Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1578.263ON59259231020.0
YLR089C (ALT1)8.263ON59259229520.0
Smik_12.1488.263ON59259228940.0
Suva_10.1738.263ON59259227900.0
TDEL0F039008.263ON55949921350.0
NCAS0B050208.263ON56849121230.0
NDAI0B019908.263ON58849921180.0
KNAG0G020408.263ON59149020740.0
ZYRO0C01628g8.263ON53448720620.0
KLLA0F19162g8.263ON52848620180.0
SAKL0H17006g8.263ON53148820060.0
CAGL0L12254g8.263ON57457620060.0
KAFR0B027308.263ON53948919580.0
Kpol_392.58.263ON51249618970.0
NCAS0B038408.263ON49749118350.0
KNAG0M012108.263ON52150018270.0
TPHA0J007508.263ON52249618260.0
KLTH0G13662g8.263ON51948118000.0
Smik_4.3578.263ON50749317940.0
TBLA0E044408.263ON56249217880.0
Skud_4.3728.263ON50748917660.0
YDR111C (ALT2)8.263ON50748917650.0
Kwal_56.237918.263ON51850617610.0
KAFR0B055308.263ON51449017550.0
Suva_2.2718.263ON50749317520.0
Kpol_543.398.263ON49248917220.0
NDAI0J013608.263ON50149717220.0
KAFR0B05520singletonON51049016850.0
Ecym_43078.263ON53451016730.0
TPHA0A018008.263ON49849016640.0
AGR085W8.263ON52148816470.0
TBLA0G01630singletonON50049716330.0
TBLA0F030608.263ON50049416090.0
Kwal_34.160181.472ON3791671402e-08
KLTH0G19646g1.472ON3791861303e-07
KLLA0F10021g3.511ON4971251206e-06
SAKL0F02156g3.511ON4981581198e-06
Kwal_23.48882.252ON3891241189e-06
KNAG0B006603.511ON4961251172e-05
Kpol_1032.398.204ON4531901152e-05
SAKL0D11528g1.472ON3831521143e-05
NCAS0E006703.511ON4972531153e-05
TPHA0D033703.511ON4971581153e-05
Kpol_1039.222.252ON3861691143e-05
KLLA0F03509g2.252ON3871701134e-05
TPHA0O014501.321ON4431681134e-05
Kpol_278.23.511ON4981251134e-05
NCAS0G040501.472ON3841641125e-05
KAFR0D014203.511ON4921601117e-05
Skud_10.1561.321ON4603701101e-04
NDAI0B045502.102ON5651701101e-04
Suva_6.1361.321ON4441861091e-04
Ecym_7228na 1ON4881561091e-04
CAGL0G01254g3.511ON5041231092e-04
Ecym_32902.252ON3861271062e-04
KLTH0G09614g2.252ON3891241062e-04
TDEL0D019001.321ON4431681063e-04
NDAI0G057601.321ON4481791045e-04
YJL060W (BNA3)1.321ON4441861036e-04
Kwal_47.189823.511ON4961241037e-04
ZYRO0A01672g2.252ON3861241028e-04
Smik_7.693.511ON5001221020.001
KNAG0G005501.472ON3872251010.001
SAKL0E08492g2.252ON3841261010.001
NDAI0B037302.252ON3861231010.001
ZYRO0G20636g1.321ON4533531010.001
NDAI0I028303.511ON5001321010.001
Kwal_14.25741.321ON443681000.001
Kwal_47.17462na 1ON4921281010.001
KLTH0G02002g3.511ON4961241000.001
CAGL0J05126g1.321ON4333701000.002
ZYRO0C06028g3.511ON496122990.002
YGL202W (ARO8)3.511ON500122990.002
ADL249W2.252ON387176980.002
Kpol_1035.231.321ON444168980.002
SAKL0H21824gna 1ON499125980.003
Smik_10.1801.321ON444168970.004
KLLA0A04906gna 1ON480124970.004
TDEL0A016008.204ON475183960.004
TPHA0F012602.252ON392124960.005
AGR167Wna 1ON512160960.005
NCAS0A092001.321ON445186960.005
KNAG0B053201.321ON433164950.006
KNAG0E018502.252ON384122940.007
Kpol_480.11.472ON380153940.008
KLTH0E07678gna 1ON492125940.008
Suva_7.613.511ON500132930.011
Smik_9.532.252ON388125920.014
Skud_7.693.511ON500122920.015
SAKL0E12188g2.102ON53051920.018
YIL116W (HIS5)2.252ON385123910.018
NCAS0B064402.252ON385123900.022
Suva_9.782.252ON386124900.025
Ecym_6319singletonON354137890.026
Kpol_431.132.475ON443431900.026
TDEL0D057903.511ON49760900.029
CAGL0I06578g8.204ON436177890.034
Smik_5.3198.204ON443178890.034
ZYRO0G05346g2.102ON50450880.043
TBLA0B080808.204ON444179880.043
SAKL0D06886g1.321ON447324880.043
TBLA0B009902.102ON54650880.044
TPHA0O015202.102ON50350880.044
KLTH0H10648g1.321ON44372870.052
Ecym_62921.321ON430132860.074
CAGL0G06028g2.102ON537169860.091
KLTH0B00176g8.204ON448183850.11
Skud_9.552.252ON385124840.11
AFR548C3.511ON497127850.11
KLLA0F01617g1.321ON44462840.12
KAFR0A017101.321ON435184840.12
SAKL0D14630g7.14ON27056830.14
CAGL0C01243g2.252ON383124830.15
KAFR0B007905.329ON14148790.17
KAFR0J015802.252ON383123830.18
Kwal_33.145822.102ON52550830.18
Kwal_26.77682.475ON422143820.21
TDEL0C040902.252ON383126820.21
KLTH0G19624gsingletonON468184820.22
NCAS0B072202.102ON51050820.24
Smik_8.2182.102ON513356810.36
KLTH0B06270g2.102ON52544800.48
TDEL0A025102.475ON426132770.92
AEL170C1.321ON45872761.1
KNAG0H037302.102ON52344761.2
YHR137W (ARO9)2.102ON513445761.2
TDEL0F009002.102ON49344761.4
Skud_8.1982.102ON517184751.5
KLLA0E00969g8.204ON445182742.1
ABL038W2.475ON443252742.1
KNAG0G016808.204ON45234742.3
Suva_5.2818.204ON45033742.4
Kwal_8.5858.204ON44644732.8
ZYRO0B11088g8.204ON45032732.8
KLTH0D00836g7.14ON20856704.4
Kwal_26.67957.14ON20856694.8
Suva_15.3342.102ON560141715.1
NDAI0G056201.294ON1165178715.8
TBLA0B093302.420ON40833706.1
KNAG0C027105.561ON293147698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.157
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...  1199   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...  1141   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...  1119   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...  1079   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   827   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   822   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   820   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   803   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   798   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   781   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   777   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   777   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   758   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   735   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   711   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   708   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   707   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   697   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   695   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   693   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   684   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   684   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   682   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            680   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   679   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   667   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   667   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   653   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   649   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   645   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   639   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              633   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   624   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    59   2e-08
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    55   3e-07
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    51   6e-06
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    50   8e-06
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    50   9e-06
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    50   2e-05
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    49   2e-05
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    49   3e-05
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     49   3e-05
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    49   3e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    49   3e-05
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    48   4e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    48   4e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    48   4e-05
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    48   5e-05
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    47   7e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    47   1e-04
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    47   1e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    47   1e-04
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    47   1e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    47   2e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    45   2e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    45   2e-04
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    45   3e-04
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    45   5e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    44   6e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    44   7e-04
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    44   8e-04
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    44   0.001
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       44   0.001
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    44   0.001
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    44   0.001
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    44   0.001
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    44   0.001
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    43   0.001
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    44   0.001
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    43   0.001
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    43   0.002
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    43   0.002
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    43   0.002
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    42   0.002
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    42   0.002
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    42   0.003
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    42   0.004
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    42   0.004
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    42   0.004
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    42   0.005
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    42   0.005
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    42   0.005
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    41   0.006
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    41   0.007
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    41   0.008
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    41   0.008
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    40   0.011
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    40   0.014
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    40   0.015
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    40   0.018
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    40   0.018
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    39   0.022
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    39   0.025
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    39   0.026
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    39   0.026
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    39   0.029
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    39   0.034
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    39   0.034
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    39   0.043
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    39   0.043
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    39   0.043
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    39   0.044
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    39   0.044
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    38   0.052
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    38   0.074
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    38   0.091
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.11 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    37   0.11 
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    37   0.11 
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    37   0.12 
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    37   0.12 
SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highl...    37   0.14 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    37   0.15 
KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.32...    35   0.17 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    37   0.18 
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    37   0.18 
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    36   0.21 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    36   0.21 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    36   0.22 
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    36   0.24 
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    36   0.36 
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    35   0.48 
TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.4...    34   0.92 
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    34   1.1  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    34   1.2  
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    34   1.2  
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    34   1.4  
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    33   1.5  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    33   2.1  
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    33   2.1  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.3  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   2.4  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   2.8  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    33   2.8  
KLTH0D00836g Chr4 complement(79191..79817) [627 bp, 208 aa] {ON}...    32   4.4  
Kwal_26.6795 s26 complement(66701..67327) [627 bp, 208 aa] {ON} ...    31   4.8  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    32   5.1  
NDAI0G05620 Chr7 (1389796..1393293) [3498 bp, 1165 aa] {ON} Anc_...    32   5.8  
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    32   6.1  
KNAG0C02710 Chr3 (532540..533421) [882 bp, 293 aa] {ON} Anc_5.56...    31   8.0  

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score = 1199 bits (3102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/592 (97%), Positives = 578/592 (97%)

Query: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60
           MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV
Sbjct: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60

Query: 61  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120
           LQRHSSSWVA              NDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV
Sbjct: 61  LQRHSSSWVAGQSHSRSLSGQSSLNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360
           YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK
Sbjct: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480

Query: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540
           HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS
Sbjct: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score = 1141 bits (2952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/592 (92%), Positives = 562/592 (94%)

Query: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60
           MLSLS KN  T SN IT +IKSYHIRTLT+S +KMP+I  PF T+AS+TKLKAFRKVRPV
Sbjct: 1   MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60

Query: 61  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120
           LQRHSSSW+               NDLRHLNRFPHHTLKT N++FYPAEQLTLEDVNENV
Sbjct: 61  LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFD+IINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RD+GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360
           YYLDE SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTKFHSMKKILR LQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE DQAERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480

Query: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540
           HEKLITRAMTLY+TFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCK 
Sbjct: 481 HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE+FHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/592 (90%), Positives = 555/592 (93%)

Query: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60
           M  LS K   T SN I+  IKSYHIRTLT+  +KMP+I+ PF T+ASNT LKAFRK+RPV
Sbjct: 1   MSYLSAKTHFTVSNSISQAIKSYHIRTLTSRAEKMPHISTPFTTSASNTNLKAFRKIRPV 60

Query: 61  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120
           LQRHSSSW+A              NDLRHLNRFPHHTLKT N++FYPAEQLTL+DVNENV
Sbjct: 61  LQRHSSSWIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKAKYAVRGAIPMRAEELKAQLEKDPQSLPF+KIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLNQNEQQLVDSKLFKLDAIKRAKSLME+IGGSVGAYSSSQGVEGIR+SVAEFITK
Sbjct: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITK 240

Query: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RD+GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241 RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360
           YYLDE SGWSTNPEEIETVVKEAI+NEIK TVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301 YYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGTKFHSMKKILR LQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP+EGEESFE DQAERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSI 480

Query: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540
           HEKLITRAMTLY TFNSLEGIECQKPQGAMYLFPKIDLPF+AVQEARHLELTPDEFYCK 
Sbjct: 481 HEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFD YRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score = 1079 bits (2790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/592 (88%), Positives = 552/592 (93%)

Query: 1   MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60
           MLSLS KN  T +N IT I+KSYHI+TLTTS KKMP+I   F TTAS+TKLKAFR+VRPV
Sbjct: 1   MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHITTSFTTTASSTKLKAFRQVRPV 60

Query: 61  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120
           LQRHSSSW+A               DLRHLNRFPHHTLKT N++FYPAEQLTL+DVNENV
Sbjct: 61  LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120

Query: 121 LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180
           LKA+YAVRGAIPMRAEELKAQLEKDPQSLPF+KIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121 LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 181 QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240
           QYPELLN NEQ+LV SKLFK+DAIKRAKSL++DIGGSVGAYSSSQGVEGIRKSVA+FITK
Sbjct: 181 QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240

Query: 241 RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300
           RD GE +YPEDIFLTAGASAAV YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ LP
Sbjct: 241 RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360
           YYLDE SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301 YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 361 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420
           YGTVVIADEVYQENIFPGT+F+SMKK+LR LQR+HPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361 YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480
           RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE DQ+ERNSI
Sbjct: 421 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480

Query: 481 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540
           HEKL TRAMTLY+TFNSLEGIECQKPQGAMYLFPKID+PFKA+QEA HLELTPDEFYCK 
Sbjct: 481 HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540

Query: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592
           LLESTGICTVPGSGFGQEPGTYHLRTTFLAPG+EW+KKWE FHKEFFDQYRD
Sbjct: 541 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/499 (77%), Positives = 444/499 (88%), Gaps = 1/499 (0%)

Query: 95  HHTL-KTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 153
           HH   K  + DFYPAE LT+ D+NENVLKAKYAVRG+IPMRAEEL+ QL++DP SLPFDK
Sbjct: 61  HHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDK 120

Query: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213
           I+NANIGNPQQL QKPL++YRQVLS+LQYPE+L Q E++L+   +FK DAI+RAK ++ D
Sbjct: 121 IVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRD 180

