Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1578.263ON59259229840.0
YLR089C (ALT1)8.263ON59259228350.0
Smik_12.1488.263ON59259227770.0
Suva_10.1738.263ON59259227260.0
TDEL0F039008.263ON55949920570.0
NCAS0B050208.263ON56849920520.0
NDAI0B019908.263ON58849920400.0
KNAG0G020408.263ON59149019970.0
ZYRO0C01628g8.263ON53448719860.0
KLLA0F19162g8.263ON52848619570.0
SAKL0H17006g8.263ON53148819390.0
KAFR0B027308.263ON53948919380.0
CAGL0L12254g8.263ON57457319350.0
Kpol_392.58.263ON51249618340.0
TPHA0J007508.263ON52249618200.0
NCAS0B038408.263ON49749517730.0
KNAG0M012108.263ON52150017560.0
Smik_4.3578.263ON50748917360.0
KLTH0G13662g8.263ON51948117310.0
TBLA0E044408.263ON56249217260.0
Skud_4.3728.263ON50748917130.0
YDR111C (ALT2)8.263ON50748917120.0
Kwal_56.237918.263ON51850617080.0
Suva_2.2718.263ON50748916960.0
KAFR0B055308.263ON51449016920.0
Kpol_543.398.263ON49248916740.0
NDAI0J013608.263ON50149716700.0
KAFR0B05520singletonON51049716310.0
AGR085W8.263ON52148816280.0
TPHA0A018008.263ON49849016180.0
Ecym_43078.263ON53451016160.0
TBLA0F030608.263ON50049415900.0
TBLA0G01630singletonON50049715880.0
Kwal_34.160181.472ON3791671455e-09
KLTH0G19646g1.472ON3791861358e-08
SAKL0F02156g3.511ON4981551288e-07
Kwal_23.48882.252ON3891241206e-06
Kwal_56.23794singletonOFF1151151116e-06
NCAS0G040501.472ON3841641171e-05
Kpol_1039.222.252ON3861691171e-05
Suva_6.1361.321ON4441851172e-05
SAKL0D11528g1.472ON3831521162e-05
TPHA0O014501.321ON4431681162e-05
KLLA0F03509g2.252ON3871701152e-05
Skud_10.1561.321ON4601851153e-05
TDEL0D019001.321ON4431681144e-05
KAFR0D014203.511ON4921601144e-05
NCAS0E006703.511ON4972501144e-05
NDAI0G057601.321ON4481791135e-05
Ecym_7228na 1ON4881991135e-05
Kpol_1032.398.204ON4531881118e-05
KNAG0G005501.472ON3872401101e-04
CAGL0J05126g1.321ON4331771101e-04
YJL060W (BNA3)1.321ON4441851101e-04
NCAS0A092001.321ON4451851091e-04
NDAI0B045502.102ON5651701073e-04
Ecym_32902.252ON3861261063e-04
KLTH0G09614g2.252ON3891241063e-04
Kwal_14.25741.321ON443681063e-04
ZYRO0G20636g1.321ON4533531063e-04
Kpol_1035.231.321ON4441681046e-04
Smik_10.1801.321ON4441681046e-04
Smik_7.693.511ON5001221038e-04
ZYRO0A01672g2.252ON3861241020.001
NDAI0B037302.252ON3861231020.001
Ecym_6319singletonON3541371000.001
SAKL0E08492g2.252ON3841261000.002
KNAG0B053201.321ON4331641000.002
KLLA0A04906gna 1ON480124990.002
Kpol_480.11.472ON380153980.003
TPHA0F012602.252ON392175980.003
KAFR0A017101.321ON435185980.003
SAKL0D06886g1.321ON447324980.003
KLTH0H10648g1.321ON443177970.004
YDR112W (IRC2)singletonOFF10270880.006
ADL249W2.252ON387176950.006
YIL116W (HIS5)2.252ON385123940.008
TDEL0A016008.204ON475183940.009
AGR167Wna 1ON512158940.010
Suva_9.782.252ON386124930.011
Smik_9.532.252ON388124930.011
Ecym_62921.321ON430132930.012
KLLA0F01617g1.321ON444182930.012
KNAG0E018502.252ON384122920.015
SAKL0E12188g2.102ON530170920.017
NCAS0B064402.252ON385123910.019
CAGL0G06028g2.102ON537169910.023
TBLA0B009902.102ON54650910.023
TBLA0B080808.204ON444178900.028
ZYRO0G05346g2.102ON50450890.038
TPHA0O015202.102ON50350880.051
Smik_5.3198.204ON443178870.063
KLTH0B00176g8.204ON448183870.064
TDEL0C040902.252ON383126860.078
KLTH0G19624gsingletonON468184860.085
Skud_4.373singletonON18670830.091
KAFR0B007905.329ON14148810.10
Skud_9.552.252ON385123840.14
Kwal_26.77682.475ON422144840.14
CAGL0I06578g8.204ON436175840.14
Kwal_33.145822.102ON52550840.15
KAFR0J015802.252ON383123830.18
CAGL0C01243g2.252ON383124830.18
NCAS0B072202.102ON51050830.20
KLTH0B06270g2.102ON525129820.27
KLLA0E05215g4.241ON12593770.27
SAKL0D14630g7.14ON27056800.34
KNAG0H037302.102ON52344780.81
KLLA0E00969g8.204ON445180771.0
AEL170C1.321ON45848771.0
TDEL0F009002.102ON49361771.0
Skud_8.1982.102ON517184771.1
ZYRO0B11088g8.204ON450183761.3
TDEL0A025102.475ON426132751.7
Suva_15.3342.102ON560136751.9
KNAG0C027105.561ON293147741.9
NCAS0A038308.204ON446180742.3
KLLA0F02233g1.347ON40158732.9
YHR137W (ARO9)2.102ON513186733.2
Ecym_23281.347ON40164723.9
Suva_5.2818.204ON45032724.0
KNAG0G016808.204ON45232724.0
Smik_8.2182.102ON513181724.2
YJR151C (DAN4)na 2ON116166724.8
CAGL0H00110gsingletonON36634714.9
Kwal_8.5858.204ON44644715.3
KLTH0D00836g7.14ON20856696.2
Suva_15.1337.101ON109297716.3
ABL038W2.475ON443252707.0
Kpol_1004.715.311ON67042707.7
NDAI0G056201.294ON1165178708.3
TBLA0B093302.420ON40833699.0
Kwal_34.15954singletonOFF9925649.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Skud_12.157
         (1779 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...  1154   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...  1096   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...  1074   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...  1054   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   796   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   795   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   790   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   773   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   769   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   758   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   751   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   751   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   749   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   711   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   705   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   687   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   681   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   673   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   671   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   669   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   664   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   664   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   662   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   657   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            656   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   649   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   647   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   632   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   631   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   627   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   627   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   617   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              616   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    60   5e-09
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    57   8e-08
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    54   8e-07
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    51   6e-06
