQMCQKCEGRGEV------IKNKCKTCHGSKVVKKNKSFHVDVPAGAPRDF 250

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFG-DGNMEDSYVSVTISLSE 314
           V  I G A E+      GD+   + E           ++N G      D + +  +SL+E
Sbjct: 251 VAVIRGEA-EKSPDTEPGDIYVKVVESP---------VQNMGYRRRGPDLFRTEVLSLTE 300

Query: 315 ALT-GFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIH 373
           AL  G+ + L      + + LS   G  ++ G+V  I   G P+  ++  + GDLYV   
Sbjct: 301 ALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPL--ESGTKYGDLYVDYV 358

Query: 374 IEFP 377
           I  P
Sbjct: 359 IVMP 362

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+ +DA  +EIK++YR+L+ K HPDK       +    KF EI  AYE+LSDPEK+
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDK---NPGDEEAHHKFIEIGEAYEVLSDPEKR 79

Query: 71 SHYDLY 76
            +D Y
Sbjct: 80 KIFDQY 85

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 101/243 (41%), Gaps = 28/243 (11%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           L++K+ Y G  L F L    +C  C G+G    K        +C  C G+G   ++ R G
Sbjct: 144 LSLKEYYTGATLEFTLALNDICDHCDGTGSADGK------VAKCSDCQGRGVVIQVIRMG 197

Query: 198 PGLVASQWV--MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
              + +Q +  MC +C GKG         KN C  C G  +  K++   V V PG   + 
Sbjct: 198 ---MMTQQIQQMCGRCGGKGSV------IKNHCKTCHGSKVVKKQKPFHVEVPPGAARHY 248

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
             T  G +D+     A GD+    NE+  +    +    +         Y +  +S  EA
Sbjct: 249 TETRSGESDKGADFDA-GDVFIEFNEKTTNNLGYRRRGPHL--------YRTEVLSAREA 299

Query: 316 LTGFEKFLTKTFDD-RLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYVFIHI 374
           L G  +   +  D+ + + ++     V+  G+V +I   G P   + +   GDL++   +
Sbjct: 300 LKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMP-QPNGKHAFGDLFIEYVV 358

Query: 375 EFP 377
             P
Sbjct: 359 VMP 361

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV++DA  +EIK+AYR+L+ K+HPDK       +    KF E+  AYE+LSD +K+
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDK---NPGDETAHHKFIEVGEAYEVLSDDQKR 82

Query: 71 SHYDLY 76
            Y+ Y
Sbjct: 83 QIYNQY 88

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 95/237 (40%), Gaps = 32/237 (13%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           +T+K+ Y G  L F L     C  C G+G +  K         C  C G+G   ++ R G
Sbjct: 148 ITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGK------TTRCSDCQGQGVVIQIIRMG 201

Query: 198 PGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVI 257
           P +      MC  C GKG+        KN C  C G  ++ K +   V V  G   + V 
Sbjct: 202 P-ITQQIQQMCGACQGKGQI------IKNKCKQCHGAKVERKTKHFHVDVPAGAPRDFVD 254

Query: 258 TIEGMADEEIGKAACGDLRFHLNERQED---WFAKQVFLKNFGDGNMEDSYVSVTISLSE 314
              G AD+     A GD+    +E   D   +  + V L           + +  ++L E
Sbjct: 255 VKNGEADKGPDFDA-GDVYIKFSESSRDNMGYRRRGVHL-----------HRTEVLTLKE 302

Query: 315 ALTGFEKFLTKTFD-DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLYV 370
           AL G  K   +  D  + + L    G  +R G+  ++   G P   D R   GDL+V
Sbjct: 303 ALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP--KDGR-HFGDLFV 356

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+  DA   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LSDP+ K
Sbjct: 8  YDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDA---QSKFQAVGEAYQVLSDPQLK 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDQF 70

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ + Y VLGV  DA  ++IK AYRK A++ HPDK  +       + KF+E++ AY++LS
Sbjct: 3  KDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEA---QAKFQEVSKAYKVLS 59

Query: 66 DPEKKSHYD 74
          D E +S YD
Sbjct: 60 DGELRSRYD 68

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y VLGV+  A   EIK AYRK A++ HPDK  D       E KF+ +  AY++LS
Sbjct: 3  KDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEA---ETKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          D E +S YD +
Sbjct: 60 DTELRSRYDQF 70

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L + + A  +EIK+AYR+L+ K HPDK  +  S++ ++ KF E+  AY++LSDPEKK
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLY 76
            YD +
Sbjct: 82 KIYDQF 87

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 104/237 (43%), Gaps = 32/237 (13%)

Query: 138 LTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G  + F L     C  CHGSG    K        +C  C G+G   ++ R G
Sbjct: 146 LSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGKL------AQCPDCQGRGVIIQVLRMG 199

Query: 198 PGLVASQWV--MCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFND 255
              + +Q +  MC +C G G+        KN C  C G  +  + +   V V PG   N 
Sbjct: 200 ---IMTQQIQQMCGRCGGTGQV------IKNECKTCHGNKVTKRNKFFHVDVPPGAPRNY 250

Query: 256 VITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEA 315
           + T  G A E+      GDL     E+     ++ +  +  GD    + Y +  +S+ EA
Sbjct: 251 MDTRAGEA-EKGPDFDAGDLVIEFKEKD----SENMGYRRRGD----NLYRTEVLSIEEA 301

Query: 316 L-TGFEKFLTKTFDDRLLTLSIKPGRV-IRPGDVLKITNEGWPILDDARGRCGDLYV 370
           L  G+E+ +    +++ + LS +P  V +  G++  +   G P     +G  GDLY+
Sbjct: 302 LYGGWERTIEFLDENKPVKLS-RPAYVGVSNGEIEVMKGFGMP--KGGKGY-GDLYI 354

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y VLGVT +A   +IK AYRK A++ HPDK+ D       + KF+ +  AY++LS
Sbjct: 3  KDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEA---QSKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP  +S YD +
Sbjct: 60 DPGLRSKYDQF 70

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y +LGV  DA   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LS
Sbjct: 3  KDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDA---QAKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP  +S YD +
Sbjct: 60 DPGLRSRYDEF 70

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VLGV   A   EIK AYR+ A++ HPDK+ D       + KF+E+  AY++LSDP  +
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPE---AQAKFQEVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SRYDEF 70

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y +LG+  DA   +IK AYRK A+  HPDK+ D       + KF+ I  AY++LS
Sbjct: 3  KDTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEA---QAKFQAIGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP+ +S YD +
Sbjct: 60 DPDLRSRYDEF 70

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + AD  EIK +YRKLA+K HPDK     + +     FK I  A+E+LSD EK
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGEA----FKVINRAFEVLSDDEK 80

Query: 70 KSHYD 74
          +S +D
Sbjct: 81 RSVFD 85

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y +L V+ DA  QEIK +YRKLA+K HPDK  D       + KF+E+  AY++L 
Sbjct: 3  KDTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQA---QTKFQELAKAYQVLI 59