Query: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273
           +GGSVGAYSSSQGV GIRK+VA+FIT+RD GE +YPEDIFLTAGASAAV+YLLSI CRG 
Sbjct: 181 VGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ 240

Query: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 333
           ETGVLIPIPQYPLYTATLALNNS  LPYYLDE+SGWSTN  EIE VV E+I++ I+P+VL
Sbjct: 241 ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL 300

Query: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393
           VVINPGNPTG+VLS E++ +IF+VAAKYG VVIADEVYQENIF G++FHSMKK+LR LQ+
Sbjct: 301 VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK 360

Query: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
           EHPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+RQV+LKLASISLCPVVTGQ
Sbjct: 361 EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ 420

Query: 454 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 513
           ALVDLMV PP  G+ES+E D+ ER  IHE+L  RA  L+DTFNSLEGIECQKP+GAMYLF
Sbjct: 421 ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF 480

Query: 514 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573
           P+I LP+KA+Q A+HLE TPDEFYC+ LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 481 PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 540

Query: 574 EWIKKWETFHKEFFDQYRD 592
           EWIKKWE FHK+F+DQYRD
Sbjct: 541 EWIKKWEDFHKKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/491 (78%), Positives = 442/491 (90%)

Query: 102 NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 161
           +++F PA+QLTL ++N+NVLKAKYAVRGAIPMRAEELK QL++DP SLPFD I+NANIGN
Sbjct: 78  HNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGN 137

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQQL QKPL++YRQVLSLLQYPE+L Q+E +LV S LFK DA++RAK+L+ +IGG+VGAY
Sbjct: 138 PQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAY 197

Query: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S+SQGV GIRK+VA FITKRD+GE +YPEDIFLTAGASAAV YLLSI C+GPETGVLIPI
Sbjct: 198 SASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPI 257

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTA+LALNNS ALPYYLDE+SGWSTNP+EIE VV  A   +I+P+VLVVINPGNP
Sbjct: 258 PQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNP 317

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TGAVLS +S+  IFE+AAKYG VVIADEVYQEN+F   KFHSMKK+LR LQ++HPG +D 
Sbjct: 318 TGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDM 377

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQALVDLMV 
Sbjct: 378 VQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVS 437

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP +G+ESFE DQAER  I  +L TRAM LY  FN+LEGIECQKPQGAMYLFP++DLPFK
Sbjct: 438 PPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFK 497

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
           AVQ+A+HLE++PDEFYCKSLLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI+KW+ 
Sbjct: 498 AVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKI 557

Query: 582 FHKEFFDQYRD 592
           FH++F++ YRD
Sbjct: 558 FHQDFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/499 (76%), Positives = 437/499 (87%), Gaps = 1/499 (0%)

Query: 95  HHTLKTG-NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 153
           HH+LK     DF PAEQLTL D+NENVLKAKYAVRG+IPMRAEELK QLE +P +LPF +
Sbjct: 90  HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149

Query: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213
           I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L +NEQ L+D+K++K DAI RAK L+ +
Sbjct: 150 IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209

Query: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273
           IGGSVGAYS+SQGV GIRK+VA FIT+RD GE +YPEDIFLT        YLLSI C+GP
Sbjct: 210 IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269

Query: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 333
           +TGVLIPIPQYPLYTATLALNNS ALPYYLDE+SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 270 KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329

Query: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393
           VVINPGNPTGAVL+ ES+  IFE+AAKYG VVIADEVYQENI  G KF+SMKK+LR LQ+
Sbjct: 330 VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389

Query: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
            HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 390 SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449

Query: 454 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 513
           ALVDLMV PP +G+ S+E DQAER  I  +L  RA  LY+TF  LEGIECQKPQGAMYLF
Sbjct: 450 ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509

Query: 514 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573
           PK+DLPFKAVQEA+HLE+TPDEFYCKSLL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 510 PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569

Query: 574 EWIKKWETFHKEFFDQYRD 592
           EWIKKWE FHKEF+D YRD
Sbjct: 570 EWIKKWEAFHKEFYDNYRD 588

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/490 (77%), Positives = 438/490 (89%), Gaps = 2/490 (0%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164
           F PA Q+ + D+NENVLKAKYAVRG+IPMRAE+L+ QL++DP+SLPFDKIINANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223
           L QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L+EDIGGSVGAYS+
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIRK+VA+FIT+RD+ E +YPEDIFLTAGASAAV+YLLSIFC+G +TGVLIPIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTATLALNNS  LPYYLDE+SGWSTN +EI++VV +AI   IKP+VLVVINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRTLQREHPGKFDNV 402
           AVLS +++++IFE+AAKYG VVIADEVYQENIF    KFHSMKK+LR LQ+EHPGKFD V
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 403 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 462
           QLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDLMV P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 463 PVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKA 522
           P EGEES+ELDQAER+ IH +L  RA  L++TFN LEGI+CQKPQGAMYLFP+++LPFKA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 523 VQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETF 582
           VQ+A+H+E+T DEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EWI  WE F
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 583 HKEFFDQYRD 592
           HKEF+++YRD
Sbjct: 582 HKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/487 (76%), Positives = 428/487 (87%)

Query: 106 YPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQL 165
           YPAE+L L +VNENVLKAKYAVRGAIPM A EL A+L+KDP SLPFD I++ANIGNPQ L
Sbjct: 48  YPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHL 107

Query: 166 QQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQ 225
           +QKPLT+YRQVLSLLQYP LL +NEQ L+DSKL++ DAI RA+ L+ DIG SVGAYS+SQ
Sbjct: 108 KQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167

Query: 226 GVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYP 285
           G++GIR++VA+FIT+RD GE +Y EDIFLTAGAS+AV+YLLSI C+G ETGVLIPIPQYP
Sbjct: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227

Query: 286 LYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAV 345
           LYTA+LALNNS  LPYYLDE+SGWSTNP EIE VV  AI+  IKP+VLVVINPGNPTGAV
Sbjct: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287

Query: 346 LSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLA 405
           LS E +SQIF +AAKYG VVIADEVYQEN+F G +FHSMKKILR LQ+ +PG FDNVQLA
Sbjct: 288 LSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLA 347

Query: 406 SLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVE 465
           SLHSTSKGVSGECGQRGGYME+TGF++++RQVILKLASISLCPVVTGQALVDLMV PP  
Sbjct: 348 SLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKP 407

Query: 466 GEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQE 525
           G+ES+ELDQ ER SIHE L  RA  L+ TFNSLEGIECQKP+GAMYLFP++ LPFKA+Q 
Sbjct: 408 GDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQS 467

Query: 526 ARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKE 585
           A H  +TPD FYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI++WE FHK 
Sbjct: 468 AEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKA 527

Query: 586 FFDQYRD 592
           F+++YRD
Sbjct: 528 FYEEYRD 534

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/486 (74%), Positives = 428/486 (88%), Gaps = 2/486 (0%)

Query: 107 PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQ 166
           PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF KII+ANIGNPQQL 
Sbjct: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 167 QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226
           QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 227 VEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286
           V+GIR++VA+FITKRDDGEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 287 YTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346
           YTA+LALNNS+ LPYYL E+  WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 347 SPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLAS 406
           S +S+ +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR LQ+ + G++DN+QLAS
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 467 EESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 526
           +ES+E DQ ER  IH+ L  RA  L++TF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 527 RHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEF 586
           +HLE+ PDEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 587 FDQYRD 592
           FD+YRD
Sbjct: 523 FDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/488 (74%), Positives = 425/488 (87%), Gaps = 1/488 (0%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164
           F PA++L+LED+NENVL+AKYAVRG IP +AEELK QL +DP+SLPFD+IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224
           L QKPLT+YRQVLSLLQ P++L +  ++ + S+++K DAI RA  L+ +IGGSVGAYS S
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 225 QGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQY 284
           QGV G RK+VA+FITKRD GE +Y EDIFLTAGASAAV+Y+LSI CRGP+TGVLIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 285 PLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 344
           PLYTA+LALNNS ALPYYLDE+S WSTNPEEIE VV  +I   ++P  LVVINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 345 VLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQL 404
           +LSPES+ +IFEVAAKYG VVIADEVYQEN+F G +FHSM+K+L+ LQR+H GKFDN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 405 ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPV 464
           ASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP 
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 465 EGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQ 524
            G+ S+E DQ ER+ IH+ L  RA  LY+TFN LEGIECQKPQGAMYLFP++DL +KAVQ
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 525 EARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHK 584
           +A HL L+PDEFYC+ LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG +WIK WE FHK
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 585 EFFDQYRD 592
           +F+++YRD
Sbjct: 524 KFYNEYRD 531

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/576 (66%), Positives = 453/576 (78%), Gaps = 16/576 (2%)

Query: 27  TLTTSVKKMPYINPPFITTASNT-------KLKAFRKVRPVLQRHSSSWVAXXXXXXXXX 79
           T + S+ KMP+  PP    + ++       +L      RP L     S  +         
Sbjct: 5   TTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLRFHSS 64

Query: 80  XXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELK 139
                     LN   HH     N  F PAEQ TL+DVNE VL AKYAVRGAIPMRAEELK
Sbjct: 65  ASSSSLRSSFLNTEIHHH-SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELK 123

Query: 140 AQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPEL---LNQNEQQLVDS 196
            QL ++P SLPF+ IINANIGNPQQL+QKPL++YRQVLSLLQYPEL   L  N Q ++  
Sbjct: 124 TQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-- 181

Query: 197 KLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTA 256
              K DAI RAK L++DIGGSVGAYSSSQGV GIRK+VA+FIT RDDG I+YPEDIFLTA
Sbjct: 182 ---KQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTA 238

Query: 257 GASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEI 316
           GAS+AV+YLLSIFCRG ETGVLIPIPQYPLYTATLAL NS ALPYYL+E++GWST+PEE+
Sbjct: 239 GASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEEL 298

Query: 317 ETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
           E+++ ++I+N IKP+VLVVINPGNPTGAVLS E++ QIF +AAKYG +VIADEVYQEN+F
Sbjct: 299 ESIILDSIENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVF 358

Query: 377 PGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQ 436
              KFHSMKK+LR LQ + PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H++RQ
Sbjct: 359 EDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQ 418

Query: 437 VILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFN 496
           V+LKLASISLCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L  RA  L+D F 
Sbjct: 419 VVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFV 478

Query: 497 SLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFG 556
            L+GI CQKPQGAMYLFPK++LP+KA+QEA H +++PDEFYCKSLLE TGICTVPGSGFG
Sbjct: 479 KLDGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFG 538

Query: 557 QEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592
           QEPGTYHLRTTFLAPG +WI+ W  FH+EF++++++
Sbjct: 539 QEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/489 (75%), Positives = 421/489 (86%)

Query: 102 NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 161
           N +F PA QLT+ D+NENVLKAKYAVRG IP RAEELK QL + P SLPFDKIINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK +++DIGGSVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S SQGV GIR++VA FIT+RD GE +YPEDIFLTAGASAAVNYLLSI C+G +TGVLIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATLALNNS ALPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TGAVLS E++  I E+AAKYG VVIADEVYQENIF G KFHS+K +LR LQRE PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  GEESF LDQA+R +IH +L  RA  L+ TFNSL+GIECQKP GAMYLFPK++LP++
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
           A+QEA+ LEL+PDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EWI  W+ 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 582 FHKEFFDQY 590
           FH EF ++Y
Sbjct: 529 FHIEFMEKY 537

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/496 (69%), Positives = 417/496 (84%), Gaps = 8/496 (1%)

Query: 97  TLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIIN 156
           TL     + YPA++L ++D+N+NVLKAKYAVRG+IP+RAEELK  LE   Q LPFD +IN
Sbjct: 25  TLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVIN 83

Query: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 216
           ANIGNPQQL+QKPLT+YRQVLS+LQYPELL         S +FK DAI+RA+ L+++IG 
Sbjct: 84  ANIGNPQQLKQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG- 136

Query: 217 SVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           SVG+YSSSQG+  IRK+VA FITKRDDGEIS P DIFLTAGAS+AV+YLLSI C+  ++G
Sbjct: 137 SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196

Query: 277 VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336
           VLIPIPQYPLYTATLALNN+ ALPYYLDE  GWST+  EIE V+ +++   IKPT LV+I
Sbjct: 197 VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256

Query: 337 NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHP 396
           NPGNPTG++LS ES+ +I EVAA +G V+IADEVYQEN+F   KFHSMKK+LR LQ+  P
Sbjct: 257 NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP 316

Query: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456
           G++D VQLASLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALV
Sbjct: 317 GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALV 376

Query: 457 DLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKI 516
           DLMV PP +G+ES+E DQ ER++I   L  RA+ L++ FNS+EG+ CQKP+GAMYLFPKI
Sbjct: 377 DLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKI 436

Query: 517 DLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576
           DLPFK +Q+++ L++TPDEFYCK+LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EWI
Sbjct: 437 DLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWI 496

Query: 577 KKWETFHKEFFDQYRD 592
            +W  FH EF+D+YRD
Sbjct: 497 DRWNKFHAEFYDKYRD 512

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/491 (66%), Positives = 408/491 (83%), Gaps = 1/491 (0%)

Query: 102 NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 161
           N+DF PA +L+L+D+NENV+ AK+A+RG+I ++AE+L+ QL K+P  LPFD+I  ANIGN
Sbjct: 8   NNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGN 67

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L+ DIGGSVGAY
Sbjct: 68  PQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAY 126

Query: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S+SQGV GIRK+ AE+ITKRD GE SYPEDIFLT GA++A +YLLS+ CRGP+TGVLIPI
Sbjct: 127 SASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPI 186