Kwal_56.23794 s56 complement(707600..707947) [348 bp, 115 aa] {O...    47   6e-06
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    50   1e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    50   1e-05
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    50   2e-05
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    49   2e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    49   2e-05
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    49   2e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    49   3e-05
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    49   4e-05
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    49   4e-05
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     49   4e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    48   5e-05
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    48   5e-05
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    47   8e-05
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       47   1e-04
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    47   1e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    47   1e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    47   1e-04
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    46   3e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    45   3e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    45   3e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    45   3e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    45   3e-04
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    45   6e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    45   6e-04
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    44   8e-04
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    44   0.001
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    44   0.001
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    43   0.001
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    43   0.002
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    43   0.002
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    43   0.002
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    42   0.003
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    42   0.003
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    42   0.003
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    42   0.003
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    42   0.004
YDR112W Chr4 (679544..679852) [309 bp, 102 aa] {OFF}  IRC2Dubiou...    39   0.006
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    41   0.006
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    41   0.008
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    41   0.009
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    41   0.010
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    40   0.011
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    40   0.011
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    40   0.012
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    40   0.012
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    40   0.015
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    40   0.017
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    40   0.019
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    40   0.023
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    40   0.023
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    39   0.028
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    39   0.038
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    39   0.051
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    38   0.063
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    38   0.064
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    38   0.078
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    38   0.085
Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W (...    37   0.091
KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.32...    36   0.10 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    37   0.14 
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    37   0.14 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    37   0.14 
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    37   0.15 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    37   0.18 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    37   0.18 
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    37   0.20 
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    36   0.27 
KLLA0E05215g Chr5 (459726..460103) [378 bp, 125 aa] {ON} weakly ...    34   0.27 
SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highl...    35   0.34 
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    35   0.81 
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    34   1.0  
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    34   1.0  
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    34   1.0  
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    34   1.1  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    34   1.3  
TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.4...    33   1.7  
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    33   1.9  
KNAG0C02710 Chr3 (532540..533421) [882 bp, 293 aa] {ON} Anc_5.56...    33   1.9  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     33   2.3  
KLLA0F02233g Chr6 (199224..200429) [1206 bp, 401 aa] {ON} simila...    33   2.9  
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    33   3.2  
Ecym_2328 Chr2 complement(641102..642307) [1206 bp, 401 aa] {ON}...    32   3.9  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    32   4.0  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    32   4.0  
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    32   4.2  
YJR151C Chr10 complement(712255..715740) [3486 bp, 1161 aa] {ON}...    32   4.8  
CAGL0H00110g Chr8 complement(2611..3711) [1101 bp, 366 aa] {ON} ...    32   4.9  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    32   5.3  
KLTH0D00836g Chr4 complement(79191..79817) [627 bp, 208 aa] {ON}...    31   6.2  
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    32   6.3  
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    32   7.0  
Kpol_1004.71 s1004 complement(152942..154954) [2013 bp, 670 aa] ...    32   7.7  
NDAI0G05620 Chr7 (1389796..1393293) [3498 bp, 1165 aa] {ON} Anc_...    32   8.3  
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    31   9.0  
Kwal_34.15954 s34 complement(132450..132749) [300 bp, 99 aa] {OF...    29   9.8  