Query: 66 DPEKKSHYDLY 76
          D + +  YD +
Sbjct: 60 DDDLRKKYDQF 70

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y VLG++ +A   EIK AYRK+A+  HPDK+ D       + KF+ +  AY++L+
Sbjct: 3  KDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPE---AQAKFQAVGEAYQVLN 59

Query: 66 DPEKKSHYDLY 76
          DP  +  YD +
Sbjct: 60 DPALRKQYDEF 70

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+  AD  E+K A+R+ AL++HPDK  ++D+ +     F +I AAYE+L+DP+++
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDK--NRDNVEEATETFAQIRAAYEVLNDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y VL V R +D  EIK +YRKLA+K HPDK     + +     FK I  A+E+LSD EK
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASEA----FKVINRAFEVLSDNEK 78

Query: 70 KSHYD 74
          +  +D
Sbjct: 79 REIFD 83

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V R A   EIK AYRKLA+K HPDK     + +     FK I  A+E+LS+ EK
Sbjct: 22 FYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +S YD
Sbjct: 78 RSIYD 82

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++ + Y +LGV  +A   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LS
Sbjct: 3  KDTQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEA---QSKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP  +S YD +
Sbjct: 60 DPGLRSRYDEF 70

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   E+K AYRK AL++HPDK  + D+ +    KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDK--NPDNVEEATQKFAVIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L +  DA  +EIK AYR   L  HPDK     +  VN +   +I  AY+ILS+ +K+
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +    Y +LG+  DA   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LS
Sbjct: 3  KETEYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP  +S YD +
Sbjct: 60 DPGLRSKYDEF 70

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   E+K AYRK AL++HPDK  D + ++  E KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYRKL++K HPDK    +  D KDV E  + +IT AYE L+D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDK--YVDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y +LGV +++D + I+ AY  L  K+HPDK   + Q  ++ N  K  EI  AYEIL D  
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 69  KKSHYD 74
           KK  YD
Sbjct: 616 KKKEYD 621

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV +DA   +IK AY KLA + HPD   D+ +    E KF ++  AYEILSD  K+
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEGA----EKKFHDLQNAYEILSDENKR 98

Query: 71  SHYDLY 76
             YD +
Sbjct: 99  RQYDQF 104

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 79/219 (36%), Gaps = 34/219 (15%)

Query: 146 GKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQW 205
           G  L+   +R V C  CHG+G +   R        C  C G+G   R           + 
Sbjct: 208 GSGLKAGAQRSV-CGGCHGTGTQVHVRAGFQMASTCSQCSGEGYSIR-----------RG 255

Query: 206 VMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITIEGMADE 265
             C  C G+G      K  K   P     GLQ       V+  PG      I ++     
Sbjct: 256 DRCGTCSGEGVVFNRNKEVKMDFPH----GLQDGD----VVKVPGQGSFPHIQVDPKTAH 307

Query: 266 EIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTGFEKFLTK 325
            + +   GDL   +   ++  F     +KN    N +  YV      + AL G       
Sbjct: 308 TM-RLRRGDLLVQVQVERDPRFQ----IKN----NYDIWYVQEIPITTAALGG--TVSIP 356

Query: 326 TFDDRLLTLSIKPGRVIRPGDVLKITNEGWPI-LDDARG 363
           T D   + L + PG   +P  V+ I N+G P  L  ARG
Sbjct: 357 TVDGDQIRLKVIPG--TQPDQVVSIPNKGVPRGLSGARG 393

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   E+K AYRK AL+ HPDK  + D+ D     F  I AAYE+LSDP+++
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDK--NPDNVDEATENFATIRAAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y VL + R+A   EIK AYRKLA+K HPDK     + +     FK I  A+E+LSD +K
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQK 78

Query: 70 KSHYD 74
          +  +D
Sbjct: 79 RRIFD 83

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 98/232 (42%), Gaps = 26/232 (11%)

Query: 138 LTMKDLYMGKK---LRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLK 194
           ++ KD   G K   LRF       C  C G+G K       TH+V C +C G G+   + 
Sbjct: 208 VSFKDAVFGSKNVQLRFSALDP--CSTCSGTGMKPN-----THKVSCSTCHGTGTTVHI- 259

Query: 195 RFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQ-SKKEVITVIVAPGHHF 253
           R G  ++++    C  C+G+G  ++    P++ C  C G G+Q ++ + ITV +  G   
Sbjct: 260 RGGFQMMST----CPTCNGEGTMKR----PQDNCTKCHGEGVQVNRAKTITVDLPHGLQD 311

Query: 254 NDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLK--NFGDGNMEDSYVSVTIS 311
            DV+ I G        A   DL+  +   + D   +    K  NF   N  D +    I 
Sbjct: 312 GDVVRIPGQGSYP-DIAVEADLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIP 370

Query: 312 LSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG 363
           ++ A  G       T + + + + + PG   +   V+ I N G P     RG
Sbjct: 371 ITTAALG-GTVTIPTVEGQKIRIKVAPG--TQYNQVISIPNMGVPKTSTIRG 419

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 6   RNNRL----YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAY 61
           RNN      Y  LG+ + A   EIK AY KLA K+HPD   + D+    E KF ++  AY
Sbjct: 54  RNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAY 109

Query: 62  EILSDPEKKSHYD 74
           EILSD  K+  YD
Sbjct: 110 EILSDETKRQQYD 122

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 5/72 (6%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYV-DQDSKDVNEIKFKEITAAYEIL 64
          ++   Y  LG++ DA   EIK AYRK A+  HPDK+  D D+    + KF+ +  AY++L
Sbjct: 3  KDTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDA----QAKFQAVGQAYQVL 58

Query: 65 SDPEKKSHYDLY 76
          SDP  +S YD +
Sbjct: 59 SDPGLRSRYDEF 70

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 6/66 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIK--FKEITAAYEILSDPE 68
          Y +L V  DA   ++K AYR+ AL++HPDK  D    +V E    F EI AAYE+LSDP+
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPD----NVEEATTIFAEIRAAYEVLSDPQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y VL + R A   EIK +YRKLA+K HPDK     + +     FK I  A+E+LSD EK
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASEA----FKVINRAFEVLSDEEK 80

Query: 70 KSHYD 74
          +  YD
Sbjct: 81 RRLYD 85

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 7   NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDK--YVDQDSKDVNEIKFKEITAAYEIL 64
           N   Y +LG++++A  ++I+ AY +L  ++HPDK  ++ +  +  N  K  EI  AYE L
Sbjct: 557 NKDYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETL 616

Query: 65  SDPEKKSHYD 74
           SD  KKS YD
Sbjct: 617 SDEAKKSEYD 626

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VLGV+  A   EIK AYRK A++ HPDK+ D       + KF+ +  AY++LSD E +
Sbjct: 8  YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPD---AQAKFQRVGEAYQVLSDEELR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 KRYDEF 70