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATLALN S  +PYYLDE+S WSTN  EIE +V ++I+  IKP+V+VVINPGNP
Sbjct: 187 PQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNP 246

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TGAVLS  ++++IF++AAKYG VV+ADEVYQENIF G +FHS KK+LR LQ+++PGKFDN
Sbjct: 247 TGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDN 306

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           +QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VDLM+ 
Sbjct: 307 IQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLL 366

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP +G+ S+ELD+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + L  K
Sbjct: 367 PPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKK 426

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
           A+ +A  L LTPDEFYC  LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EWI KWE 
Sbjct: 427 AIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEK 486

Query: 582 FHKEFFDQYRD 592
           FHK F+++Y+D
Sbjct: 487 FHKHFYEKYQD 497

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/500 (67%), Positives = 406/500 (81%), Gaps = 8/500 (1%)

Query: 100 TGNDD------FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 153
           TG+D       F PA +L  +D+N+N++ A+YAVRGAIPM+AEEL+ QL + P  LPF+ 
Sbjct: 23  TGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNA 82

Query: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213
           I  ANIGNPQQL QKPLT+ RQV+S+LQYP LL+  E+QLV S  +K DA KRA  L+E 
Sbjct: 83  ITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQ 141

Query: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273
           IGGSVGAYS +QGV GIR+SVA+FIT+RD+GE + P+DIFLT GAS A  YLLSI CR  
Sbjct: 142 IGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDS 201

Query: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 333
            TG++IPIPQYPLYTA++ + NS  LPYYLDE+SGWST  EEIE  V ++I+  + P V+
Sbjct: 202 STGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVI 261

Query: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393
           VVINPGNPTGAVLS ++++QI  +AAKYG VV+ADEVYQ NI+ G KFHSMKK+LR+LQR
Sbjct: 262 VVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQR 321

Query: 394 EHP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTG 452
           +HP G++DNVQLAS+HSTSKGVSGECGQRGGYMEL GFS+E+RQVILKLASIS+C VVTG
Sbjct: 322 DHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTG 381

Query: 453 QALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYL 512
           QALVDLM+ PP EG++S+ELD  ER  IH  + TR   LYDTF  LEGIECQ+PQGAMYL
Sbjct: 382 QALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYL 441

Query: 513 FPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPG 572
           FPK+ L  KA++EA+ L L PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG
Sbjct: 442 FPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPG 501

Query: 573 LEWIKKWETFHKEFFDQYRD 592
            +WIK WETFHK F+D+YRD
Sbjct: 502 TQWIKDWETFHKAFYDKYRD 521

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/496 (69%), Positives = 414/496 (83%), Gaps = 1/496 (0%)

Query: 97  TLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIIN 156
           T+   + +F PA++LT+ D+NENVLKAKYAVRG IP RAE LK QL  +P SLPF K+IN
Sbjct: 28  TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87

Query: 157 ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 216
           ANIGNPQQL QKPLT+YRQVLSLLQYP +L++       + L+K DAI+RAK ++ DIG 
Sbjct: 88  ANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIGS 146

Query: 217 SVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           SVG+YSSSQGV G+RK+VAE+I++RD GE +Y EDIFLTAGAS+AV+YLL+I C+G E+G
Sbjct: 147 SVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESG 206

Query: 277 VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 336
           VLIPIPQYPLYTATLALNN+ ALPYYL+E SGWSTN EEIE VV  AI+ +I P VLVVI
Sbjct: 207 VLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVI 266

Query: 337 NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHP 396
           NPGNPTGA+LS ES+ +IF+VAA +G VVIADEVYQENIFPG +FHSMKK+LR LQR  P
Sbjct: 267 NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP 326

Query: 397 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 456
           GK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQALV
Sbjct: 327 GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386

Query: 457 DLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKI 516
           DLM  PP +GE S+E DQ ER++IH +L  RA  L+  FN +EG+ CQKPQG+MYLFPKI
Sbjct: 387 DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446

Query: 517 DLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576
           D+P KA+++A+ L++TPDE YC  LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  WI
Sbjct: 447 DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506

Query: 577 KKWETFHKEFFDQYRD 592
            +W  FH+ F ++YRD
Sbjct: 507 DQWREFHQIFCNKYRD 522

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/481 (69%), Positives = 396/481 (82%), Gaps = 2/481 (0%)

Query: 112 TLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLT 171
           TL DVN+ VL AKYAVRG IP+RAEEL+ +L ++P SLPF+KIINANIGNPQQL QKPLT
Sbjct: 41  TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100

Query: 172 YYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIR 231
           +YRQVLSLLQ P L+       +  KLFK DA++RAK +++ +GGSVGAYS+SQGV G R
Sbjct: 101 FYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159

Query: 232 KSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATL 291
           +SVAEFI +RD GE +   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTATL
Sbjct: 160 QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218

Query: 292 ALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESV 351
           ALN++ ALPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE++
Sbjct: 219 ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278

Query: 352 SQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTS 411
            +I  VAAKY  VVIADEVYQEN F    F SMKK+LR LQ+  PGK+DNVQLASLHSTS
Sbjct: 279 EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338

Query: 412 KGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE 471
           KGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S+E
Sbjct: 339 KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398

Query: 472 LDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLEL 531
           LD+ ERN+IH  L  ++  LY+TF SLEG+ CQKPQGAMYLFPK+DL  KA+++A  L +
Sbjct: 399 LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458

Query: 532 TPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYR 591
            PDE+YCK LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D++R
Sbjct: 459 APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518

Query: 592 D 592
           D
Sbjct: 519 D 519

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/493 (65%), Positives = 403/493 (81%)

Query: 100 TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 159
           T + +F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L++ P  LPFD IINANI
Sbjct: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L+EDIGGS+G
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134

Query: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS SQGV GIR+SVAEFITKRDDGE + PE+I+LT GAS+A   LLS+ C+  +TG+LI
Sbjct: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLI 194

Query: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPG
Sbjct: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 399
           NPTGAVLS +++++I  +AAKYG  +I+DEVYQEN+F G KFHSMKK+LR LQR +PGKF
Sbjct: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374

Query: 460 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 519
           V+PP  G+ES++ D +ER  I  ++ TRA  L++TFN LEGIECQKPQGAMYLFP++ LP
Sbjct: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434

Query: 520 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579
            KA++E+  L + PDEFYC SLLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W
Sbjct: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494

Query: 580 ETFHKEFFDQYRD 592
           + FH++FF++YRD
Sbjct: 495 KHFHQDFFNKYRD 507

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/492 (66%), Positives = 409/492 (83%), Gaps = 2/492 (0%)

Query: 100 TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 159
           T  +  Y AE+L  ED+N NV+KAKYAVRGAIP  A++LK QL K P +LPF+ +IN+NI
Sbjct: 73  TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           GNPQQL QKPL++ RQVLS+L+YP LL+ +E+ LVDS  +  D+I+RAK+L+ DIG S+G
Sbjct: 133 GNPQQLGQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190

Query: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS+SQGV GIR++VA+FIT RDDGE++YP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 191 AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250

Query: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTATL LN++ ALPYYLDE +GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 251 PIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 399
           NPTG+VL+ E++  +F+VAAKYG VVIADEVYQ+NIFPG++FHSMKKILR LQ+E P K+
Sbjct: 311 NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 371 DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430

Query: 460 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 519
             PP +GE S+ELDQ ER +I      R+  LY+ FNSLEG+ CQKPQGAMY+FP I LP
Sbjct: 431 CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490

Query: 520 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579
           F A++ A++L++TPDEFYC+ LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPG+EW+K+W
Sbjct: 491 FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550

Query: 580 ETFHKEFFDQYR 591
           E FH EFF++YR
Sbjct: 551 EKFHIEFFEKYR 562

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/489 (65%), Positives = 397/489 (81%)

Query: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163
           DF PA ++T +D+N +V KA+YAVRG+IP RA+ELK +L+K+P  LPFD IINANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L++DIGGSVGAYS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIR++VA+FIT RD GE + PEDI+LT GAS+A   LLS+ C+   TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+ +L N+Q LPYYLDE+  WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 403
           AVL+ E++++I  +AAKYG  VI+DEVYQEN+F   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 464 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523
             G+ES+E D+ ER+ I  ++ TRA  LY+TFN LEGIECQ PQGAMYLFP++ LP KA 
Sbjct: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 524 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583
           +E+  L + PDEFYC SLLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 584 KEFFDQYRD 592
           + FF++YRD
Sbjct: 499 QSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/489 (65%), Positives = 396/489 (80%)

Query: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163
           DF PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L+K+P+ LPFD IINANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223
           QL QKPLT+ RQVL++L+YPE+L     +L    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283
           SQGV GIR++VA+FIT+RD GE + PEDI+LT GAS+A   LLS+ C+  +TG+LIPIPQ
Sbjct: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343
           YPLYTA+ +L N+Q LPYYLDE+S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 403
           AVLS E++++I  +AAKYG  +I+DEVYQENIF   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 464 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523
             G+ES+E D  ER  I  ++ TRA  LY+TF  LEGIECQKPQGAMYLFP++ LP KA+
Sbjct: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 524 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583
            E+  L + PDEFYC SLLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 584 KEFFDQYRD 592
           ++FF +YR+
Sbjct: 499 QDFFSKYRN 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/506 (65%), Positives = 403/506 (79%), Gaps = 4/506 (0%)

Query: 87  LRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDP 146
           LRHL+  P   L+          + TL+D+NE VL AKYAVRG IP+RAEELK +L ++P
Sbjct: 17  LRHLSTRP--GLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74

Query: 147 QSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 206
            SLPFDKIINANIGNPQQL QKPLT+YRQVL+LLQ P+L++      +  K FK DA++R
Sbjct: 75  GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVER 133

Query: 207 AKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLL 266
           AK +++ +GGSVGAYS+SQGV G R+SVAEFI +RD GE +  +DIFLT GAS AV+Y+L
Sbjct: 134 AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192

Query: 267 SIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQN 326
           S+FC GPE G LIPIPQYPLYTA+LALNNS ALPYYLDE+SGWS + E+IE VV+++I+ 
Sbjct: 193 SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252

Query: 327 EIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386
            I+PT LVVINPGNPTGA+L+ +++  + +VAAKY  V+IADEVYQEN F   +F SMKK
Sbjct: 253 GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312

Query: 387 ILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISL 446
           +LR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASISL
Sbjct: 313 VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372

Query: 447 CPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKP 506
           CPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L  R+  LY  F S+EG+ CQ+P
Sbjct: 373 CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432

Query: 507 QGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRT 566
           QGAMYLFPK++L  KA+ +A    L PDE+YCK LLE+TGICTVPGSGFGQ PGT+HLRT
Sbjct: 433 QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492

Query: 567 TFLAPGLEWIKKWETFHKEFFDQYRD 592
           TFLAPG EWI  W+ FH++F + +RD
Sbjct: 493 TFLAPGTEWIDSWKKFHEKFTEDHRD 518

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/490 (65%), Positives = 402/490 (82%), Gaps = 4/490 (0%)

Query: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDKIINANIGN 161
           +F PA+++TL+D+N+NVLK++YAVRG+IP RAEEL+ +L       SL F+ I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQQL QKPLT+ RQV+S+LQYPELLNQ    LV + +FK DA++RA++L+  IGGSVGAY
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           SSSQGV GIR++VA +IT RD+GE + P+DIFLT GAS A +YLLS+ C+   TGVLIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTAT+ L +++ LPYYL+E+SGWSTN  EIE VV +AI + +KP+V+VVINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TG+VLS + +  I  + AKYG V+IADEVYQENIF G +FHSMKK+LR+LQ+++PGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV 
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP +G+ES+ELD  ER +IHE L  RA  LY+ F  L+G+ECQKPQGAMYLFPK+  P  
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
            + EA +  ++PDEFYC +LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+ 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 582 FHKEFFDQYR 591
           FH+EFF +Y+
Sbjct: 505 FHEEFFSKYQ 514

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/493 (63%), Positives = 397/493 (80%)

Query: 100 TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 159
           T + DF PA +LT +D+N +V KA+YAVRGAIP RAEELK +L++   SLPF+ IINANI
Sbjct: 15  TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANI 74

Query: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219
           GNPQQL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L++DIGGSVG
Sbjct: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVG 134

Query: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           AYS SQGV GIR++VA+FIT+RD GE + PEDI+LT GAS+A   LLS+ C+  +TG+L+
Sbjct: 135 AYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLL 194

Query: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
           PIPQYPLYTA+ +L N+Q LPYYLDE++ WST  +EIE VV +A++  I+P+VLVVINPG
Sbjct: 195 PIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPG 254

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 399
           NPTGAVL+  ++++I  +AAKYG  +I+DEVYQENIF   KFHSMKKILR LQ  HPGKF
Sbjct: 255 NPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKF 314

Query: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLM
Sbjct: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLM 374

Query: 460 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 519
           V+PP  G+ES++ D+ ER  I+ +++TRA  LY+TFN LEGI+CQKPQGAMYLFPK+ LP
Sbjct: 375 VKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLP 434

Query: 520 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579
            KA++E+  L + PD  YC SLLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +WI+ W
Sbjct: 435 EKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDW 494