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
            YLR089C (REAL)
          Length = 592

 Score = 1154 bits (2984), Expect = 0.0
 Identities = 578/592 (97%), Positives = 578/592 (97%)
 Frame = +1

Query: 1    MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 180
            MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV
Sbjct: 1    MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 60

Query: 181  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 360
            LQRHSSSWVA              NDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV
Sbjct: 61   LQRHSSSWVAGQSHSRSLSGQSSLNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 120

Query: 361  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 540
            LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 541  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 720
            QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
Sbjct: 181  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 721  RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 900
            RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241  RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 901  YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 1080
            YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK
Sbjct: 301  YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 360

Query: 1081 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 1260
            YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361  YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 1261 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 1440
            RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI
Sbjct: 421  RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 480

Query: 1441 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 1620
            HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS
Sbjct: 481  HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 540

Query: 1621 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 1776
            LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD
Sbjct: 541  LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
            ALT1Alanine transaminase (glutamic pyruvic transaminase);
            involved in alanine biosynthetic and catabolic processes;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 592

 Score = 1096 bits (2835), Expect = 0.0
 Identities = 547/592 (92%), Positives = 562/592 (94%)
 Frame = +1

Query: 1    MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 180
            MLSLS KN  T SN IT +IKSYHIRTLT+S +KMP+I  PF T+AS+TKLKAFRKVRPV
Sbjct: 1    MLSLSAKNHFTVSNSITHVIKSYHIRTLTSSAEKMPHITTPFSTSASSTKLKAFRKVRPV 60

Query: 181  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 360
            LQRHSSSW+               NDLRHLNRFPHHTLKT N++FYPAEQLTLEDVNENV
Sbjct: 61   LQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENV 120

Query: 361  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 540
            LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFD+IINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 541  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 720
            QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK
Sbjct: 181  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 240

Query: 721  RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 900
            RD+GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241  RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 901  YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 1080
            YYLDE SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301  YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 1081 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 1260
            YGTVVIADEVYQENIFPGTKFHSMKKILR LQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361  YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 1261 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 1440
            RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE DQAERNSI
Sbjct: 421  RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSI 480

Query: 1441 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 1620
            HEKLITRAMTLY+TFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCK 
Sbjct: 481  HEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKK 540

Query: 1621 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 1776
            LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWE+FHKEFFDQYRD
Sbjct: 541  LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
            YLR089C (REAL)
          Length = 592

 Score = 1074 bits (2777), Expect = 0.0
 Identities = 535/592 (90%), Positives = 555/592 (93%)
 Frame = +1

Query: 1    MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 180
            M  LS K   T SN I+  IKSYHIRTLT+  +KMP+I+ PF T+ASNT LKAFRK+RPV
Sbjct: 1    MSYLSAKTHFTVSNSISQAIKSYHIRTLTSRAEKMPHISTPFTTSASNTNLKAFRKIRPV 60

Query: 181  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 360
            LQRHSSSW+A              NDLRHLNRFPHHTLKT N++FYPAEQLTL+DVNENV
Sbjct: 61   LQRHSSSWIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENV 120

Query: 361  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 540
            LKAKYAVRGAIPMRAEELKAQLEKDPQSLPF+KIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 541  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 720
            QYPELLNQNEQQLVDSKLFKLDAIKRAKSLME+IGGSVGAYSSSQGVEGIR+SVAEFITK
Sbjct: 181  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITK 240

Query: 721  RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 900
            RD+GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP
Sbjct: 241  RDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 300