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 8  NRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDP 67
          ++ Y +L V R A+  EIK +YRKLA++ HPDK     + +     FK I  A+E+L D 
Sbjct: 21 HQFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEA----FKLINRAFEVLGDS 76

Query: 68 EKKSHYD 74
          EK+S YD
Sbjct: 77 EKRSLYD 83

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LGV+  A  +EIK+AYRKL+LK HPDK    + ++ K+  E  + +I+ AYE L+D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 68  EKKSHYDLY 76
             K +Y +Y
Sbjct: 182 LVKQNYLMY 190

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV+RDA   +IK AY KLA K+HPD   +  +       F  +  AYEILSD +KK
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKT----FHNLQNAYEILSDEKKK 105

Query: 71  SHYDLY 76
             YD Y
Sbjct: 106 LQYDQY 111

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 13/104 (12%)

Query: 159 CMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYR 218
           C  CHGSG K  ++        C  C G G++  +K    G   +    C  CHG+G   
Sbjct: 213 CGTCHGSGLKNGEQ---HKRKTCSYCNGTGTQVHVK---SGFQMAS--TCMHCHGEG--- 261

Query: 219 KSPKNPKNFCPDCAGVGLQ-SKKEVITVIVAPGHHFNDVITIEG 261
            +    ++ C  C G G++ + K+ + V    G    DVI I G
Sbjct: 262 -TTIAREDTCSACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPG 304

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 5/70 (7%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDK----YVDQDSKDVNEIKFKEITAAYEILSD 66
           Y +LGVT  +  +EIK AYR L+LK HPDK      +++   + EI F +I+ AYE L++
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEI-FVQISKAYEALTN 181

Query: 67  PEKKSHYDLY 76
           P  K +Y LY
Sbjct: 182 PATKENYLLY 191

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L V   AD  E+K AYR+ AL++HPDK   ++ ++  EI F  I AAYE+LSDP+++
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNP-ENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V R A   +IK AYRKLA+K HPDK     + +     FK I  A+E+LS+ EK
Sbjct: 22 FYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +S YD
Sbjct: 78 RSIYD 82

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 99/231 (42%), Gaps = 24/231 (10%)

Query: 138 LTMKDLYMG-KKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRF 196
           ++ KD   G K ++        C  C G+G K       TH+V C +C G GS   + R 
Sbjct: 212 VSFKDAVFGAKNVQLKFSALDPCGTCSGTGMKPN-----THKVSCTTCHGSGSTVHV-RG 265

Query: 197 GPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK-EVITVIVAPGHHFND 255
           G  ++++    C  C+G+G  ++    P++ C  C G G+Q+ + + ITV +  G    D
Sbjct: 266 GFQMMST----CPTCNGEGTMKR----PQDNCTSCHGEGVQANRGKSITVDLPHGLQDGD 317

Query: 256 VITIEGMAD-EEIGKAACGDLRFHLNERQEDWFAKQVFLKN--FGDGNMEDSYVSVTISL 312
           V+ I G     +I   A  DL+  +   + D   +    K+  F   N  D +    I +
Sbjct: 318 VVRIPGQGSYPDIAVEA--DLQDSIKLSRGDILVRIRVDKDPSFSIRNKYDIWYDKEIPI 375

Query: 313 SEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG 363
           + A  G       T D + + + + PG   +   V+ I N G P     RG
Sbjct: 376 TTAALG-GTITIPTVDGQKIRIKVAPG--TQYNQVISIPNMGVPRTATLRG 423

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LG+ + A   EIK AY KLA K+HPD   + D+    E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSDDTKR 118

Query: 71  SHYD 74
             +D
Sbjct: 119 QQFD 122

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + A   EIK AYRKLA+K HPDK     + +     FK I  A+E+LS+ EK
Sbjct: 22 FYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEA----FKVINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +S YD
Sbjct: 78 RSIYD 82

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDK--YVDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y +L V ++A+ ++I+ AY +L  K+HPDK   + ++ +  NE K   I  AYEILSD  
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 569 KRKEYDL 575

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + A+  EIK AYRKLA+K HPDK     + +     FK I  A+E+LSD EK
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASEA----FKIINRAFEVLSDVEK 78

Query: 70 KSHYD 74
          +  YD
Sbjct: 79 RQLYD 83

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +    Y VLG+   A   EIK AYR+ A++ HPDK+ D  +      +F+++  AY++LS
Sbjct: 3  KETEYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP+ +  YD +
Sbjct: 60 DPDLRKQYDEF 70

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  +A   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LSDP  +
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDA---QAKFQAVGEAYQVLSDPGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L V+  A   E+K AYRK AL++HPDK  ++++ +     F EI AAYE+LSDP+++
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDK--NRENPEEATAIFSEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          +    Y +LG+  +A   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LS
Sbjct: 3  KETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          DP  +S YD +
Sbjct: 60 DPGLRSKYDQF 70

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   E+K AYRK AL+ HPDK  D + ++  EI F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYRKL++K HPDK    +  D K V E  + +IT AYE L+D 
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 3/66 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LGV+  A  ++IK+AYRKL++K HPDK    +  D K+V E  + +IT AYE L+D 
Sbjct: 127 YEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

Query: 68  EKKSHY 73
             + +Y
Sbjct: 187 LVRQNY 192

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          YGVLGV   A   EIK AY KLA ++HPD  +++++    E KF ++  AYEILSD  K+
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPD--INKEAG--AEKKFHDLQNAYEILSDESKR 92

Query: 71 SHYD 74
            +D
Sbjct: 93 KQFD 96

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 75/216 (34%), Gaps = 52/216 (24%)

Query: 159 CMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYR 218
           C  C GSG K   R        C  C G+G+             +   +C  CHG+    
Sbjct: 231 CPGCQGSGTKIHVRGGFQMMSTCNECQGEGT-----------TVNSSDLCGACHGE---- 275

Query: 219 KSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITIEGMAD-EEIG--------- 268
                         GV     KE ITV +  G    DVI I G     E+          
Sbjct: 276 --------------GVHFHRGKE-ITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSV 320

Query: 269 KAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTGFEKFLTKTFD 328
           K   GD+  ++   ++  F  +         +  D + ++ I ++ A  G       T D
Sbjct: 321 KLTRGDVLVNVRVEEDPTFTIR---------DKSDIWYTMEIPITTAALG-GTVQVPTVD 370

Query: 329 DRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGR 364
              + L + PG   + GDV+ + N G P  +  R R
Sbjct: 371 GSHIRLKVAPG--TQSGDVITVPNMGVPRSNLTRSR 404

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   E+K AYRK AL+ HPDK  D +  +  EI F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPD-NVDEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 7   NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDK--YVDQDSKDVNEIKFKEITAAYEIL 64
           N   Y +LGV +++ ++EI+ +Y  L  K+HPDK   + ++ ++ N  K ++I  AYE L
Sbjct: 602 NKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECL 661