Query: 580 ETFHKEFFDQYRD 592
             FH++FF++YRD
Sbjct: 495 RQFHQDFFNKYRD 507

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 394/489 (80%), Gaps = 3/489 (0%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164
           F PAE+L++ D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPFDKII ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 222
           + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ +++ IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 223 SSQGVEGIRKSVAEFITKRDD-GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           +SQGV G R++VA+FI KRD   +++ P DIFLT GAS+AV+YLLSI C GPE GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTATL L+NS A+PYYL E + WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TGA+LS   ++ I  ++AKYG  +IADEVYQENIFPG +FHSM+K+L  LQ E PG +DN
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  G+ S++LDQ ERN I + L+ RA  LY  F SLEG+ECQ+PQGAMYLFPK+ LP K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
           A+++A  LE+ PDE+YC+ LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EWI++W  
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 582 FHKEFFDQY 590
           FH++F++++
Sbjct: 483 FHQQFYERF 491

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/497 (61%), Positives = 399/497 (80%), Gaps = 2/497 (0%)

Query: 96  HTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKII 155
           HT++T   DF PA +L+++D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF++I 
Sbjct: 4   HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63

Query: 156 NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDI 214
            ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN+ NE       ++  D+  RA+ L+ +I
Sbjct: 64  VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123

Query: 215 GGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           GGSVGAYS+SQGV GIRK++A +IT+RD GE + P DIF+T GA+AA +YLLSI   GP+
Sbjct: 124 GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183

Query: 275 TGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIE-TVVKEAIQNEIKPTVL 333
           TGVL+PIPQYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE T+ K A+   I+P V+
Sbjct: 184 TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243

Query: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393
           V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G KFHS KK+LR+LQ+
Sbjct: 244 VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303

Query: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 453
           + P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 304 QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363

Query: 454 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 513
           A++DLM+ PP +G++S++LD  ER  IH  ++ RA  LYD F+ +EGI+CQKPQGAMYLF
Sbjct: 364 AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423

Query: 514 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 573
           P++ L  K + EA+  E+ PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 424 PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483

Query: 574 EWIKKWETFHKEFFDQY 590
           +WI KWE FHK F  +Y
Sbjct: 484 QWINKWEKFHKAFLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/490 (63%), Positives = 393/490 (80%), Gaps = 4/490 (0%)

Query: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDKIINANIGN 161
           DF PA ++++ D+N+ ++ A+YAVRG+I MRAEEL+ +L  +  P S PF++II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           PQQL QKPLT+ RQV+S+L+YP LL + +  L+   ++K DA++RA+ L   IG SVGAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLL-KFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S +QGV GIR++ A FI+KRD+ E +  +DIFLT GAS AV YL+   C+   TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTA++ ++N++ LPYYLDE+SGWST  EEIE  V  AI+N IKP+ +VVINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TGAVLS + + +I  VAAKYG V+IADEVYQ+NIF G +FHSMKKILR LQ+++PGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQALVDLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  G+ES+E DQ ERN IH  L  RA  LYDTF++LEGIECQKPQGAMYLFP++ LP +
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
           A++EA+ L++  DEFYC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWI  W+ 
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 582 FHKEFFDQYR 591
           FH++F  +Y+
Sbjct: 501 FHEKFMKEYQ 510

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/510 (61%), Positives = 390/510 (76%), Gaps = 10/510 (1%)

Query: 90  LNRFPHHTLK-------TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL 142
           L+  PH T+        T    F P + L LED+N NVL+AKYAVRG IP RA EL+ QL
Sbjct: 28  LHGLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQL 87

Query: 143 EKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLD 202
            +DP SLPF KII ANIGNPQQL QKPL++ R+VLSLL+ P LL    + L  + ++K D
Sbjct: 88  SRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPD 145

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           A++RAK +M D+  S+GAYS SQGV G RK+VAE+++ RD GE +  EDIFLT GAS   
Sbjct: 146 AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGA 204

Query: 263 NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE 322
           + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE+SGWS N +++E ++ E
Sbjct: 205 SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIE 264

Query: 323 AIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFH 382
           +I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVYQEN+F G KF+
Sbjct: 265 SIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFY 324

Query: 383 SMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLA 442
           SMKK+LR+LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS ++R+VILK+A
Sbjct: 325 SMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMA 384

Query: 443 SISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIE 502
           SI LC  V GQALVDLM+  P  G+ES+E D +ER+SI   L  R+ +L++TFN+LEG+E
Sbjct: 385 SIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVE 444

Query: 503 CQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTY 562
           C+KPQG+MYLFP++ LP KA++ A  L++ PDEFYC  LL STGICTVPGSGFGQ P T 
Sbjct: 445 CRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTC 504

Query: 563 HLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592
           HLRTTFL PG EWI+ WE FHK F+D+YRD
Sbjct: 505 HLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/490 (60%), Positives = 387/490 (78%), Gaps = 2/490 (0%)

Query: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163
           DF P  ++TL+D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPF+KIINANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221
           QL QKPL++ R+VLS+LQYP++L      Q L++ ++++ D ++RA+ L+ +IGGSVGAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281
           S SQGV GI+++VA++ITKRD GE++YPEDIFLT GAS+AV+++L +FC GP TGVLIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341
           PQYPLYTAT+ L  + A+ YYL+E+  WS N  E+E  ++E+I++ IKPT +V+INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401
           TG++L+ + ++ I  ++AKYG ++IADEVYQEN+F G +FHS+KK+LR LQR++ G ++ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461
           VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V 
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521
           PP  G+ES+E+DQ ERN+I   LI+R+  L+  F SLEG+EC +PQGAMYLFPK   P K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581
            +  A+ L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 582 FHKEFFDQYR 591
           FH EF ++YR
Sbjct: 488 FHTEFCERYR 497

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/488 (63%), Positives = 385/488 (78%), Gaps = 3/488 (0%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164
           F PAE +TL DVNENV+KAKYAVRG IP RAEEL+ +LE+ P SLPF KII ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224
           L QKPLT+YRQV+SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAYS+S
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSAS 154

Query: 225 QGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQY 284
           QGV+G R++VA+FI +RD G  + P++++LTAGAS+AV+ LLS FC+GPETGVLIPIPQY
Sbjct: 155 QGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213

Query: 285 PLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 344
           PLYTAT+  NN+ ALPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNPTG+
Sbjct: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273

Query: 345 VLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQL 404
           VLS + +  I  +AAKYG VVIADEVYQ+N+F   KFHSM+K+L+ LQ   P  + NVQL
Sbjct: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333

Query: 405 ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPV 464
           ASLHS SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP 
Sbjct: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393

Query: 465 EGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQ 524
           +G+ S+E    E  SI+ +L  R+  L+ TF SLEGIEC  PQGA+YLFPK+ LP KA++
Sbjct: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453

Query: 525 EARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHK 584
            A+ L +  DE YC  LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +WI+ W+ FHK
Sbjct: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513

Query: 585 EFFDQYRD 592
           +F+D+YRD
Sbjct: 514 KFYDKYRD 521

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/497 (60%), Positives = 384/497 (77%), Gaps = 10/497 (2%)

Query: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163
           D  PA + +L D+++++L  +YA+RG IP RA+EL+ QL   P  LPF KII ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223
           QL+Q+PLT+ RQVLSL++YP L+N ++  LV++K++  DAIKRA++++  IGGSVGAYSS
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 224 SQGVEGIRKSVAEFITKRDDGEISYPE---------DIFLTAGASAAVNYLLSIFCRGPE 274
           SQG+  IRK+VA+ I +RD+ E+   +         +IFLT GA+ AV+Y+L +F +   
Sbjct: 124 SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 275 TGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLV 334
            GVL+PIPQYPLYTA + L NS+ LPYYL+E   WST+PEEIET++K+AI   IKPT LV
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 335 VINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQRE 394
           +INPGNPTGA+LS ES++QI  +AAKYG V+IADEVYQ NI+   KFHS KKIL +L+ +
Sbjct: 244 IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 395 HPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQA 454
           +P K+DNVQLASLHS SKGV+GECGQRGGY EL GFS E++++ILKLASI +C VVTGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 455 LVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFP 514
           LVDLM +PP +G+ S++LDQ ERN+I   LI ++ TLYD F+ L GI CQKPQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 515 KIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLE 574
           ++ L    + EA+   L PDEFYC  LLE+TGICTVPGSGFGQ+ GTYH+RTTFL  G+E
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 575 WIKKWETFHKEFFDQYR 591
           WIK WE FH EF +QY+
Sbjct: 484 WIKLWEKFHLEFMNQYK 500

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/494 (60%), Positives = 383/494 (77%), Gaps = 8/494 (1%)

Query: 105 FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 164
           F PA + +L D+NE++LKA+YA+RG IP RAEEL  QL ++ +SLPF KI+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 165 LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 224
           L Q+PLT+ RQV+SL+Q+P+LL +++  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 225 QGVEGIRKSVAEFITKRD-------DGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 277
           QGV  IRK+VA FI KRD       D       ++FLTAGAS AV+++L +F +    GV
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 278 LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 337
           L+PIPQYPLYTA + L  S+ LPYYL+E + WST+P++IE +V +AI+  IKPT LVVIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 338 PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPG 397
           PGNPTGA+L+ +S+  I ++AA+YG V+IADEVYQEN++   +FHS KK+L  L++ +P 
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 398 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 457
           K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 458 LMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKID 517
           LMV PP  G+ES+ELDQ ER+ IH  LI ++ TLYD F  L GI CQKPQGAMYLFP++ 
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 518 LPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 577
           L   A+  A  L L PDEFYC  LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EWI 
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 578 KWETFHKEFFDQYR 591
            WE FH EF ++Y+
Sbjct: 487 SWEKFHLEFMEKYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 17/167 (10%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y + QG   +RK +AE  +  +D  +S  E++ LT GA AA N+L      G     +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSN-EDVTLS-EENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 281 IPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN-PG 339
            P Y   ++   +  ++    +L +++ +  N  E+E ++K         T  +V+N P 
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIK-------PNTKCIVLNTPN 164

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 386
           NP  +V+  E++ +I E+A K+G VV  DEVY         FHS +K
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEK 205

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 89/186 (47%), Gaps = 21/186 (11%)

Query: 186 LNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGE 245
           LN NE   +  + F+ D   R              Y S  G   +R  VA+ I   D+ +
Sbjct: 32  LNLNELSSLTGESFEFDQNMRL------------TYGSIWGTPVLRDLVAK-IHSSDEIQ 78

Query: 246 ISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDE 305
           ++  +++ +T GA  A N+L+     GP   ++   P Y   ++  ++  +     +L+ 
Sbjct: 79  LT-ADNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEA 136

Query: 306 QSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVV 365
           + G++ N +++++ V+   +       +V+ NP NP G+V+S E +++I + A +    +
Sbjct: 137 EDGYTPNIQKLKSKVRANTK------YIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFI 190

Query: 366 IADEVY 371
           + DEVY
Sbjct: 191 VCDEVY 196

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDEQS 307
           D+  T G + A   +L IFC   +T   I   Q+  ++++++   +Q +   P  LDE  
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVI 366
                P ++ET++    +   KP +L  +  G NPTG+ LS +   +I+ +A K+  ++I
Sbjct: 190 ---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIII 246

Query: 367 ADEVY 371
            DE Y
Sbjct: 247 EDEPY 251

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 78/158 (49%), Gaps = 18/158 (11%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDD--GEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 277
           Y  SQG    +  + EF+ K      +I Y + D+  TAG + A    L +FC   +T  
Sbjct: 106 YGFSQG----QPELMEFVRKHTSLVHDIKYADWDVLATAGNTNAWESTLRVFCNRGDT-- 159

Query: 278 LIPIPQYPLYTATLALNNSQAL---PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLV 334
            I    Y  ++++L    +Q +   P  LDE   +   PE++E+++        KP +L 
Sbjct: 160 -ILAEAYS-FSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLY 214

Query: 335 VINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
            I  G NPTG+ LS +  ++I+ +A K+  ++I DE Y
Sbjct: 215 TIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--ALPYYLDEQS 307
           E++ L  G+   ++ L+   C   +  +LI  P Y +Y+    +N+ +   +P  +++ S
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
                 + IET     +QN+    ++ + +PGNPTGA++ PE++ ++  ++      V+ 
Sbjct: 148 FQMDTEKVIET-----LQNDPSIKLVFITSPGNPTGALIKPENIEKL--LSQWQSGFVVV 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 64/125 (51%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDEQS 307
           D+  T G + A    L +FC   + G +I + +   +++ LA   +Q +   P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVI 366
                PE++E ++    +   KP +L  I  G NPTG+ LS +   +I++VA K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 81/190 (42%), Gaps = 41/190 (21%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLLSIFCRG-- 272
           Y S++G   +R ++ EF+ +      RDD   S PE + LT+GAS  V   L+I  +   
Sbjct: 51  YGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQATL 107

Query: 273 PETGV----LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVK--EAIQ- 325
           P TGV     I  P Y L                +DE+   S + E +E  +K  E+I  
Sbjct: 108 PHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDP 167

Query: 326 ---NEIKPTVLVVINP--------------------GNPTGAVLSPESVSQIFEVAAKYG 362
              NE    + ++ NP                     NP+G   + E+  ++ E+A KY 
Sbjct: 168 NPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYD 227

Query: 363 TVVIADEVYQ 372
            ++I D+VY 
Sbjct: 228 MLIITDDVYD 237

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 72/152 (47%), Gaps = 9/152 (5%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y + +G + +R  VA   +   D E+   +D  L    +   N+L+S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYS---DKEVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 281 IPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y   ++   +  ++     L+ ++ +  +  ++++++K   +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 341 PTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
           P G+V+   ++ +I  +A K    VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 109/253 (43%), Gaps = 36/253 (14%)

Query: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVG-AYSSSQGVEGIRKSVAEFITKRDD--GEISY 248
           +L + ++ K+D  K  K    DI  +    Y  SQG    +  + EFI + +    ++ Y
Sbjct: 74  ELSNDEVCKVDLKKDVKVHEGDIPLARSLQYGFSQG----QPELLEFIREHNKLIHDMQY 129