Query: 901  YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 1080
            YYLDE SGWSTNPEEIETVVKEAI+NEIK TVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301  YYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 1081 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 1260
            YGTVVIADEVYQENIFPGTKFHSMKKILR LQREHPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361  YGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 1261 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 1440
            RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP+EGEESFE DQAERNSI
Sbjct: 421  RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSI 480

Query: 1441 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 1620
            HEKLITRAMTLY TFNSLEGIECQKPQGAMYLFPKIDLPF+AVQEARHLELTPDEFYCK 
Sbjct: 481  HEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKK 540

Query: 1621 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 1776
            LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFD YRD
Sbjct: 541  LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
            YDR111C (REAL)
          Length = 592

 Score = 1054 bits (2726), Expect = 0.0
 Identities = 522/592 (88%), Positives = 552/592 (93%)
 Frame = +1

Query: 1    MLSLSVKNRCTASNCITDIIKSYHIRTLTTSVKKMPYINPPFITTASNTKLKAFRKVRPV 180
            MLSLS KN  T +N IT I+KSYHI+TLTTS KKMP+I   F TTAS+TKLKAFR+VRPV
Sbjct: 1    MLSLSAKNHFTVNNSITHIVKSYHIKTLTTSAKKMPHITTSFTTTASSTKLKAFRQVRPV 60

Query: 181  LQRHSSSWVAXXXXXXXXXXXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENV 360
            LQRHSSSW+A               DLRHLNRFPHHTLKT N++FYPAEQLTL+DVNENV
Sbjct: 61   LQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFYPAEQLTLDDVNENV 120

Query: 361  LKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLL 540
            LKA+YAVRGAIPMRAEELKAQLEKDPQSLPF+KIINANIGNPQQLQQKPLTYYRQVLSLL
Sbjct: 121  LKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLL 180

Query: 541  QYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITK 720
            QYPELLN NEQ+LV SKLFK+DAIKRAKSL++DIGGSVGAYSSSQGVEGIRKSVA+FITK
Sbjct: 181  QYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITK 240

Query: 721  RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALP 900
            RD GE +YPEDIFLTAGASAAV YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ LP
Sbjct: 241  RDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLP 300

Query: 901  YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 1080
            YYLDE SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPES++QIFEVAAK
Sbjct: 301  YYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAK 360

Query: 1081 YGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQ 1260
            YGTVVIADEVYQENIFPGT+F+SMKK+LR LQR+HPGKFDNVQLASLHSTSKGVSGECGQ
Sbjct: 361  YGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQ 420

Query: 1261 RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSI 1440
            RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE DQ+ERNSI
Sbjct: 421  RGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSI 480

Query: 1441 HEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKS 1620
            HEKL TRAMTLY+TFNSLEGIECQKPQGAMYLFPKID+PFKA+QEA HLELTPDEFYCK 
Sbjct: 481  HEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKK 540

Query: 1621 LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 1776
            LLESTGICTVPGSGFGQEPGTYHLRTTFLAPG+EW+KKWE FHKEFFDQYRD
Sbjct: 541  LLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
            Anc_8.263 YDR111C
          Length = 559

 Score =  796 bits (2057), Expect = 0.0
 Identities = 386/499 (77%), Positives = 444/499 (88%), Gaps = 1/499 (0%)
 Frame = +1

Query: 283  HHTL-KTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 459
            HH   K  + DFYPAE LT+ D+NENVLKAKYAVRG+IPMRAEEL+ QL++DP SLPFDK
Sbjct: 61   HHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDK 120

Query: 460  IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 639
            I+NANIGNPQQL QKPL++YRQVLS+LQYPE+L Q E++L+   +FK DAI+RAK ++ D
Sbjct: 121  IVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRD 180

Query: 640  IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 819
            +GGSVGAYSSSQGV GIRK+VA+FIT+RD GE +YPEDIFLTAGASAAV+YLLSI CRG 
Sbjct: 181  VGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQ 240

Query: 820  ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 999
            ETGVLIPIPQYPLYTATLALNNS  LPYYLDE+SGWSTN  EIE VV E+I++ I+P+VL
Sbjct: 241  ETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVL 300

Query: 1000 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 1179
            VVINPGNPTG+VLS E++ +IF+VAAKYG VVIADEVYQENIF G++FHSMKK+LR LQ+
Sbjct: 301  VVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQK 360

Query: 1180 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 1359
            EHPG +DNVQL SLHSTSKGVSGECGQRGGYMELTGF+HE+RQV+LKLASISLCPVVTGQ
Sbjct: 361  EHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ 420

Query: 1360 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 1539
            ALVDLMV PP  G+ES+E D+ ER  IHE+L  RA  L+DTFNSLEGIECQKP+GAMYLF
Sbjct: 421  ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF 480