Query: 65  SDPEKKSHYDL 75
           SD  K+  YDL
Sbjct: 662 SDESKRKEYDL 672

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 89/208 (42%), Gaps = 21/208 (10%)

Query: 159 CMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYR 218
           C  C G+G K       TH+V C +C G G+   + R G  ++++    C  C+G+G  +
Sbjct: 229 CSTCSGTGMKPN-----THKVNCSTCHGTGTTVHI-RGGFQMMST----CPTCNGEGTMK 278

Query: 219 KSPKNPKNFCPDCAGVGLQ-SKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRF 277
           +    P++ C  C G G+Q ++ + ITV +  G    DV+ I G        A   DL+ 
Sbjct: 279 R----PQDSCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYP-DIAVEADLKD 333

Query: 278 HLNERQEDWFAKQVFLK--NFGDGNMEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLS 335
            +   + D   +    K  NF   N  D +    I ++ A  G       T + + + + 
Sbjct: 334 TVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTAALG-GTVTIPTVEGQKIRIK 392

Query: 336 IKPGRVIRPGDVLKITNEGWPILDDARG 363
           + PG   +   V+ I N G P     RG
Sbjct: 393 VAPG--TQYNQVISIPNMGVPKTTTIRG 418

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 2   SDSDRNNRL----YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEI 57
           S + RNN      Y  LG+ + A   EIK AY KLA K+HPD   + D+    E KF ++
Sbjct: 50  SSAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEVDA----EKKFHDL 105

Query: 58  TAAYEILSDPEKKSHYD 74
             AYEILSD  K+  YD
Sbjct: 106 QNAYEILSDENKRQQYD 122

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG++  A   EIK AYRK ++K HPDK  +  S      +F+ I+ AY++LSD + +
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 71 SHYDLY 76
          S+YD Y
Sbjct: 65 SNYDKY 70

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 4  SDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEI 63
          S   +  Y VL V + A   EIK AYRKLA+K HPDK     + +     FK I  A+E+
Sbjct: 17 SKDKHAFYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEV 72

Query: 64 LSDPEKK 70
          LSD +K+
Sbjct: 73 LSDEQKR 79

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYRKL++K HPDK    +  D K V E  + +IT AYE L+D 
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDE 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 LVRQNYLKY 195

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  DA+  E++ AYR+  L+ HPDK    D   V  I+      AY +LSDP ++
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQ-----QAYRVLSDPTQR 60

Query: 71 SHYD 74
          S YD
Sbjct: 61 SAYD 64

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIK--FKEITAAYEILSDPE 68
          Y +LGV  +A   E+K AYR+ AL+ HPDK  D    +V E    F  + AAYE+L+DP+
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDKNPD----NVEETTAIFASVRAAYEVLADPQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQ------DSKDVNEIKFKEITAAYEIL 64
          Y VL +  DA +QEIK AY++  L  HPDK   Q       + D+  +   +I  AY+IL
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 65 SDPEKKSHYD 74
          S+   +  YD
Sbjct: 71 SNESTREQYD 80

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 2/71 (2%)

Query: 7   NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI--KFKEITAAYEIL 64
           N   Y +L V++DA  ++I+ +Y  L  K HPDK      K+  +I  K  EI  AYE+L
Sbjct: 525 NKDYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVL 584

Query: 65  SDPEKKSHYDL 75
           SD  K++ YDL
Sbjct: 585 SDETKRNEYDL 595

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI--KFKEITAAYEILSDPE 68
          Y +LGV   A   E+K AYRK AL++HPDK  D    +V E   KF  I AAYE+LSD +
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD----NVEEATEKFAIIRAAYEVLSDSQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L +  DA  +EIK AYR   L  HPDK   + S  VN +    I  AY++LS+ + +
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 11/73 (15%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI-------KFKEITAAYEI 63
           Y +LGVT  +  +EIK+AYRKL++K HPDK     SKD+NEI       +F  I  AY+ 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKL----SKDLNEIERTAMEEQFVMINKAYKA 168

Query: 64  LSDPEKKSHYDLY 76
           L+D   K +Y  Y
Sbjct: 169 LTDEITKENYRKY 181

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGVT  A   EIK AYRK +++ HPDK  ++D     E +F+ I+ AY++LSD + +
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDK--NRDDPMATE-RFQAISEAYQVLSDEDLR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 GKYDRF 70

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + A   EIK AYRKLA+K HPDK     + +     FK I  A+E+LS+ EK
Sbjct: 22 FYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEA----FKIINRAFEVLSNEEK 77

Query: 70 KSHYD 74
          +  YD
Sbjct: 78 RGLYD 82

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY--VDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y +LGV + A  ++++ +Y +L  K HPDK   ++ + +  NE K  EI  AYEILSD +
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 69  KKSHYD 74
           K++ YD
Sbjct: 590 KRTKYD 595

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI--KFKEITAAYEILSDPE 68
          Y +LGV   A   E+K AYRK AL++HPDK  D    +V E   KF  I AAYE+LSD +
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD----NVEEATQKFAIIRAAYEVLSDSQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   ++K AYRK AL +HPDK  ++D+ +     F  I AAYE+L+DP+++
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDK--NRDNVEEATAIFATIRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   E+K AYRK AL++HPDK   +  ++  EI F  I  AYE+LSDP+++
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTK-VEEATEI-FATIRTAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V R +   EIK AYRKLA++ HPDK     + +     FK I  A+E+LSD EK
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASEA----FKIINRAFEVLSDNEK 77

Query: 70 KSHYD 74
          +  +D
Sbjct: 78 RRIFD 82

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   ++K AYR+ AL++HPDK +  + +   EI F  I AAYE+LSD +++
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIG-NVQQATEI-FASIRAAYEVLSDAQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+T  A   EIK AYRK ++K HPDK  +  +      +F++I+ AY++LSD   +
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDEHLR 64

Query: 71 SHYDLY 76
          ++YD +
Sbjct: 65 NNYDQF 70

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 6/66 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI--KFKEITAAYEILSDPE 68
          Y +LGV   A   E+K AYRK ALK+HPDK    +  +V E    F  I  AYE+LSDP+
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDK----NPNNVEEATQAFATIRLAYEVLSDPQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 5/70 (7%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVN-EIKFKEITAAYEIL 64
          ++   Y +LGV  +A   EIK AYR+ A++ HPDK+ +    D N + KF+ +  AY++L
Sbjct: 3  KDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPN----DPNAQAKFQAVGEAYQVL 58

Query: 65 SDPEKKSHYD 74
          SD E +  YD
Sbjct: 59 SDDELRKRYD 68

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y VL V R A   EIK AYR+LA+K HPDK     S +     FK I  A+E+L D +K
Sbjct: 24 FYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEA----FKVINRAFEVLGDEDK 79

Query: 70 KSHYD 74
          +  +D
Sbjct: 80 RRLFD 84

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON}
          Anc_1.185 YJL162C
          Length = 586