Query: 249 PE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLD 304
            + D+  TAG + A    L +FC     G +I + +   +++ LA   +Q +   P  +D
Sbjct: 130 EDWDVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPVPID 185

Query: 305 EQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGT 363
           ++      P ++E ++        KP +L  I  G NPTG  L+ E   +IF +A K+  
Sbjct: 186 DKG---IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDF 242

Query: 364 VVIADEVYQENIFPGTKFHSMKKILRTLQ-----REHPGKFDNVQLASLHSTSKGVSGEC 418
           ++I D  Y         F  M K  R LQ     R  P +     LASL  T   V  + 
Sbjct: 243 LIIEDAPYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTD- 293

Query: 419 GQRGGYMELTGFS 431
              G  + L  FS
Sbjct: 294 ---GRVIRLDSFS 303

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 18/158 (11%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDD--GEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 277
           Y ++QG    +  + EF+ + +    E +Y + D  LT G +      L IFC     G 
Sbjct: 103 YGATQG----QPEILEFLREHNKLVHEFNYSDWDSILTTGNTNGWESTLRIFCN---KGD 155

Query: 278 LIPIPQYPLYTATLALNNSQAL---PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLV 334
           +I + +   ++++LA   +Q +   P  +D        PE++E+++        KP +L 
Sbjct: 156 VI-LAEAHSFSSSLASAEAQGVITFPVPIDSDG---IIPEKLESILDNWTPGSPKPKLLY 211

Query: 335 VINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
            I  G NPTG+ LS E    I+++A K+  ++I DE Y
Sbjct: 212 TIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 78/169 (46%), Gaps = 17/169 (10%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+   ++ L+   CR     +L   P Y +Y+    +N+ + +  P   ++ S
Sbjct: 85  DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
                PE + T     ++N+ K  +L + +PGNPTG +++ + +  I E       +V+ 
Sbjct: 145 FQMNVPEVLST-----LKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWT--NGLVVV 197

Query: 368 DEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 416
           DE Y +        +SM K++         K+ N+ +    S S G++G
Sbjct: 198 DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSFGLAG 238

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 84/170 (49%), Gaps = 19/170 (11%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--ALPYYLDEQS 307
           +++ L  G+  +++ L+   C   +  +LI    Y +YT    +N+ +   +P  L E+ 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGT-VVI 366
            +  + E+I     E +QN+    ++ + +PGNPTG  +    V++I ++ +++ T +V+
Sbjct: 148 KFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFI---DVNRIEKILSQWQTGLVV 200

Query: 367 ADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 416
            DE Y +    G+   S+  +          K++N+ +    S S G++G
Sbjct: 201 VDEAYID-FVEGSDKGSLAPL--------ATKYENIAVLQTLSKSFGLAG 241

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   + KS+ +  +      +  PE++ +T GA+  +   L+ I  +  E  
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEGILACLMGILNQNDEVI 142

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + L   + + + W+ + E+ E V+        
Sbjct: 143 VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN------ 196

Query: 329 KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E + +I ++  K+  ++I+DEVY    F
Sbjct: 197 KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDEQS 307
           DI LT G +      L +FC     G +I + +   ++++LA   +Q +   P  +DE  
Sbjct: 132 DIILTTGNTNGWESTLRVFCN---KGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVI 366
                PE++E ++        KP +L  I  G NPTG  L+ E   +I+ +A K+  ++I
Sbjct: 188 ---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLII 244

Query: 367 ADEVY 371
            DE Y
Sbjct: 245 EDEPY 249

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 76/164 (46%), Gaps = 18/164 (10%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280
           Y S +G + +R  +A        G     +++ +T GA AA N+L+     GP   V+  
Sbjct: 55  YGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICV 108

Query: 281 IPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340
            P Y    +   +  ++     L ++ G+  N E ++ ++K   +      ++++ NP N
Sbjct: 109 DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNN 162

Query: 341 PTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSM 384
           P G+ +S E+++ I ++  +    +  DEVY+        FHSM
Sbjct: 163 PLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 22/160 (13%)

Query: 221 YSSSQGVEGIRKSVAEFI-----TKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPET 275
           Y  SQG   + K + E        + DD E+       +TAG ++A    L IFC   +T
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWEL------LVTAGNTSAWESTLRIFCNRGDT 156

Query: 276 GVLIPIPQYPLYTATLALNNSQAL---PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTV 332
                + +   ++++L+   +Q +   P  +D++      PE++  ++        KP +
Sbjct: 157 ----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG---IIPEKLAAIMDNWNPETPKPKL 209

Query: 333 LVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           L  I  G NPTG+ L  E  SQ++++A K+  +++ DE Y
Sbjct: 210 LYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/370 (19%), Positives = 147/370 (39%), Gaps = 52/370 (14%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +  +   D ++   E++ +T GA+  +
Sbjct: 88  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIKLYSPIYDTDLR-AENVTVTTGANEGI 144

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSG----WST 311
            + L+ +   G E  V++  P +  Y   + L   + +      P  LD+++     W+ 
Sbjct: 145 LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTI 202

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           + E+ E  +        K   +++  P NP G V + E ++ +  +  K+  V+I+DEVY
Sbjct: 203 DFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 256

Query: 372 QENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431
            E++F    F                     ++A+L      ++   G  G     TG+ 
Sbjct: 257 -EHLFFTDSF--------------------TRIATLSPEIGQLTLTVGSAGKSFAATGWR 295

Query: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTL 491
                 +L L +  L         +      P++   +  ++ A +    EK+    +T 
Sbjct: 296 IGW---VLSLNAELLSYAAKAHTRICFASPSPLQEACANSINDALKIDYFEKMRQEYITK 352

Query: 492 YDTFNSL---EGIECQKPQGAMYL---FPKIDLPFKAVQEARHLELTPDEFYCKSLLEST 545
           +  F S+    G+    P+G  ++   F K+ +P         L+   D      L+   
Sbjct: 353 FKIFTSIFDKLGLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEILDKGKDFRISHWLINEL 412

Query: 546 GICTVPGSGF 555
           G+  +P + F
Sbjct: 413 GVVAIPPTEF 422

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 18/170 (10%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDD----GEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           YS +QG++ +   +  FITK ++     E  Y  DI L  G+S ++  +    C    T 
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLCDESTTV 194

Query: 277 VLIPIPQYPLYTATLALNNSQALPYYLD---EQSGWSTNPEEIETVV-----KEAIQNEI 328
           ++      P+ +  +A   ++ +P  L+   E  G   + E +E ++     K   ++  
Sbjct: 195 LMEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLS 251

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 377
           KP +L  I+ G NP G  LS E   +I+ +A ++  +++ D+ Y    FP
Sbjct: 252 KPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPYCYLTFP 301

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 91/186 (48%), Gaps = 24/186 (12%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +  T   + E+   E++ +T GA+  +
Sbjct: 72  AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGI 128

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSG----WST 311
            + L+ +   G E  V++  P +  Y   + L   + +      P  LD+++     W+ 
Sbjct: 129 LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEV 370
           + E+ E    +AI ++ K    V+IN P NP G V + + ++ +  +  K+  V+I+DEV
Sbjct: 187 DFEQFE----KAITSKTKA---VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEV 239

Query: 371 YQENIF 376
           Y+   F
Sbjct: 240 YEHLYF 245

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 75/156 (48%), Gaps = 11/156 (7%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           Y +S+G   +   + E I K    +I Y + D+ +TAG++ A +  L +FC  P   VL+
Sbjct: 100 YGNSRGQRELVSFLKEHIVKFH--QIPYSDWDVLITAGSTQAWDASLRLFCN-PGDSVLL 156

Query: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVK---EAIQNEIKPTVLVVI 336
              +   Y++++    +Q +     E  G    PE++E +++   +       P +L VI
Sbjct: 157 ---ESWTYSSSVEAAEAQGMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVI 213

Query: 337 NPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
             G NP G  L+ E    I+ +  KY  V+I D+ Y
Sbjct: 214 PTGQNPMGVTLADERKPLIYNIIQKYDMVLIEDDPY 249

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 251 DIFLTAGASAAVNYLLSIFC-RGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGW 309
           D+  T G + A    L +FC RG      + + +   ++++LA   +Q +  +       
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGD-----VILAEAHSFSSSLASAEAQGIITFPVPIDAH 186

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
              PE++E ++    +   KP +L  I  G NPTG+ L+ E   +I+ +A K+  ++I D
Sbjct: 187 GIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIED 246

Query: 369 EVY 371
           E Y
Sbjct: 247 EPY 249

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 8/127 (6%)

Query: 246 ISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLD 304
           ISY ++I L  G+   V+ L+   C      VL+  P Y +Y+    +N+++ +    + 
Sbjct: 85  ISY-KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 305 EQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTV 364
           E + +  + +     V E + N+    +L +  PGNPTGA +S + +  +    +    +
Sbjct: 144 EDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWS--AGI 197

Query: 365 VIADEVY 371
           V+ DE Y
Sbjct: 198 VVVDEAY 204

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+  +++ L+   C   +  +LI  P Y +Y+    +N+ + +  P  +++ S
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
                 + IET     +Q +    +  V +PGNPTGA++   S+ +I     + G V I 
Sbjct: 148 FQMNTDKVIET-----LQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIVAI- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 78/168 (46%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   + +S+ +  +   + E+   E++ +T GA+  + + L+ I   G E  
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + +   + + + W+ + E+    + +      
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 329 KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E +++I E+  K   V+I+DEVY+   F
Sbjct: 197 KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYF 244

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 87/179 (48%), Gaps = 18/179 (10%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +  +     E+   E+I +T GA+  +
Sbjct: 76  AIKEAQKALEI--PLVNQYSPTRGRASLLNSLIKLYSPFYGKELK-QENITITTGANEGI 132

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSGWSTNPEE 315
            + L+ +   G E  V++  P +  Y + + L   + +      P  LD++    T    
Sbjct: 133 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTE--- 187

Query: 316 IETVVKEAIQNEIKP-TVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
             T+  E  +N I P T  V++N P NP G V + E ++++ E+  +   ++I+DEVY+
Sbjct: 188 -WTIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYE 245

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 92/186 (49%), Gaps = 24/186 (12%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AIK A+  + DI   V  YS ++G   +  S+ +  +   + E+   E++ +T GA+  +
Sbjct: 72  AIKEAQKAL-DIP-MVNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGI 128

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSG----WST 311
            + L+ +   G E  V++  P +  Y   + L   + +      P  LD+++     W+ 
Sbjct: 129 LSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEV 370
           + E+ E    +AI ++ K    V+IN P NP G V + E ++ +  +  K+  V+I+DEV
Sbjct: 187 DFEQFE----KAITSKTKA---VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEV 239

Query: 371 YQENIF 376
           Y+   F
Sbjct: 240 YEHLYF 245

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNS--QALPYYLDEQSG 308
           ++  T G + +    L IFC   +T   I   QY   ++  A         P  LD    
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDADG- 190

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIA 367
               PE +E ++     +  KP +L  I  G NPTG+ LS +   +I+ +A K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIE 248

Query: 368 DEVY 371
           DE Y
Sbjct: 249 DEPY 252

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P    + S
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
             +   E I+T      QN+    ++ + +PGNPTGA +    + +I +   +   +V+ 
Sbjct: 147 FQANTDEVIKTA-----QNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR--GMVVV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 310
           D+F TAG + A    L +FC     G +I + +   ++++LA   +Q +  +        
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADE 369
             PE++  ++     N  KP +L  I  G NPTG  ++      I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 370 VY 371
            Y
Sbjct: 250 PY 251

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 92/225 (40%), Gaps = 31/225 (13%)

Query: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPED 251
           QL + K F+LD   R              Y + +G + +R  +A          + +  D
Sbjct: 39  QLSNDKPFQLDPDMRL------------TYGAIKGSKDLRTLIAGLYG------VQFSAD 80

Query: 252 IFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWST 311
             L    +   N+LL     G    V+   P Y    +   +  ++     L E+  +  
Sbjct: 81  NVLVTNGAIGANFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSFLP 140

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           N + +    K+AI++  K  ++++ NP NP G V+S E ++ I E+  +    +  DEVY
Sbjct: 141 NLDTL----KKAIKSNTK--LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVY 194

Query: 372 QENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 416
           +        FHS+   + T  R     +DN  ++   S +  ++G
Sbjct: 195 RP------IFHSLPSGVTT-PRSAAQIYDNAVVSGSMSKAFSLAG 232

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 61/126 (48%), Gaps = 13/126 (10%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           E+I L  G+  +++ L+ + C   +  ++I  P Y +Y+    +N+   +  P   ++ S
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTV--LVVINPGNPTGAVLSPESVSQIFEVAAKYGTVV 365
                 + +ET+ ++       PT+  + + +PGNPT A++    + ++       G +V
Sbjct: 148 FQMDTSKVLETLAQD-------PTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLV 198

Query: 366 IADEVY 371
           + DE Y
Sbjct: 199 VVDEAY 204

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDEQSG 308
           E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +    L + + 
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNS 148

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
           +  + E + TV    +QN+    +L + +PGNPTGA +  E +  + +       +V+ D
Sbjct: 149 FQMDTESVLTV----LQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD--GLVVVD 202

Query: 369 EVY 371
           E Y
Sbjct: 203 EAY 205

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/353 (19%), Positives = 134/353 (37%), Gaps = 46/353 (13%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   +  S+ +  +     E+   E++ +T GA+  + + L+ I   G E  
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + +   + E   W+ + EE+            
Sbjct: 151 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTS------ 204