Query: 1540 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 1719
            P+I LP+KA+Q A+HLE TPDEFYC+ LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 481  PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 540

Query: 1720 EWIKKWETFHKEFFDQYRD 1776
            EWIKKWE FHK+F+DQYRD
Sbjct: 541  EWIKKWEDFHKKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  795 bits (2052), Expect = 0.0
 Identities = 386/499 (77%), Positives = 445/499 (89%)
 Frame = +1

Query: 280  PHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 459
            P  T K  +++F PA+QLTL ++N+NVLKAKYAVRGAIPMRAEELK QL++DP SLPFD 
Sbjct: 70   PKPTTKKNHNNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDH 129

Query: 460  IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 639
            I+NANIGNPQQL QKPL++YRQVLSLLQYPE+L Q+E +LV S LFK DA++RAK+L+ +
Sbjct: 130  IVNANIGNPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHE 189

Query: 640  IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 819
            IGG+VGAYS+SQGV GIRK+VA FITKRD+GE +YPEDIFLTAGASAAV YLLSI C+GP
Sbjct: 190  IGGTVGAYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGP 249

Query: 820  ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 999
            ETGVLIPIPQYPLYTA+LALNNS ALPYYLDE+SGWSTNP+EIE VV  A   +I+P+VL
Sbjct: 250  ETGVLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVL 309

Query: 1000 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 1179
            VVINPGNPTGAVLS +S+  IFE+AAKYG VVIADEVYQEN+F   KFHSMKK+LR LQ+
Sbjct: 310  VVINPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQK 369

Query: 1180 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 1359
            +HPG +D VQLASLHSTSKGVSGECGQRGGYMELTGF+HE+R VILKLASISLCPVVTGQ
Sbjct: 370  KHPGVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQ 429

Query: 1360 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 1539
            ALVDLMV PP +G+ESFE DQAER  I  +L TRAM LY  FN+LEGIECQKPQGAMYLF
Sbjct: 430  ALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLF 489

Query: 1540 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 1719
            P++DLPFKAVQ+A+HLE++PDEFYCKSLLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 490  PRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT 549

Query: 1720 EWIKKWETFHKEFFDQYRD 1776
            EWI+KW+ FH++F++ YRD
Sbjct: 550  EWIEKWKIFHQDFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
            Anc_8.263 YDR111C
          Length = 588

 Score =  790 bits (2040), Expect = 0.0
 Identities = 384/499 (76%), Positives = 437/499 (87%), Gaps = 1/499 (0%)
 Frame = +1

Query: 283  HHTLKTGND-DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 459
            HH+LK     DF PAEQLTL D+NENVLKAKYAVRG+IPMRAEELK QLE +P +LPF +
Sbjct: 90   HHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQ 149

Query: 460  IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 639
            I+NANIGNPQQL+QKPL++YRQVLS+LQYP++L +NEQ L+D+K++K DAI RAK L+ +
Sbjct: 150  IVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSE 209

Query: 640  IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 819
            IGGSVGAYS+SQGV GIRK+VA FIT+RD GE +YPEDIFLT        YLLSI C+GP
Sbjct: 210  IGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGP 269

Query: 820  ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 999
            +TGVLIPIPQYPLYTATLALNNS ALPYYLDE+SGWSTNP+EIE VV++A++  I P+VL
Sbjct: 270  KTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVL 329

Query: 1000 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 1179
            VVINPGNPTGAVL+ ES+  IFE+AAKYG VVIADEVYQENI  G KF+SMKK+LR LQ+
Sbjct: 330  VVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQK 389

Query: 1180 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 1359
             HPGKFDNVQLASLHSTSKGVSGECGQRGGYMEL GF+HE+R+VILKLASISLCPVVTGQ
Sbjct: 390  SHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ 449

Query: 1360 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 1539
            ALVDLMV PP +G+ S+E DQAER  I  +L  RA  LY+TF  LEGIECQKPQGAMYLF
Sbjct: 450  ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF 509

Query: 1540 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 1719
            PK+DLPFKAVQEA+HLE+TPDEFYCKSLL++TGICTVPGSGFGQEPGTYHLRTTFLAPG 
Sbjct: 510  PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT 569

Query: 1720 EWIKKWETFHKEFFDQYRD 1776
            EWIKKWE FHKEF+D YRD
Sbjct: 570  EWIKKWEAFHKEFYDNYRD 588

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
            Anc_8.263 YDR111C
          Length = 591

 Score =  773 bits (1997), Expect = 0.0
 Identities = 378/490 (77%), Positives = 438/490 (89%), Gaps = 2/490 (0%)
 Frame = +1