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+T  A V EI+ +Y KLA   HPDK     S+++    FK ++ A+ IL DPE K
Sbjct: 16 YSVLGLTSKASVSEIRKSYMKLAKSLHPDKSKSNASEEL----FKIVSNAHSILIDPELK 71

Query: 71 SHYD 74
            YD
Sbjct: 72 LDYD 75

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 82/197 (41%), Gaps = 41/197 (20%)

Query: 159 CMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYR 218
           C  CHGSG K   + H     +C SC G G K  + R G  +V++    C +CHG+G   
Sbjct: 222 CHTCHGSGIKQGAQKH-----QCPSCHGSGQKVHI-RSGFQMVST----CNECHGEGTIL 271

Query: 219 KSPKNPKNFCPDCAGVGLQ-SKKEVITVIVAPGHHFNDVITIEGMA-------DEEIG-- 268
               N  ++C  C G  ++ ++   I V +  G    DVI I G         D E+   
Sbjct: 272 ----NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALDPELKNS 327

Query: 269 -KAACGDL----------RFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALT 317
            K   GD+          RF + ++ + WF K + +     G +      VTI   +  T
Sbjct: 328 VKLTRGDVLVRIRVDKDNRFSIKDKYDIWFTKDIPITTAALGGI------VTIPTVDGTT 381

Query: 318 GFEKFLTKTFDDRLLTL 334
              K    T  D+++++
Sbjct: 382 LRLKVQAGTQHDQVISI 398

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y VLG+ + A   EIK AY KLA K+HPD     + +   E KF ++  AYEILSD  KK
Sbjct: 53  YKVLGINKSATSSEIKKAYYKLAKKYHPDI----NKEPTAEKKFHDLQNAYEILSDETKK 108

Query: 71  SHYDLY 76
           S YD +
Sbjct: 109 SQYDTF 114

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + A   EIK AYRKLA++ HPDK     + +     FK I  A+E+LSD  K
Sbjct: 25 FYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEA----FKRINRAFEVLSDVGK 80

Query: 70 KSHYD 74
          +  +D
Sbjct: 81 RRMFD 85

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI--KFKEITAAYEILSDPE 68
           Y VLG+++ A  +EI+ AY  L  K+HPDK      K+  +I  K  ++  AYEILSD  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 69  KKSHYD 74
           KK  YD
Sbjct: 584 KKRDYD 589

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 6/66 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIK--FKEITAAYEILSDPE 68
          Y +LGV   A   ++K AYR+ AL++HPDK  D    +V E    F  I +AYE+L+DP+
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPD----NVEEATTVFATIRSAYEVLADPQ 61

Query: 69 KKSHYD 74
          +++ YD
Sbjct: 62 ERAWYD 67

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y  LG++  A   EIK AYR+ A++ HPDK+ D       E KF+ +  AY++LS
Sbjct: 3  KDTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEA---ENKFQAVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          D   ++ YD Y
Sbjct: 60 DESLRARYDEY 70

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDK---YVDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG+  DA+ ++I+ AY  L  K+HPDK     D +   V E K   I  AYE+LSD 
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEE-KMSSINEAYEVLSDE 569

Query: 68  EKKSHYDL 75
            K+  YD+
Sbjct: 570 SKRKEYDM 577

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYRKL++K HPDK    + Q+ +   E K+ +IT AYE L+D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 68  EKKSHYDLY 76
             K ++  Y
Sbjct: 183 VIKENFLKY 191

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 90/208 (43%), Gaps = 21/208 (10%)

Query: 159 CMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYR 218
           C  C G+G K       TH+V C +C G G+   + R G  ++++    C  C+G+G  +
Sbjct: 235 CGTCSGTGMKPN-----THKVNCGTCHGTGTTVHI-RGGFQMMST----CPTCNGEGTMK 284

Query: 219 KSPKNPKNFCPDCAGVGLQ-SKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRF 277
           +    P++ C  C G G+Q ++ + ITV +  G    DV+ I G        A   DL+ 
Sbjct: 285 R----PQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYP-DIAVEEDLKD 339

Query: 278 HLNERQEDWFAKQVFLK--NFGDGNMEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLS 335
            +   + D   +    K  NF   N  D + +  I ++ A  G       T + + + + 
Sbjct: 340 SVKLSRGDILVRIRVDKDPNFSIKNKYDIWYNKEIPITTAALG-GTVTIPTVEGQKIRIK 398

Query: 336 IKPGRVIRPGDVLKITNEGWPILDDARG 363
           + PG   +   V+ I N G P     RG
Sbjct: 399 VAPG--TQYNQVISIPNMGVPKTPTIRG 424

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LG+ + A   EIK AY KLA K+HPD   + D+    E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA----EKKFHDLQNAYEILSDESKR 118

Query: 71  SHYDLY 76
             YD +
Sbjct: 119 QQYDQF 124

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+  A   EIK AYRK +++ HPDK  + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPN-DPKATE--RFQAISEAYQVLGDDELR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 AKYDKY 70

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V R +   +IK AYRKLA+K HPDK     + +     FK I  A+E+LSD +K
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEA----FKLINRAFEVLSDSQK 77

Query: 70 KSHYD 74
          +  YD
Sbjct: 78 RQIYD 82

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  +A   EIK AYR+ A++ HPDK+ D       + KF+ +  AY++LSD   +
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDA---QAKFQAVGEAYQVLSDQGLR 64

Query: 71 SHYDLY 76
          S YD +
Sbjct: 65 SKYDEF 70

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          ++   Y +LG+   A   EIK AYRK A++ HPDK+ D       + KF+ +  AY++LS
Sbjct: 3  KDTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPD---AQSKFQSVGEAYQVLS 59

Query: 66 DPEKKSHYDLY 76
          D + +  YD +
Sbjct: 60 DDDLRKRYDEF 70

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+ DA   EIK AYRK +++ HPDK  + D K     +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPN-DPKATE--RFQAISEAYQVLSSDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDK--YVDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y VLGV + A  ++I+ +Y  +  K+HPDK   + +  K  N+ K  EI  AYEILSD  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 69  KKSHYD 74
           K+  YD
Sbjct: 567 KRKEYD 572

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V R A+  EIK AYRKLA+K HPDK     + +     FK I  A+E+L + EK
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAEA----FKLINRAFEVLGNSEK 78

Query: 70 KSHYD 74
          +  ++
Sbjct: 79 REIFN 83

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          N   Y +LGV  ++   EIK AYRK ++K HPDK  + ++ D  + KF+ I+ AY++LSD
Sbjct: 4  NTEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDK--NPNNPDATK-KFQAISEAYQVLSD 60

Query: 67 PEKKSHYDLY 76
             +S+YD +
Sbjct: 61 KNLRSNYDKF 70

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L V  DA   ++K AYRK AL +HPDK  + + ++  E+ F +I AAYE+LSD +++
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRN-NIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L V   A   ++K AYR+ AL++HPDK ++ + K+  +I F  I  AYEILSDP+++
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNIN-NIKEATDI-FANIRTAYEILSDPQER 63