Query: 329 KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKIL 388
           K   L++  P NP G V + E +++I  +  +   V+I+DEVY+   F  +         
Sbjct: 205 KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDSY-------- 256

Query: 389 RTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCP 448
                         ++A+L      ++   G  G     TG+       ++ L    L  
Sbjct: 257 -------------TRIATLSPEIGQLTLTVGSAGKTFAATGWRIGW---VISLNPELLSY 300

Query: 449 VVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSL---EGIECQK 505
           V  G   +      P++   +  ++ A +    E + T  +  ++ F S+    G+    
Sbjct: 301 VSKGHTRICFSSPSPIQEAVANSIEDALKGDYFEAMRTDYIRKFEIFTSVFKEMGLPYTI 360

Query: 506 PQGAMYL---FPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGF 555
           P+G  ++   F K+++P         L+   D      L+   G+  +P + F
Sbjct: 361 PEGTYFILVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINELGVVAIPPTEF 413

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (47%), Gaps = 12/132 (9%)

Query: 245 EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---P 300
           +I Y + DI  TAG + A    L +FC     G +I + +   +++ LA   +Q +   P
Sbjct: 126 DIKYQDWDIIATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFP 181

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAA 359
             +D+       PE++E ++        KP +L  I  G NPTG  L    + +I+ +A 
Sbjct: 182 IPIDDNG---IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQ 238

Query: 360 KYGTVVIADEVY 371
           K+  +++ D  Y
Sbjct: 239 KHDFLIVEDAPY 250

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
           W+ N +E+E  +        K   L++  P NP G V + E + +I E+  K+  V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 369 EVYQENIF 376
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 14/128 (10%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDEQS 307
           DI  T G++   +  L IFC   +T +L    +Y  Y++++   ++Q L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184

Query: 308 GWSTNPEEIETVV---KEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGT 363
           G    PE++E ++    +   +   P +L  I  G NPTG  LS      I+ +A KY  
Sbjct: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 364 VVIADEVY 371
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 54/124 (43%), Gaps = 9/124 (7%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLAL--NNSQALPYYLDEQSG 308
           D+  T G + +    L IFC   +T   I   +Y   ++  A         P  LD    
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDADG- 190

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIA 367
               PE +E ++        KP +L  I  G NPTG+ LS +   +I+ +A K+  ++I 
Sbjct: 191 --LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIE 248

Query: 368 DEVY 371
           DE Y
Sbjct: 249 DEPY 252

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 84/370 (22%), Positives = 153/370 (41%), Gaps = 52/370 (14%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AI  AKS ++     V  YS ++G   + KS+ E + K   G+    +++ +T GA+  +
Sbjct: 61  AINAAKSALD--VPLVNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGI 117

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYL-DEQSGWSTNPEEIET-- 318
            + L+ I   G E  V  P     +    L     + +P +   E    +T  +E +   
Sbjct: 118 LSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDW 177

Query: 319 -VVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
             +++   N+ K    V+IN P NP G V + + ++++ ++  ++ TVVI+DEVY E+++
Sbjct: 178 DALEKTFNNKTKA---VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY-EHLY 233

Query: 377 PGTKFHSMKKILRTLQREHPGKFDNVQLASLHST--SKGVS-GECGQRGGYM-----ELT 428
               F  +  I             N  +A+L  T  S G S    G R G++     +L 
Sbjct: 234 FTESFPRIANI-------------NEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLL 280

Query: 429 GFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRA 488
            +  +    I   +   L     G              E + ++D   +  + E+   + 
Sbjct: 281 NYVSKAHTRICFASPSPLQEACAGSI------------EHALKIDYFPK--MREEYRKKF 326

Query: 489 MTLYDTFNSLEGIECQKPQGAMYL---FPKIDLPFKAVQEARHLELTPDEFYCKSLLEST 545
             L   F+ L G+   +P+G  ++   F K+ +P   V     LE   D      L+   
Sbjct: 327 EILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEI 385

Query: 546 GICTVPGSGF 555
           GI  +P + F
Sbjct: 386 GIVAIPPTEF 395

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 310
           ++  + G + A    L IFC   + G ++   +Y  +++ LA   +Q +         + 
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFG 186

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADE 369
             PE++E ++     N  KP +L  I  G NPTG  L  +    I+ +A K+  +++ DE
Sbjct: 187 IVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDE 246

Query: 370 VY 371
            Y
Sbjct: 247 PY 248

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 310
           D+  TAG + A    L +FC     G +I +  +  ++++LA   +Q +  +        
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHS-FSSSLASAEAQGVITFPVPIDADG 189

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADE 369
             PE++  V++       KP +L  I  G NPTG  ++      I+++A KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 370 VY 371
            Y
Sbjct: 250 PY 251

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 21/176 (11%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGW 309
           ++I L  G+  +++ ++   C   E  V++  P Y +Y     +N+      Y++     
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG----YVEVPLIS 143

Query: 310 STNPEEI-ETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
           S N  +I E  + E +  +    V+ + +PGNPTGA +    V ++         +V+ D
Sbjct: 144 SDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR--NWTAGIVVVD 201

Query: 369 EVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGY 424
           E Y +       F + K  L  L  +HP       L  L + SK  SG  G R G+
Sbjct: 202 EAYID-------FSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   +  S+ +  +     +++ PE++ +T GA+  + + L+ I   G E  
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIINPGDEVI 143

Query: 277 VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 328
           V  P     IP   L    +    +N  + L   + + + W+ + +E    +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP------ 197

Query: 329 KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
           K   +++  P NP G V + E ++++  +  +   ++IADEVY+   F
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYF 245

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDEQS 307
           DI  T G++ A +  L IFC   +T +L    +   Y++++   ++Q L   P  +D Q 
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVI 366
                 EE+ +   +       P +L  I  G NPTG  LS      I+ +A KY  +++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 367 ADEVY 371
            D+ Y
Sbjct: 249 EDDPY 253

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 83/168 (49%), Gaps = 16/168 (9%)

Query: 218 VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 276
           V  YS ++G   +  S+ +  +   + +++  E++ +T GA+  + + L+ +   G E  
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNKDLT-TENVTVTTGANEGILSCLMGLLNAGDE-- 141

Query: 277 VLIPIPQYPLYTATLALNNSQAL------PYYLDEQSGWSTNPEEIETVVKEAIQNEIKP 330
           V++  P +  Y + + L   + +      P  LD ++   T  EE  T+  E  +  I P
Sbjct: 142 VIVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRN---TRGEEW-TIDFEQFEKAITP 197

Query: 331 -TVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
            T  V+IN P NP G V + E ++ +  +  K+  ++I+DEVY+   F
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYF 245

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 310
           D+  TAG++ A +  L +FC   ET   + + +Y  Y+++L    +Q L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 311 TNPEEIETVVKE---AIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
              +++  ++++   A+Q      +  + N  NPTG  L  E   ++  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 368 DEVY 371
           D+ Y
Sbjct: 244 DDPY 247

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 73/183 (39%), Gaps = 32/183 (17%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLL---SIFCR 271
           Y S +G   +R+++  F         RDD   S PE + L++GAS  V  +L   ++   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 272 GPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE--------- 322
           G      I  P Y L           +    +DE    S +   +E  ++E         
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 323 -------------AIQNEIKPTVLVVI-NPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
                        A+  +I   V+  I    NPTG   S E+  ++ E+A KY  ++IAD
Sbjct: 171 DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 369 EVY 371
           +VY
Sbjct: 231 DVY 233

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+   ++ L+   C+     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
                   +ET+ K+ +       +L + +PGNPTG +++ + +  + E   K G VV+ 
Sbjct: 145 FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 368 DEVY 371
           DE Y
Sbjct: 198 DEAY 201

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 73/160 (45%), Gaps = 19/160 (11%)

Query: 221 YSSSQG----VEGIRKSVAEFITKRDDGEISYPE-DIFLTAGASAAVNYLLSIFCRGPET 275
           Y +S+G    VE +R+   +F   R      Y + D+ +TAG++ A +  + +FC   ++
Sbjct: 98  YGNSRGQSELVEFLRQHTEKFHKLR------YADWDVLVTAGSTQAWDATMRLFCNEGDS 151

Query: 276 GVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE---AIQNEIKPTV 332
            V+        Y++++    +Q L     E       PE +  ++ E         +P V
Sbjct: 152 VVMEAFT----YSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELLAEWDTQHAGHARPRV 207

Query: 333 LVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           L  I  G NP G+ L     +QI+ +A +Y  +++ D+ Y
Sbjct: 208 LYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 89/186 (47%), Gaps = 24/186 (12%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AIK A+  + DI   V  YS ++G   +  ++ +  T     E+   E++ +T GA+  +
Sbjct: 73  AIKEAQKAL-DIP-LVNQYSPTRGRVSLLNALIKQYTPIYGSELK-QENVTITTGANEGI 129

Query: 263 -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLD----EQSGWST 311
            + L+ +   G E  V++  P +  Y + + L   + +      P  LD    E + W+ 
Sbjct: 130 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTV 187

Query: 312 NPEEIETVVKEAIQNEIKPTVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEV 370
           + E+     K AI ++ K    V+IN P NP G V + E + QI  +  +   ++I+DEV
Sbjct: 188 DMEQF----KNAITSKTKA---VIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEV 240

Query: 371 YQENIF 376
           Y+   F
Sbjct: 241 YEHLYF 246

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 80/164 (48%), Gaps = 14/164 (8%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETGVLI 279
           YS ++G   + K++A+  T     ++S  ++I +  GA+ A+ + L+ +  +G E  V++
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 280 PIPQYPLYTATLALNNSQAL------PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 333
             P +  Y + + L            P  LD++    T  E    ++++ I +  K    
Sbjct: 134 FEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINSRTK---C 190

Query: 334 VVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
           V+IN P NP G V + E + ++ ++      V+I+DEVY+   F
Sbjct: 191 VIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/122 (19%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDEQSGW 309
           +I L  G+  +++ ++   C      +L+  P Y +Y+    +N+ + +    + E + +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADE 369
             + ++    V + + N+ +  +L + +PGNPTGA +    + ++ +   +   +V+ DE
Sbjct: 149 QMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR--GLVVVDE 202

Query: 370 VY 371
            Y
Sbjct: 203 AY 204

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 71/153 (46%), Gaps = 12/153 (7%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           +Y + +G + +R S+A        G     +DI LT GA  A N+L      G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339
             P Y    +   +  ++     L ++  +  N + +++++K   +      ++++ NP 
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPN 161

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
           NP G+V+  + + QI ++  +    + +DEVY+
Sbjct: 162 NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL---PYYLDEQS 307
           DI  T G++   +  L IFC   +T +L    +   Y++++   ++Q L   P  LD + 
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVI 366
              +  EE+             P +L  I  G NPTG  LS      I+ +A +Y  ++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 367 ADEVY 371
            D+ Y
Sbjct: 248 EDDPY 252

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 63/132 (47%), Gaps = 12/132 (9%)

Query: 245 EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ---ALP 300
           +I Y + D+  TAG + A    L +FC     G +I + +   ++++LA   +Q   A P
Sbjct: 127 DIKYKDWDVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFP 182

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAA 359
             +D        PE++  ++        KP +L  I  G NPTG  ++      I+++A 
Sbjct: 183 VPIDADG---IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQ 239

Query: 360 KYGTVVIADEVY 371
           K+  +++ DE Y
Sbjct: 240 KHDFLIVEDEPY 251

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 11/125 (8%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + + S
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGT-VVI 366
            +  N E + T+    + N+    ++   +PGNPTGA +       I EV  K+   +V+
Sbjct: 148 -FQMNTEAVLTI----LNNDPLIKIMFATSPGNPTGAKI---KTCLIEEVLQKWDNGIVV 199

Query: 367 ADEVY 371
            DE Y
Sbjct: 200 VDEAY 204

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 310
           D+  TAG +      L +FC     G +I + +   ++++LA   +Q +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADE 369
             PE++  ++        KP +L  I  G NPTG  ++      I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 370 VY 371
            Y
Sbjct: 250 PY 251

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPG 378
           KP VL  I  G NPTG  LSPE    I+E+A  +  +++ D+ Y    FP 
Sbjct: 245 KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPYGYLKFPA 295

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSG- 308
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +   L    G 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
           +  + E + T++K    N+    ++ V +PGNPTGA +    + ++ +       +V+ D
Sbjct: 148 FQMDTEAVLTILK----NDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQNWDN--GLVVVD 201

Query: 369 EVY 371
           E Y
Sbjct: 202 EAY 204

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/123 (18%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDEQSG 308
           E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +    + E + 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
           +  N +++  ++K    N+    ++ + +PGNPTG  +  + + ++ +       +V+ D
Sbjct: 148 FQLNSDKVLDILK----NDPLIKLVFITSPGNPTGVKIETKRIEKVLQNWD--NGLVVVD 201

Query: 369 EVY 371
           E Y
Sbjct: 202 EAY 204

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + + S
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
            +  + E + T+    ++N+    ++ V +PGNPTGA +    + Q+ +   + G VV+ 
Sbjct: 148 -FQMDVEAVLTI----LENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 16/137 (11%)

Query: 249 PEDIFLTAGASAAV-NYLLSIFCRGPETGVLIPIPQYPLYTATL--------ALNNSQAL 299
           PE+I +T GA+  +   L+S+   G E  VL P     +Y   +         L   + L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 300 PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAA 359
                + S W+ + ++  + + E      K   +++ +P NPTG V + E +  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 360 KYGTVVIADEVYQENIF 376
           +    +I+DEVY EN++
Sbjct: 213 EKNVYIISDEVY-ENLY 228