Query: 313  FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 492
            F PA Q+ + D+NENVLKAKYAVRG+IPMRAE+L+ QL++DP+SLPFDKIINANIGNPQQ
Sbjct: 102  FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 493  LQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 669
            L QKPL++YRQVLSLLQ+PELLN   E     + L+K DA++RA+ L+EDIGGSVGAYS+
Sbjct: 162  LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 670  SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 849
            SQGV GIRK+VA+FIT+RD+ E +YPEDIFLTAGASAAV+YLLSIFC+G +TGVLIPIPQ
Sbjct: 222  SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 850  YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 1029
            YPLYTATLALNNS  LPYYLDE+SGWSTN +EI++VV +AI   IKP+VLVVINPGNPTG
Sbjct: 282  YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 1030 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRTLQREHPGKFDNV 1206
            AVLS +++++IFE+AAKYG VVIADEVYQENIF    KFHSMKK+LR LQ+EHPGKFD V
Sbjct: 342  AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 1207 QLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRP 1386
            QLASLHSTSKGVSGECGQRGG+MELTGFSHE+RQVILKLASISLCPVVTGQALVDLMV P
Sbjct: 402  QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 1387 PVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKA 1566
            P EGEES+ELDQAER+ IH +L  RA  L++TFN LEGI+CQKPQGAMYLFP+++LPFKA
Sbjct: 462  PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 1567 VQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETF 1746
            VQ+A+H+E+T DEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG EWI  WE F
Sbjct: 522  VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 1747 HKEFFDQYRD 1776
            HKEF+++YRD
Sbjct: 582  HKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar to
            uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
            putative alanine transaminase (glutamyc pyruvic
            transaminase)
          Length = 534

 Score =  769 bits (1986), Expect = 0.0
 Identities = 374/487 (76%), Positives = 428/487 (87%)
 Frame = +1

Query: 316  YPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQL 495
            YPAE+L L +VNENVLKAKYAVRGAIPM A EL A+L+KDP SLPFD I++ANIGNPQ L
Sbjct: 48   YPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHL 107

Query: 496  QQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQ 675
            +QKPLT+YRQVLSLLQYP LL +NEQ L+DSKL++ DAI RA+ L+ DIG SVGAYS+SQ
Sbjct: 108  KQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167

Query: 676  GVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYP 855
            G++GIR++VA+FIT+RD GE +Y EDIFLTAGAS+AV+YLLSI C+G ETGVLIPIPQYP
Sbjct: 168  GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227

Query: 856  LYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAV 1035
            LYTA+LALNNS  LPYYLDE+SGWSTNP EIE VV  AI+  IKP+VLVVINPGNPTGAV
Sbjct: 228  LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287

Query: 1036 LSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLA 1215
            LS E +SQIF +AAKYG VVIADEVYQEN+F G +FHSMKKILR LQ+ +PG FDNVQLA
Sbjct: 288  LSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLA 347

Query: 1216 SLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVE 1395
            SLHSTSKGVSGECGQRGGYME+TGF++++RQVILKLASISLCPVVTGQALVDLMV PP  
Sbjct: 348  SLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKP 407

Query: 1396 GEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQE 1575
            G+ES+ELDQ ER SIHE L  RA  L+ TFNSLEGIECQKP+GAMYLFP++ LPFKA+Q 
Sbjct: 408  GDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQS 467

Query: 1576 ARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKE 1755
            A H  +TPD FYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI++WE FHK 
Sbjct: 468  AEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKA 527

Query: 1756 FFDQYRD 1776
            F+++YRD
Sbjct: 528  FYEEYRD 534

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa] {ON}
            similar to uniprot|P52893 Saccharomyces cerevisiae
            YLR089C ALT1 putative alanine transaminase (glutamyc
            pyruvic transaminase)
          Length = 528

 Score =  758 bits (1957), Expect = 0.0
 Identities = 364/486 (74%), Positives = 428/486 (88%)
 Frame = +1

Query: 319  PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQ 498
            PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF KII+ANIGNPQQL 
Sbjct: 45   PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104

Query: 499  QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 678
            QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 105  QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 679  VEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 858
            V+GIR++VA+FITKRDDGEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 163  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 859  YTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 1038
            YTA+LALNNS+ LPYYL E+  WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 223  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 1039 SPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLAS 1218
            S +S+ +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR LQ+ + G++DN+QLAS
Sbjct: 283  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342

Query: 1219 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 1398
            LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 343  LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402

Query: 1399 EESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 1578
            +ES+E DQ ER  IH+ L  RA  L++TF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 403  DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462