Query: 71 SHYD 74
            YD
Sbjct: 64 VWYD 67

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  +EIK+AYRKL++K HPDK    + +  +   E  + +IT AYE L+D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 68  EKKSHYDLY 76
             + ++  Y
Sbjct: 181 LTRQNFLKY 189

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LGV+  A  +EIK+AYRKL++K HPDK    +  +++   E  + +IT AYE L+D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 68  EKKSHYDLY 76
             K +Y  Y
Sbjct: 184 NVKENYLRY 192

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+T  A + +IK +Y+KLA + HPDK    +S ++    FK +  AY ILSD +++
Sbjct: 9  YSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSEL----FKIVVDAYSILSDVKER 64

Query: 71 SHYDL 75
            Y++
Sbjct: 65 EEYNI 69

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDS---KDVNEIKFKEI 57
           ++DS      Y +LG+  +A  +EI+ AY  L  K+HPDK   Q S   +  N+ K  EI
Sbjct: 533 LTDSQTAKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEI 592

Query: 58  TAAYEILSDPEKKSHYD 74
             AYE+L+D EK+  YD
Sbjct: 593 NEAYEVLNDEEKRKEYD 609

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKY----VDQDSKDVNEIKFKEITAAYEILSD 66
          Y VLGV  DA   EIK  YRK+ L  HPDK     +D   K  + +   +I  AY +LS+
Sbjct: 12 YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 67 PEKKSHYD 74
           + ++ Y+
Sbjct: 72 DQLRAAYN 79

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L + ++A   ++K AYRKLA+K HPDK     + +     FK+I  A+E+LSD  K
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEA----FKKINRAFEVLSDENK 80

Query: 70 KSHYD 74
          +  YD
Sbjct: 81 RKVYD 85

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L +  DA  +EIK AYR   L  HPDK        ++ +   +I  AY ILSD   +
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 CEYD 73

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDV--NEIKFKEITAAYEIL 64
          N   Y VL V   A + +IK AYR+  L  HPDK   Q ++     +   ++I  AY +L
Sbjct: 2  NKSHYEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVL 61

Query: 65 SDPEKKSHYD 74
          +DP ++  YD
Sbjct: 62 ADPTRREQYD 71

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + A   EIK +YRKLA+K HPDK     + +     FK I  A+E+L D +K
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASEA----FKRINRAFEVLGDEKK 80

Query: 70 KSHYD 74
          +  +D
Sbjct: 81 RVLFD 85

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYRKL+LK HPDK    + +  ++  E ++ +IT AYE L+D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 183 LIRFNYLTY 191

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV--DQDSKDVNEIKFKEITAAYEILSDPE 68
           Y +LGV+ +A+ +EI+ AY  L  K+HPDK      D K+       +I  AYE LSD +
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 604 KRKEYDL 610

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+  A   EIK AYRK +++ HPDK  + D K     +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPN-DPKATE--RFQAISEAYQVLGDNELR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 VKYDKY 70

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIK----FKEITAAYEILSD 66
          Y +LGV+  A   EIK AYRK +++ HPD       K+ N++K    F+ I+ AY++L D
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPD-------KNPNDLKATERFQAISEAYQVLGD 60

Query: 67 PEKKSHYDLY 76
           E ++ YD +
Sbjct: 61 DELRAKYDKF 70

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 10 LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
           Y +L V + A   +IK AYRKLA+K HPDK     + +     FK+I  A+E+LSD  K
Sbjct: 23 FYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEA----FKKINRAFEVLSDDSK 78

Query: 70 KSHYD 74
          +  +D
Sbjct: 79 RRIFD 83

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY--VDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y VL VT  A  ++I+ +Y  +  K+HPDK   + +  K  N+ +  EI  AYEILSD  
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 69  KKSHYD 74
           K+  YD
Sbjct: 565 KRKEYD 570

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV  DA   +IK AYRK ++K HPDK  D  +      +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEELR 64

Query: 71 SHYDLY 76
            YD +
Sbjct: 65 MKYDKF 70

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 100/242 (41%), Gaps = 44/242 (18%)

Query: 138 LTMKDLYMGKK-LRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRF 196
           L+ KD   G + +  ++     C  C GSG K       +H  EC SC G G+   + R 
Sbjct: 203 LSFKDAVFGSRNVTLNVSSIEQCKTCTGSGMKPG-----SHRSECSSCHGTGTTVHV-RA 256

Query: 197 GPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSK--KEVITVIVAPGHHFN 254
           G  + ++    C  C G G+        ++ C +C G G + +  +  + V + PG    
Sbjct: 257 GFQMAST----CMSCGGTGENIAR----EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDG 308

Query: 255 DVITIEG--------MADEEIG--KAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDS 304
           DVI + G        +A E+    K   GDL   +  +Q+  F+ +         N  + 
Sbjct: 309 DVIRVAGQGGYPNIAIAPEQRDQVKVTRGDLLVRIRVKQDKVFSIR---------NGNEL 359

Query: 305 YVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGR 364
           + +  I ++ A+ G    +  T D   L L ++ G   R G+ + +  +G P     RGR
Sbjct: 360 WQTREIPVTTAVLG-GNVVIPTLDGNQLRLRVRSG--TRDGETVSVPGQGVP-----RGR 411

Query: 365 CG 366
            G
Sbjct: 412 GG 413

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y VLG+ +DA   EIK AY KLA K+HPD   D+ S    + KF +IT AYEILSD +KK
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGS----DKKFHDITNAYEILSDEKKK 104

Query: 71  SHYDLY 76
             YD +
Sbjct: 105 MQYDQF 110

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 6/65 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPD-KYVDQDSKDVNEIKFKEITAAYEILSDPEK 69
          Y VLG+  DAD   IK AYR+  L+ HPD K +  +S  V++++      AY +L D E 
Sbjct: 6  YSVLGIDSDADSDTIKKAYRRRLLETHPDKKQISNESLSVDQLQ-----KAYRVLIDKEL 60

Query: 70 KSHYD 74
          ++ YD
Sbjct: 61 RAKYD 65

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+ +A   EIK AYRK +++ HPDK  +  S      +F+ I+ AY++LS+ E +
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNEELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 TKYDKF 70

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VL V  DA + EIK AYR   L  HPDK  D++   +N +    I  AY +LSD + +
Sbjct: 5  YEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDENKPALN-VSVNAIQEAYRVLSDEKLR 63

Query: 71 SHYD 74
            YD
Sbjct: 64 REYD 67

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY--VDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y +L + ++A+ +EI+ AY      +HPDK   + ++ +  N+ K  EI  AYE LSD  
Sbjct: 477 YKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDEKMSEINEAYETLSDEG 536

Query: 69  KKSHYDL 75
           K+  YD+
Sbjct: 537 KRREYDM 543

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYR+L+LK HPDK    +  + +   E  + +I+ A+E L+DP
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 187 IVRENYLKY 195

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 11/73 (15%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVN-------EIKFKEITAAYEI 63
           Y +LGV+  A  ++IK+AYRKL++K HPDK     SKD+        E  + +I+ AYE 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKL----SKDLGGEERARIEEMYVQISKAYEA 180

Query: 64  LSDPEKKSHYDLY 76
           L+D   K++Y  Y
Sbjct: 181 LTDEITKANYLTY 193

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 15 GVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKKSHY 73
           +TR   +QEIK  YR LALK+HPDK+ + DS  ++  KF EI+ A  IL+D +    Y
Sbjct: 24 ALTRRISIQEIKRQYRTLALKYHPDKHPN-DSNLIH--KFHEISIATNILTDEKLSEEY 79

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LG++  A  ++IK+AYRKL++K HPDK    + +  +   E  + +IT AYE L+D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 68  EKKSHYDLY 76
             + ++  Y
Sbjct: 191 AMRENFLKY 199

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+  A   EIK AYRK +++ HPDK  +  +      +F+ I+ AY++L D + +
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDDDLR 64

Query: 71 SHYDLY 76
          + YD Y
Sbjct: 65 AKYDKY 70

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 42/64 (65%), Gaps = 3/64 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+T +A   EIK AYRK +++ HPDK  + +     E +F+ I+ AY++LS+ E +
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDK--NPNDPGATE-RFQAISEAYQVLSNDELR 64

Query: 71 SHYD 74
          + YD
Sbjct: 65 AKYD 68

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 3/70 (4%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          +   Y +LG+   A   EIK AYRK +++ HPDK  + +     E +F+ I+ AY++LSD
Sbjct: 4  DTEYYELLGIETTATAVEIKKAYRKKSIEEHPDK--NPNDPGATE-RFQAISEAYQVLSD 60

Query: 67 PEKKSHYDLY 76
           + +++YD +
Sbjct: 61 SDLRANYDKF 70

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV+RDA   +IK AY KLA K+HPD   D+ +    E KF ++  AYEILSD  K+
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEGA----EKKFHDLQNAYEILSDESKR 108

Query: 71  SHYDLY 76
           S YD +
Sbjct: 109 SQYDQF 114

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 26/70 (37%), Gaps = 12/70 (17%)

Query: 146 GKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQW 205
           G  L+   KR   C  CHG+G +   R        C  C G+GS  R           + 
Sbjct: 224 GSGLKSGAKRSS-CSICHGTGTQMHVRAGFQMASTCTQCNGEGSSIR-----------RS 271

Query: 206 VMCEKCHGKG 215
             C  C G+G
Sbjct: 272 DQCSSCRGEG 281

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   + V EIK AY++  L  HPDK    ++++V+    +EI  AY++L +P  K
Sbjct: 8  YEILGVDTKSTVAEIKKAYKEKLLCTHPDKNRTVEAQNVS---IEEIKEAYQVLVNPSGK 64

Query: 71 SHYD 74
           +YD
Sbjct: 65 ENYD 68

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+   A   EIK AYRK ++K HPDK  + +     E +F+ I+ AY++LSD   +
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDK--NPNDPQATE-RFQAISEAYQVLSDESLR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 LKYDKY 70

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +LGV   A  +E+++AYRKL++K HPDK    + Q+ +   E ++  IT AY+ L+D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 68  EKKSHY 73
             K +Y
Sbjct: 178 ITKENY 183

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 5/72 (6%)

Query: 3  DSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYE 62
          D D+++  Y +L V   A   +IK AYRK+A+K HPDK     + +     FK++  A+E
Sbjct: 19 DKDKHS-FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFE 73

Query: 63 ILSDPEKKSHYD 74
          +LSD +K+  YD
Sbjct: 74 VLSDEKKRRVYD 85

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI---KFKEITAAYEILSDP 67
           Y +LGV+  A  +EI+ AY  L  K+HPDK +  +  D  E       +I  AYE LSD 
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDK-IKANHNDKQESIHETMSQINEAYETLSDD 598

Query: 68  EKKSHYDL 75
           +K+  YDL
Sbjct: 599 DKRKEYDL 606

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYV--DQDSKDVNEIKFKEITAAYEILSDPE 68
           Y  LGVT  A  +EI+ AY  L  K+HPDK      D K+       +I  AYE LSD  
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 600 KRKEYDL 606

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +L ++  +  +EI++AYRKL++K HPDK    +  D + V E ++  IT AY+ L+D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 177 ITRENYLRY 185

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI---KFKEITAAYEILSDP 67
           Y VLGV   A  +EI+ AY  L  K+HPDK +  +  D  E       +I  AYE LSD 
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDK-IKANHNDKEETIHETMSQINEAYETLSDD 595

Query: 68  EKKSHYDL 75
           +K+  YDL
Sbjct: 596 DKRKEYDL 603

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG++  A   EIK AYRK +++ HPDK  + +     E +F+ I+ AY++LSD   +
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSDDTLR 64

Query: 71 SHYDLY 76
            YD Y
Sbjct: 65 LKYDKY 70

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGVT  A  ++   AYR  A++ HPD      +      KF+E++ AY++LSDP+ K
Sbjct: 8  YDILGVTPSAFAEQNNKAYRMKAIQTHPDM---NPTHPYAHAKFQEVSKAYKVLSDPDLK 64

Query: 71 SHY 73
          + Y
Sbjct: 65 NRY 67

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +L +  DA   EIK AYR   L  HPDK        V+ +   +I  AY+ILS+ + +
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 REYD 73

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+ DA   +IK AYRK +++ HPDK  + D K     +F+ I+ AY++L   E +
Sbjct: 8  YDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPN-DPKATE--RFQAISEAYQVLGSDELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 13/78 (16%)

Query: 5  DRNNRLYGVLGVT-------RDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI-KFKE 56
          DR N LY VLG +       R     +++  YRKLAL++HPDK    +  D + I KF +
Sbjct: 11 DRVN-LYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDK----NPHDTSLIHKFHQ 65

Query: 57 ITAAYEILSDPEKKSHYD 74
          ++ A +ILSD   +S YD
Sbjct: 66 VSVATKILSDSRLRSLYD 83

>TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON}
          Anc_1.113 YJR097W
          Length = 168

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y VLGVT D+ + +IK AY++  L  HPDK   Q  K  N     +I  AY +L++   +
Sbjct: 11 YEVLGVTTDSTLMDIKRAYKEKLLNVHPDKNKGQAPKS-NTYSVNQIQEAYGVLAEQTLR 69

Query: 71 SHYD 74
          + YD
Sbjct: 70 TQYD 73

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 37/55 (67%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65
          Y  L ++ DA+  ++K +YR+L L++HPDK  +  +K+  + +F ++  +YE+L+
Sbjct: 14 YATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT 68