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 92/431 (21%), Positives = 162/431 (37%), Gaps = 54/431 (12%)

Query: 159 IGNPQQLQQKPLTYYRQVLSLL-QYPELLNQNEQQLV-------DSKLFKLDAIKRAKSL 210
           I N   L Q PL    +VL L  Q+ +  N N+  L          K+  L AI +A+ +
Sbjct: 22  IRNVSTLTQIPLAPPDRVLGLTEQFVKDKNTNKVNLTVGIYKDGHGKVSTLPAITKAQEI 81

Query: 211 --MEDIGGSVGAYSSSQGVEGIRKSVAEFITKRD----------DGEISYPEDIFLTAGA 258
             ++D      +Y    G    R +V  F+ +            D  +S+ + +  T GA
Sbjct: 82  IDLDDALNKNLSYLPISGCPNYRDNVLNFLFRDSVPKYGDKLIADNRVSFIQSLSGT-GA 140

Query: 259 SAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIET 318
            A  + LLS F       V IP P +P +     +N  + L YY     G  T    +E+
Sbjct: 141 IAVASKLLSSFI---SDTVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLES 197

Query: 319 VVKEAIQNEIKPTVLVVINPG--NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 376
              E   +  K    ++++    NPTG   + +  ++I +   +   + I D  YQ    
Sbjct: 198 TETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQG--L 255

Query: 377 PGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELT-------- 428
                +    +LR    E   K     L    S +K + G  G+R G + +         
Sbjct: 256 ESGSLYDDAYLLRHCLDESRYKGWKHGLFLCQSFAKNM-GLYGERVGSLSIVVPPNLEKA 314

Query: 429 --GFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHE---K 483
                 ++++++  + S    P   G  + +L++  P       EL       +H    +
Sbjct: 315 KLSIDSQLKKIVRGIYS---SPPGYGCRIANLVLSQP-------ELRNQWHQDVHSIVGR 364

Query: 484 LITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP-FKAVQEARHLELTPDEFYCKSLL 542
           L      +YD      G+     Q  M+ F ++D+   + +++   + LT D     S +
Sbjct: 365 LTNVRKQMYDKL-GWSGLVDSSQQHGMFYFTRLDIDQVQLLKDKYSIYLTSDGRLSLSGI 423

Query: 543 ESTGICTVPGS 553
             + I  V GS
Sbjct: 424 NDSNIDYVCGS 434

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           PE++E ++ E      +P +L  I  G NPTG  L+ +   +I+ +A K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 73/177 (41%), Gaps = 26/177 (14%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG--- 276
            Y   +G   +R+ + +F   R  G  S PE + L++G+S     +L +    P T    
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGCLSVL-LHTTLPHTNFTR 109

Query: 277 -VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE------------- 322
              I  P Y L           +    +DE+   S N E++ + ++              
Sbjct: 110 QAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVS 169

Query: 323 AIQNEIKPT-------VLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
            IQN  KPT       +  V    NP+G   S E+ +++ E+A +Y  ++I D+VY 
Sbjct: 170 IIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 27/178 (15%)

Query: 221 YSSSQGVEGIRKSVAEFIT----KRDDGEISYP--EDIFLTAGAS-AAVNYLL--SIFCR 271
           Y S +G   +R+ +  F+     K DDG  +    + + L +GAS   +N LL  ++   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 272 GPETGVLIPIPQYPLYTATL----------ALN-------NSQALPYYLDEQSGWSTNPE 314
           G      I  P Y L               A+N       + ++L   LD   G S    
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 315 EIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
             E +   A+  +I   VL  I    NP+G   S E+  ++ ++A KY  +VI+D+VY
Sbjct: 170 TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 377
           KP  L  +  G NPTG  LSP    +I+E+A K+  +++ D+ Y    FP
Sbjct: 207 KPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFP 256

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 69/179 (38%), Gaps = 30/179 (16%)

Query: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG-- 276
            Y S +G   +R+ V   I +      S PE I LT+GAS  + N LL      P TG  
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTL--PHTGYT 107

Query: 277 --VLIPIPQYPL---------------------YTATLALNNSQALPYYLDEQSGWSTNP 313
               I  P Y L                     YT+       + L Y+  E      N 
Sbjct: 108 KQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNS 167

Query: 314 EEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
            +I    K  +Q +I   V   I    NP+G     E+  Q+ ++A KY  ++I D+VY
Sbjct: 168 TDI-IQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 65/324 (20%), Positives = 133/324 (41%), Gaps = 49/324 (15%)

Query: 249 PEDIFLTAGASAAV-NYLLSIFCRGPETGVLIPIPQYPLYTATLA----------LNNSQ 297
           P ++ +T GA+ A+ + L+ +  +G E  V++  P +  Y + +           L+  +
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 298 ALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEV 357
            L   +   + W+ + +E+   +        K   L++  P NP G V + E + +I  +
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 358 AAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGE 417
             +   V+I+DEVY E+++  ++F  +     TL  E      N+ L      S G +G+
Sbjct: 230 CVENNVVIISDEVY-EHLYFTSEFTRIA----TLSPE----IGNLTL------SVGSAGK 274

Query: 418 CGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAER 477
                G+    G+       +LK AS++   +             P +   +  ++ A +
Sbjct: 275 TFAATGWR--IGWIVSQNAELLKYASMAHTRICFASP-------SPFQEACAKSIEIALQ 325

Query: 478 NSIHEKLITRAMTLYDTFNSL---EGIECQKPQGAMYL---FPKIDLPFKAVQEARHLEL 531
           N+  EK+    +  +D F  +    G+   +P+G  ++   F K+ +P         L  
Sbjct: 326 NNYFEKMRQEYINKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSK 385

Query: 532 TPDEFYCKSLLESTGICTVPGSGF 555
             D      L+   G+  +P + F
Sbjct: 386 AKDFRISYWLINELGVVAIPPTEF 409

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 377
           +P++L  I+ G NPTG  +S E+ ++I+++A KY  +++ D+ Y    +P
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPYSYMSYP 274

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 377
           KP +L  I  G NPTG  LS E   +I+E+  K+  +++ D+ Y   +FP
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFP 257

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 305 EQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTV 364
           E + W+ + +E+   +        K   L++  P NP G V + E + QI ++  +   V
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 365 VIADEVYQENIF 376
           +I+DEVY+   F
Sbjct: 233 IISDEVYEHLYF 244

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 250 EDIFLTAGA-SAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLA--------LNNSQALP 300
           E+I +T GA  A +  L+++   G E  V+ P     ++   +A        L N     
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 301 YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360
             + E + W  + E +     +      K  ++++ NP NP G V + + + ++  +   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 361 YGTVVIADEVYQ 372
            G  +IADEVY+
Sbjct: 213 NGAYIIADEVYE 224

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 74/169 (43%), Gaps = 10/169 (5%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLI 279
           Y+   G+  IR      + K +    S  + D+ L++G+  ++      FC    T ++ 
Sbjct: 125 YNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLME 184

Query: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVK-------EAIQNEIKPTV 332
                P+ +   A   ++ +P  ++     ST   +++ + +          ++  KP +
Sbjct: 185 EFTFTPVISHVKA-TGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRI 243

Query: 333 LVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTK 380
           L  I  G NPTG  +  E+  +I+E+A K+  +++ D+ Y    FP  K
Sbjct: 244 LYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPSYK 292

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 75/183 (40%), Gaps = 33/183 (18%)

Query: 221 YSSSQGVEGIRKSVAEFITKR-----DDGEISYPEDIFLTAGASAAVNYLLSIFCRGPET 275
           Y S  G   +R  +AEF  K           + P+ + LT+GAS  +  +L +    P T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 276 G----VLIPIPQYPL---------YTATLALNNSQA-----------LPYYLDEQSGW-- 309
           G      I  P Y L         +T  +     +            L  + +  +G   
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 310 STNPEEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
               E ++ +  +  Q ++   V+ ++    NPTGA+ S  S  ++ E+A KY  ++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 369 EVY 371
           +VY
Sbjct: 228 DVY 230

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 63/124 (50%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + + S
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
            +  + E   T++K    N+    ++ V +PGNPTGA +    + +I +   + G VV+ 
Sbjct: 148 -FQMDTEAALTILK----NDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV- 200

Query: 368 DEVY 371
           DE Y
Sbjct: 201 DEAY 204

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLAL--NNSQALPYYLDEQSG 308
           D+  T G ++A    L +FC   +T   I   +Y   ++ +A      +A P  LDE   
Sbjct: 132 DVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVPLDENG- 187

Query: 309 WSTNPEEIETVVK--EAIQNEI-KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTV 364
               PE +  ++   E   + + +P +L  +  G NPTG  LS +    ++ +A ++  +
Sbjct: 188 --MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLL 245

Query: 365 VIADEVY 371
           ++ DE Y
Sbjct: 246 IVEDEPY 252

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 331 TVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILR 389
           T  +++N P NP G V + E ++Q+ ++  K    +I+DEVY E+++ G +F  +  I +
Sbjct: 199 TKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISK 257

Query: 390 TL 391
            +
Sbjct: 258 EI 259

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 77/184 (41%), Gaps = 20/184 (10%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 262
           AIK A+  +E     V  YS ++G   +  S+ +F T   + ++        T    A  
Sbjct: 63  AIKEAQRALEI--PLVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 263 NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQ----SGWSTN 312
           + L+ +   G E  V++  P +  Y   + L+  + +      P  LD +      W  +
Sbjct: 121 SILIGLLNPGDE--VIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQID 178

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
            + ++  +        K   +++  P NP G V +   + ++ ++  K   V+I+DEVY+
Sbjct: 179 WDSLQAAMNS------KTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYE 232

Query: 373 ENIF 376
              F
Sbjct: 233 HLYF 236

>SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highly
           similar to uniprot|Q08873 Saccharomyces cerevisiae
           YOR367W SCP1
          Length = 270

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 349 ESVSQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRTLQREHPGKF 399
           E +SQ  E A KYG  V  DE++Q     E+  P   + S+K + R   ++HP KF
Sbjct: 161 EQISQFLEFARKYG--VPDDELFQTLDLYEDKDPAIVYQSLKSLSRYANKKHPDKF 214

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 9/124 (7%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 307
           +++ L  G+  +++ ++   C   +  +L   P Y +Y+    +N+ + L  P   ++ S
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNS 146

Query: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
               + + I  +  + +   IK  ++ + +PGNPTGA +    + +I E  +  G  V+ 
Sbjct: 147 FQPDSQKVISILSSDPL---IK--LVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVV 199

Query: 368 DEVY 371
           DE Y
Sbjct: 200 DEAY 203

>KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.329
           YDR308C
          Length = 141

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 2/48 (4%)

Query: 186 LNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKS 233
           +N  +Q+LVD +  KL+AIK+ +SL++D+ G +  + S  G+   RKS
Sbjct: 94  INSLQQKLVDVEEQKLEAIKKKESLLKDVNGLIETFVS--GIAESRKS 139

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDEQSG 308
           E+  L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+   +    + E + 
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 309 WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 368
           +  +  EI  +    + N+    ++ + +PGNPTGA +  + +  + +   +   +VI D
Sbjct: 147 FQIDATEILNI----LANDPLIKLVFITSPGNPTGAKIEIDRIEYLLKNWDQ--GLVIVD 200

Query: 369 EVY 371
           E Y
Sbjct: 201 EAY 203

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 377
           +P +L  I  G NPTG  LS E   QI+++A K+  +++ D+ Y    FP
Sbjct: 239 RPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPYGYLKFP 288

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 58/143 (40%), Gaps = 5/143 (3%)

Query: 231 RKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTAT 290
           R S     T  D   IS+ + +  T GA A  + LLS+F       V IP P +P +   
Sbjct: 98  RDSCPRGATFLDQNRISFVQTLSGT-GALAVASKLLSLFM---SRSVWIPNPSWPNHANV 153

Query: 291 LALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVV-INPGNPTGAVLSPE 349
              N  + + YY   + G       I+ + K A +    P  +V+     NPTG   S E
Sbjct: 154 FQNNGFKEINYYSYYKDGSLDIEGWIQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKE 213

Query: 350 SVSQIFEVAAKYGTVVIADEVYQ 372
              +I +   +   + I D  YQ
Sbjct: 214 QWQRILDKIHELNLIPIIDMAYQ 236

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 250 EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGW 309
           E++ L  G+  +++ ++   C   +  ++   P Y +Y+   ++N+ + +   L      
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPL----VT 140

Query: 310 STNPEEIETVVKEAIQNEIKPTVLV----VINPGNPTGAVLSPESVSQIFEVAAKYGTVV 365
           S N  +++T   EA+ + +K   L+    + +PGNPTGA +    + +I +   +   ++
Sbjct: 141 SDNSFQVDT---EAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQNWDQ--GIL 195

Query: 366 IADEVY 371
           + DE Y
Sbjct: 196 VVDEAY 201

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 73/184 (39%), Gaps = 35/184 (19%)

Query: 221 YSSSQGVEGIRKSVAEFITKR-----DDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPE 274
           Y S  G   +R  +AEF  +           + PE + LT+GAS  + N LL      P 
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTL--PH 105

Query: 275 TG----VLIPIPQYPLYT-ATLALNNSQALPYYLDEQSGW--------------STNPEE 315
           TG      I  P Y L   A L    +  +    ++  G               S+N E 
Sbjct: 106 TGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGES 165

Query: 316 IETV--------VKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 367
            +           ++  +   +  + +V    NPTGA+ S  S  ++ E+A KY  ++I+
Sbjct: 166 GQKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIIS 225