Query: 1579 RHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEF 1758
            +HLE+ PDEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 463  QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522

Query: 1759 FDQYRD 1776
            FD+YRD
Sbjct: 523  FDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
            similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
            KLLA0F19162g and similar to YLR089C uniprot|P52893
            Saccharomyces cerevisiae YLR089C ALT1 putative alanine
            transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  751 bits (1939), Expect = 0.0
 Identities = 364/488 (74%), Positives = 425/488 (87%)
 Frame = +1

Query: 313  FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 492
            F PA++L+LED+NENVL+AKYAVRG IP +AEELK QL +DP+SLPFD+IINANIGNPQQ
Sbjct: 45   FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 493  LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 672
            L QKPLT+YRQVLSLLQ P++L +  ++ + S+++K DAI RA  L+ +IGGSVGAYS S
Sbjct: 105  LDQKPLTFYRQVLSLLQNPDMLEEIPREQL-SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 673  QGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQY 852
            QGV G RK+VA+FITKRD GE +Y EDIFLTAGASAAV+Y+LSI CRGP+TGVLIPIPQY
Sbjct: 164  QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 853  PLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 1032
            PLYTA+LALNNS ALPYYLDE+S WSTNPEEIE VV  +I   ++P  LVVINPGNPTGA
Sbjct: 224  PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 1033 VLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQL 1212
            +LSPES+ +IFEVAAKYG VVIADEVYQEN+F G +FHSM+K+L+ LQR+H GKFDN+QL
Sbjct: 284  ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 1213 ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPV 1392
            ASLHSTSKGVSGECGQRGGYMEL GFSH++RQV LKLASISLCPVVTGQALVDLMV PP 
Sbjct: 344  ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 1393 EGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQ 1572
             G+ S+E DQ ER+ IH+ L  RA  LY+TFN LEGIECQKPQGAMYLFP++DL +KAVQ
Sbjct: 404  PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 1573 EARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHK 1752
            +A HL L+PDEFYC+ LLE+TGICTVPGSGFGQ PGTYHLRTTFLAPG +WIK WE FHK
Sbjct: 464  KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 1753 EFFDQYRD 1776
            +F+++YRD
Sbjct: 524  KFYNEYRD 531

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
            Anc_8.263 YDR111C
          Length = 539

 Score =  751 bits (1938), Expect = 0.0
 Identities = 371/489 (75%), Positives = 421/489 (86%)
 Frame = +1

Query: 304  NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 483
            N +F PA QLT+ D+NENVLKAKYAVRG IP RAEELK QL + P SLPFDKIINANIGN
Sbjct: 49   NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 484  PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 663
            PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK +++DIGGSVGAY
Sbjct: 109  PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 664  SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 843
            S SQGV GIR++VA FIT+RD GE +YPEDIFLTAGASAAVNYLLSI C+G +TGVLIPI
Sbjct: 169  SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 844  PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 1023
            PQYPLYTATLALNNS ALPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINPGNP
Sbjct: 229  PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 1024 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 1203
            TGAVLS E++  I E+AAKYG VVIADEVYQENIF G KFHS+K +LR LQRE PGKFDN
Sbjct: 289  TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 1204 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 1383
            VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 349  VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 1384 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 1563
            PP  GEESF LDQA+R +IH +L  RA  L+ TFNSL+GIECQKP GAMYLFPK++LP++
Sbjct: 409  PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 1564 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 1743
            A+QEA+ LEL+PDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EWI  W+ 
Sbjct: 469  AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 1744 FHKEFFDQY 1770
            FH EF ++Y
Sbjct: 529  FHIEFMEKY 537

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
            {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
            YLR089c
          Length = 574

 Score =  749 bits (1935), Expect = 0.0
 Identities = 380/573 (66%), Positives = 452/573 (78%), Gaps = 7/573 (1%)
 Frame = +1

Query: 79   TLTTSVKKMPYINPPFITTASNTKLKAFRKV-------RPVLQRHSSSWVAXXXXXXXXX 237
            T + S+ KMP+  PP    + ++ +   +K        RP L     S  +         
Sbjct: 5    TTSKSLSKMPHAIPPQCRRSHSSSIFQTKKRLAHLESDRPYLTHLPRSMNSSPNLRFHSS 64

Query: 238  XXXXXNDLRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELK 417
                      LN   HH     N  F PAEQ TL+DVNE VL AKYAVRGAIPMRAEELK
Sbjct: 65   ASSSSLRSSFLNTEIHHH-SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELK 123