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDK--YVDQDSKDVNEIKFKEITAAYEILSDPE 68
           Y  LGV+++A+ ++I+ AY +L  K+HPDK   + Q+ +   + K   I  AYE L D  
Sbjct: 506 YKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYETLRDDS 565

Query: 69  KKSHYDL 75
           K+  YD+
Sbjct: 566 KRKEYDM 572

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+   A   EIK AYRK +++ HPDK  +  +      +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSEELR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV  DA  +EI  +YRKLA+K HPDK       D  E  FK +  A+ +L++ E++
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDK----SKSDKCEELFKLVVHAHSVLTNGEER 66

Query: 71 SHYD 74
          + Y+
Sbjct: 67 AKYN 70

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV   A   EIK AYRK ++  HPDK  ++D     E +F+ I+ AY++LS+ + +
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDK--NRDDPAATE-RFQSISEAYQVLSNKDLR 64

Query: 71 SHYD 74
          ++YD
Sbjct: 65 ANYD 68

>NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON}
          Anc_1.113 YJR097W
          Length = 174

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 1  MSDSDRNNRL--YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKD---VNEIKFK 55
          M+ +  NNRL  Y +L V  DA  Q+IK AY++  L  HPDK           ++ +   
Sbjct: 1  MTATTTNNRLNHYDILSVPSDASQQDIKRAYKERLLNIHPDKSSSSADSPPPTISHVTVN 60

Query: 56 EITAAYEILSDPEKKSHYDL 75
          +I  AY ILS PE ++ YD+
Sbjct: 61 QIQEAYRILSKPESRTKYDM 80

>ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 433

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 10  LYGVLGVTR---DADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
           LY  +G+++    A  ++I  ++RK  LKHHPDK       D +   FK I  AYE L D
Sbjct: 98  LYAAMGLSKLRYRATPEQIIKSHRKQVLKHHPDKKSAHGGLDQDGF-FKIIQKAYETLID 156

Query: 67  PEKKSHYD 74
           P KK+ YD
Sbjct: 157 PTKKAQYD 164

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKY---VDQDSKDVNEIKFKEITAAYEILSDP 67
           Y +L V+  +  +EI++AYRKL++K HPDK    +  + + + E ++  IT AY+ L+D 
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 68  EKKSHYDLY 76
             + +Y  Y
Sbjct: 179 VTRENYLKY 187

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIK-FKEITAAYEILSDPEK 69
          Y +LG+T DA   +IK AYRK+A+  HPDK     +K V+  + FK ++ A  +L D E+
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDK-----NKSVSAAELFKLVSHAQSVLIDKEQ 68

Query: 70 KSHYD 74
          +  Y+
Sbjct: 69 RQSYN 73

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 77/216 (35%), Gaps = 52/216 (24%)

Query: 158 VCMKCHGSGWKTKKRVHVTHEVECESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKY 217
            C  CHG+G     R        C  CGG+G+  R +            +C KCHG+G  
Sbjct: 218 TCPSCHGTGTTVHVRGGFQMASTCNQCGGEGTTVRPED-----------VCSKCHGEGVE 266

Query: 218 RKSPKNPKNFCPDCAGVGLQSKKEVITVIVAPGHHFNDVITIEGMADEEIGKAACGDL-- 275
             S ++     P     GLQ       V+  PG      + ++      + K   GD+  
Sbjct: 267 LNSQRSISVDLPQ----GLQDGD----VVRVPGQGSYPHLAVDPKMKNSV-KLHRGDVLV 317

Query: 276 --------RFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVTISLSEALTGFEKFLTKTF 327
                   RF +  + + WF K++ +     G        VTI               T 
Sbjct: 318 RIRVDKDSRFSIRNKTDIWFTKEIPITTAALGGQ------VTIP--------------TV 357

Query: 328 DDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG 363
           DD  + L ++PG   +   V+ I N G P +   RG
Sbjct: 358 DDTQIRLKVQPG--TQHDQVISIPNMGVPRIGGERG 391

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y  LGV ++A   EIK AY KLA K HPD   + ++    E KF ++  AYEILSD  KK
Sbjct: 38 YETLGVGKNASSSEIKKAYYKLAKKFHPDINKEPNA----EAKFHDLQNAYEILSDDTKK 93

Query: 71 SHYDLY 76
            YD +
Sbjct: 94 QQYDQF 99

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y  LG+  D  ++EIK AY++  L  HPDK  D+ S     ++  +I  AY++L D   +
Sbjct: 6  YETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDESSS----VEVNKIQEAYKVLCDVNLR 61

Query: 71 SHYD 74
            YD
Sbjct: 62 EKYD 65

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 7  NNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSD 66
          N   Y +LG+T +A   EI+ +Y  LA K HPDK   + + ++    FK +  A+ IL+D
Sbjct: 11 NTTHYSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGEL----FKLVVHAHSILTD 66

Query: 67 PEKKSHYD 74
           EKK  YD
Sbjct: 67 VEKKRAYD 74

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 11 YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+ DA   +IK AYRK +++ HPDK  + +     E +F+ I+ AY++LS  + +
Sbjct: 8  YDLLGVSPDAKSIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKDDLR 64

Query: 71 SHYDLY 76
          + YD +
Sbjct: 65 AKYDKF 70

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 7  NNR-LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDV-NEIKFKEITAAYEIL 64
          NNR  Y +LGV  D +  +IK AY+   L  HPDK      KDV N++  +EI  AY +L
Sbjct: 3  NNRSFYEILGVEADCNEVDIKKAYKAKLLSTHPDKV----GKDVGNKVLIEEIKEAYRVL 58

Query: 65 SDPEKKSHYD 74
           +   +  YD
Sbjct: 59 IESPSREKYD 68

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEI--KFKEITAAYEILSDPE 68
           Y +LG+ + A  ++I+ AY     K+HPDK      K+ ++I  K  +I  AYE LSD  
Sbjct: 496 YKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLSDDT 555

Query: 69  KKSHYD 74
           ++  YD
Sbjct: 556 RRKEYD 561

>KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 428

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 40/74 (54%), Gaps = 16/74 (21%)

Query: 10  LYGVLGVTR----DADVQEIKTAYRKLALKHHPDKY-----VDQDSKDVNEIKFKEITAA 60
           LY  +G+++      D Q IK A+RK  LKHHPDK      ++QD        FK I  A
Sbjct: 97  LYAAMGLSKLRHKATDAQVIK-AHRKQVLKHHPDKKSASGGLEQDGF------FKIIQKA 149

Query: 61  YEILSDPEKKSHYD 74
           YE L+DP K+  YD
Sbjct: 150 YETLTDPTKRKQYD 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,462,083
Number of extensions: 2019469
Number of successful extensions: 5597
Number of sequences better than 10.0: 373
Number of HSP's gapped: 5039
Number of HSP's successfully gapped: 471
Length of query: 455
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 342
Effective length of database: 40,524,141
Effective search space: 13859256222
Effective search space used: 13859256222
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)