Query: 368 DEVY 371
           D+VY
Sbjct: 226 DDVY 229

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 377
           KP +L  I+ G NP G  LS E   +I+++A ++  +++ D+ Y    FP
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFP 272

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 73/356 (20%), Positives = 143/356 (40%), Gaps = 84/356 (23%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           Y+ ++G+  +   V + + +       D+ E ++  D+ L+ G++ ++  +    C    
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 275 TGVLIPIPQYPLYTATLALNNSQA-----LPYYLD-----EQSG------------WSTN 312
           T V+I       +T T A++N +A     +P  +D     E+ G            WST 
Sbjct: 159 TTVMIE-----EFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTG 213

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           P           ++  KP VL  I  G NPTG  +      +I+++A K+  +++ D+ Y
Sbjct: 214 P----------YKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPY 263

Query: 372 QENIFPG------------TKFHSMKKILRTLQREHPGKFD-NVQLASLHSTSKGVSGEC 418
               FP             +   ++++ L     +     D + ++  L + SK  +   
Sbjct: 264 GYMYFPSYNPQNPLENPYDSSDLTIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP-- 321

Query: 419 GQRGGYMELTGFSHEMRQVILKLASISL-CPVVTGQALVDLMVRPPVEGEESFELDQAER 477
           G R  ++    F   + Q IL LA I+   P  T QA+V   ++   E E S  +  + R
Sbjct: 322 GLRLSFIVANKF---LLQKILDLADITTRAPSGTSQAIVYSTIKAMAESEMSSSV--SFR 376

Query: 478 NSIHEKLITRAMTLYDTFNSLEGIECQ----------------KPQGAMYLFPKID 517
           +++ E  I   M +   +N  + +  +                +P   M++  K+D
Sbjct: 377 DAMFESWIKWIMQIASKYNHRKNVTLKALYETESYQAGHFTVMEPSAGMFIIIKLD 432

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           KP +L  I  G NPTG  LS E   QI+ +A K+  ++I D+ Y
Sbjct: 239 KPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDPY 282

>TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.475
           YKL106W
          Length = 426

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 5/132 (3%)

Query: 242 DDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY 301
           ++G +S+ + +  T GA A  + LL++F       V I  P +P +      N    L  
Sbjct: 109 EEGRVSFAQTLSGT-GALAVASKLLALFL---SRTVWISEPSWPNHQNIFRSNGFTDLRT 164

Query: 302 YLDEQSGWSTNPEEIETVVKEAIQN-EIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360
           Y   Q+G     E +E +  E  ++ E + ++++     NPTG   + E   +I +   +
Sbjct: 165 YPYYQNGRLVVDEWLEKLKTEVRKDPETRHSIILHACCHNPTGLDPTREEWVRILDTVHE 224

Query: 361 YGTVVIADEVYQ 372
            G + I D  YQ
Sbjct: 225 LGMIPILDMAYQ 236

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 305 EQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTV 364
           E + W  + + +   + E      K   +++ +P NP G V + E + ++  +  + G  
Sbjct: 194 EGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIY 247

Query: 365 VIADEVYQENIF 376
           +I+DEVY+   F
Sbjct: 248 IISDEVYEHLYF 259

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           KPT++  +  G NPTG  LS E   QI+ +A ++  +++ D+ Y
Sbjct: 241 KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 93/445 (20%), Positives = 168/445 (37%), Gaps = 108/445 (24%)

Query: 221 YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           Y+ ++G+  +   V +F+++       D+ E ++  D+ L+ G++ ++  +    C    
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 275 TGVLIPIPQYPLYTATLALNNSQA---------LPYYLDEQS-------------GWSTN 312
           T V+I       +T T A++N +A         +    D +S              WST 
Sbjct: 159 TTVMIE-----EFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTG 213

Query: 313 PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           P           ++  KP VL  I  G NPTG  +      +I+++A ++  +++ D+ Y
Sbjct: 214 P----------YKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPY 263

Query: 372 QENIFPG--------TKFHS----MKKILRTLQREHPGKFD-NVQLASLHSTSKGVSGEC 418
               FP           +HS     ++ L     +     D + ++  L + SK  +   
Sbjct: 264 GYLYFPSYNPQEPLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--P 321

Query: 419 GQRGGYMELTGFSHEMRQVILKLASISL-CPVVTGQALVDLMVRPPVEGEESFELDQAER 477
           G R  ++    F   + Q IL LA I+   P  T QA+V   ++   E   S  L   E 
Sbjct: 322 GLRLSFIVANKF---LLQKILDLADITTRAPSGTSQAIVYSTIKAMAESNLSSSLSMKE- 377

Query: 478 NSIHEKLITRAMTLYDTFNSLEGIECQ----------------KPQGAMYLFPKI----- 516
            ++ E  I   M +   +N  + +  +                +P   M++  KI     
Sbjct: 378 -AMFEGWIRWIMQIASKYNHRKNLTLKALYETESYQAGQFTVMEPSAGMFIIIKINWGNF 436

Query: 517 DLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 576
           D P    Q+   L    D+F  K+     G+  V G      P      + FL   + + 
Sbjct: 437 DRPDDLPQQMDIL----DKFLLKN-----GVKVVLGYKMAVCPNYSKQNSDFLRLTIAYA 487

Query: 577 ----------KKWETFHKEFFDQYR 591
                     K+  +  KEFFD Y+
Sbjct: 488 RDDDQLIEASKRIGSGIKEFFDNYK 512

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
           Anc_2.102 YHR137W
          Length = 493

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 329 KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           KP ++  I  G NPTG  LS E   QI+ +A K+  +++ D+ Y
Sbjct: 204 KPKMIYTIATGQNPTGMTLSMEKRRQIYALAQKHDLLILEDDPY 247

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 75/184 (40%), Gaps = 43/184 (23%)

Query: 221 YSSSQGVEGIRKSVAEFITKRD----DGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 276
           Y+ S+G   + + V + +++ +      E+    D+ L+ G++ ++  +    C    T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 277 VLIPIPQYPLYTATLALNNSQA---------LPYYLDEQS-------------GWSTNPE 314
           VLI       +T T A++N +A         +   LD  S              WST P 
Sbjct: 161 VLIE-----EFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGP- 214

Query: 315 EIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQE 373
                     ++  KP VL  I  G NPTG  +      +I+ +A K+  +++ D+ Y  
Sbjct: 215 ---------YKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGY 265

Query: 374 NIFP 377
             FP
Sbjct: 266 LYFP 269

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 73/182 (40%), Gaps = 36/182 (19%)

Query: 221 YSSSQGVEGIRKSVAEFITKRDDGEI------SYPEDIFLTAGASAAVNYLLSIFCRGPE 274
           Y   +G + +R ++A F    D  ++      + PE I LTAGAS  V  +L      P 
Sbjct: 52  YGPDEGSKWVRTAIAAF--SNDCFQLPSEEMKTKPEHINLTAGASYGVMNILEQTTL-PH 108

Query: 275 TG----VLIPIPQYPLYTAT--------------------LALNNSQALPYYLDEQSGWS 310
           TG      I  P Y L   T                    +  +  Q    Y D  S  +
Sbjct: 109 TGYTRQAFIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYFDSIS--N 166

Query: 311 TNPEEIETVVKEAIQNEIKPTVLVVI-NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADE 369
            N  E++ +       ++   V+ ++    NP G   S E+  ++ E+A K+  ++++D+
Sbjct: 167 DNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDD 226

Query: 370 VY 371
           VY
Sbjct: 227 VY 228

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 97/252 (38%), Gaps = 23/252 (9%)

Query: 203 AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKR---------DDGEISYPEDIF 253
           ++ RA+ ++E   G   AY    G       V++F+              G +S+ + + 
Sbjct: 84  SVARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLS 143

Query: 254 LTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNP 313
            T   S A  +L +   +     + +P P +  +     LN  + +  Y   + G     
Sbjct: 144 GTGALSLASLFLSNFISKT----IWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVD 199

Query: 314 EEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQE 373
             +  + + A        +L+     NPTG   + E  S+I  V    G V I D  YQ 
Sbjct: 200 SWLAQLERAAADRPYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQG 259

Query: 374 NIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHE 433
                    +   +LR +  EH  ++DN  L   HS +K + G  G+R G + +    H 
Sbjct: 260 --LESGDLRADAYLLR-MCLEH--RWDN-GLYVCHSFAKNM-GLYGERVGSLSVV---HP 309

Query: 434 MRQVILKLASIS 445
           + Q   K A+ S
Sbjct: 310 LGQFQAKAATDS 321

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 339 GNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
            NP+G   S E+  ++ ++A KY  ++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
           NP+G   S E+  ++ E+A KY  +VI D+VY 
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVYD 235

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%)

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHS 383
           NP+GA  S E   ++ ++A +Y  ++I+D+VY    F G +  S
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371
           NP+G   + E+  ++ E+A KY  +++AD+VY
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>KLTH0D00836g Chr4 complement(79191..79817) [627 bp, 208 aa] {ON}
           similar to uniprot|Q08873 Saccharomyces cerevisiae
           YOR367W
          Length = 208

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 349 ESVSQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRTLQREHPGKF 399
           E +SQ    A +YG  V  DE++Q     E   P T + ++K + R   ++HP +F
Sbjct: 99  EQISQFLSFARQYG--VPEDELFQTVDLYEEKDPATVYQALKSLSRYANKKHPHQF 152

>Kwal_26.6795 s26 complement(66701..67327) [627 bp, 208 aa] {ON}
           YOR367W (SCP1) - Calponin homolog [contig 44] FULL
          Length = 208

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 349 ESVSQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRTLQREHPGKF 399
           E +SQ    A +YG  V  DE++Q     E   P   + S+K + R   ++HP KF
Sbjct: 99  EQISQFLAFARQYG--VPEDELFQTIDLYEEQDPAIVYQSLKSLSRYANKKHPQKF 152

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 66/141 (46%), Gaps = 21/141 (14%)

Query: 251 DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQA-----LPYYLDE 305
           D+ L+ G++ ++  +   FC    T V+I       +T T A++N +A     +P  ++ 
Sbjct: 184 DVILSGGSNDSMYKVFETFC-DESTTVMIE-----EFTFTPAVSNVEATGATVVPIKINL 237

Query: 306 QSGWSTNPEEIETVVKEAIQNEI--------KPTVLVVINPG-NPTGAVLSPESVSQIFE 356
            +   T   +++  + + ++N          KP VL  I  G NPTG  +      +I+E
Sbjct: 238 SADRETQSVDVD-YLSQLLENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYE 296

Query: 357 VAAKYGTVVIADEVYQENIFP 377
           +A ++  +++ D+ Y    FP
Sbjct: 297 LAQRHDFLIVEDDPYGYLYFP 317

>NDAI0G05620 Chr7 (1389796..1393293) [3498 bp, 1165 aa] {ON}
           Anc_1.294 YJL076W
          Length = 1165

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 70/178 (39%), Gaps = 16/178 (8%)

Query: 394 EHPGKFDNVQLASLHSTSKGVSGECGQRGGY----MELTGFSHEMRQVILKLASISLCPV 449
           +HP +  N+ + + HS  +G S E     GY    +E  G      + I          V
Sbjct: 691 QHPDQVQNININNDHSDEEG-SYETSSTDGYSSSGVETAGSDTSDNEKIFLREPNDKTKV 749

Query: 450 VTGQALVDLMVRPPVEGEESFELDQA-ERNSIHEKLITRAMTLYDTFNSLEGIECQKPQG 508
           +    L + +V    + ++  + + A   ++I  K+I +  +   + N  EG+   +P  
Sbjct: 750 IKTHHLKEAVVTKSNDNDKDTKQETATSTDNILGKVIGKNPSTASSGNVPEGLTKSQPS- 808

Query: 509 AMYLFPKIDLP----FKAVQEARHLELTPDEFYCKSLLESTGI-CTVPGSGFGQEPGT 561
               F KI+       K + E + + LTP  FY  S  E   +    P S F   P T
Sbjct: 809 ----FSKINEDDISNNKKINETKSISLTPSNFYSNSKTELKKLNIHKPTSKFTSMPNT 862

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 372
           NPTG   +PE   Q+ +  AKY  + + D  YQ
Sbjct: 186 NPTGMDPTPEEWEQVLDAMAKYHHIALFDSAYQ 218

>KNAG0C02710 Chr3 (532540..533421) [882 bp, 293 aa] {ON} Anc_5.561
           YDR446W
          Length = 293

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 61/147 (41%), Gaps = 23/147 (15%)

Query: 383 SMKKILRTLQREHPGKFDNVQLASL-------HSTSKGVSGECGQRGGYMELTGFSHEMR 435
           S+K+I    QRE PGK ++ +LA+         S +K +  EC Q       T   HE  
Sbjct: 48  SLKEISSNKQREFPGKSNDTKLANFANFFLSPSSLTKKLEPECSQ-------TFIKHEPT 100

Query: 436 QVILKLASISLCPVVTGQALVDLMVRPPV----EGEESFELDQAERNSIHEKLITRAMTL 491
                 +   L P +T     +  V  PV     G E   + ++++   ++K+  R   +
Sbjct: 101 DT----SKACLIPSITCSPTTNPAVENPVLNTSTGNEEKRVSKSKKRDHNQKMFKRTAEV 156

Query: 492 YDTFNSLEGIEC-QKPQGAMYLFPKID 517
             T   ++ +E  +K      +F KID
Sbjct: 157 AATGPIVDEVESLEKSVNDPGVFKKID 183

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,520,449
Number of extensions: 2616109
Number of successful extensions: 7452
Number of sequences better than 10.0: 146
Number of HSP's gapped: 7583
Number of HSP's successfully gapped: 146
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)