Query: 418  AQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLF 597
             QL ++P SLPF+ IINANIGNPQQL+QKPL++YRQVLSLLQYPEL+   E       + 
Sbjct: 124  TQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENN--PQTMI 181

Query: 598  KLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGAS 777
            K DAI RAK L++DIGGSVGAYSSSQGV GIRK+VA+FIT RDDG I+YPEDIFLTAGAS
Sbjct: 182  KQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGAS 241

Query: 778  AAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETV 957
            +AV+YLLSIFCRG ETGVLIPIPQYPLYTATLAL NS ALPYYL+E++GWST+PEE+E++
Sbjct: 242  SAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESI 301

Query: 958  VKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGT 1137
            + ++I+N IKP+VLVVINPGNPTGAVLS E++ QIF +AAKYG +VIADEVYQEN+F   
Sbjct: 302  ILDSIENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDV 361

Query: 1138 KFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVIL 1317
            KFHSMKK+LR LQ + PG +DNVQLASLHSTSKGVSGECGQRGGYMEL GF+H++RQV+L
Sbjct: 362  KFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVL 421

Query: 1318 KLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLE 1497
            KLASISLCPVVTGQALVDLMV PP +GEES+E DQ ER +IH++L  RA  L+D F  L+
Sbjct: 422  KLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLD 481

Query: 1498 GIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEP 1677
            GI CQKPQGAMYLFPK++LP+KA+QEA H +++PDEFYCKSLLE TGICTVPGSGFGQEP
Sbjct: 482  GISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEP 541

Query: 1678 GTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 1776
            GTYHLRTTFLAPG +WI+ W  FH+EF++++++
Sbjct: 542  GTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
            [1539 nt, 513 aa]
          Length = 512

 Score =  711 bits (1834), Expect = 0.0
 Identities = 346/496 (69%), Positives = 417/496 (84%)
 Frame = +1

Query: 289  TLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIIN 468
            TL     + YPA++L ++D+N+NVLKAKYAVRG+IP+RAEELK  LE   Q LPFD +IN
Sbjct: 25   TLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVIN 83

Query: 469  ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 648
            ANIGNPQQL+QKPLT+YRQVLS+LQYPELL         S +FK DAI+RA+ L+++IG 
Sbjct: 84   ANIGNPQQLKQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG- 136

Query: 649  SVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 828
            SVG+YSSSQG+  IRK+VA FITKRDDGEIS P DIFLTAGAS+AV+YLLSI C+  ++G
Sbjct: 137  SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196

Query: 829  VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 1008
            VLIPIPQYPLYTATLALNN+ ALPYYLDE  GWST+  EIE V+ +++   IKPT LV+I
Sbjct: 197  VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256

Query: 1009 NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHP 1188
            NPGNPTG++LS ES+ +I EVAA +G V+IADEVYQEN+F   KFHSMKK+LR LQ+  P
Sbjct: 257  NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP 316

Query: 1189 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 1368
            G++D VQLASLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALV
Sbjct: 317  GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALV 376

Query: 1369 DLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKI 1548
            DLMV PP +G+ES+E DQ ER++I   L  RA+ L++ FNS+EG+ CQKP+GAMYLFPKI
Sbjct: 377  DLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKI 436

Query: 1549 DLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 1728
            DLPFK +Q+++ L++TPDEFYCK+LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EWI
Sbjct: 437  DLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWI 496

Query: 1729 KKWETFHKEFFDQYRD 1776
             +W  FH EF+D+YRD
Sbjct: 497  DRWNKFHAEFYDKYRD 512

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
            Anc_8.263 YDR111C
          Length = 522

 Score =  705 bits (1820), Expect = 0.0
 Identities = 346/496 (69%), Positives = 414/496 (83%)
 Frame = +1

Query: 289  TLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIIN 468
            T+   + +F PA++LT+ D+NENVLKAKYAVRG IP RAE LK QL  +P SLPF K+IN
Sbjct: 28   TISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVIN 87

Query: 469  ANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG 648
            ANIGNPQQL QKPLT+YRQVLSLLQYP +L++       + L+K DAI+RAK ++ DIG 
Sbjct: 88   ANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIGS 146

Query: 649  SVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 828
            SVG+YSSSQGV G+RK+VAE+I++RD GE +Y EDIFLTAGAS+AV+YLL+I C+G E+G
Sbjct: 147  SVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESG 206

Query: 829  VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVI 1008
            VLIPIPQYPLYTATLALNN+ ALPYYL+E SGWSTN EEIE VV  AI+ +I P VLVVI
Sbjct: 207  VLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVI 266

Query: 1009 NPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHP 1188
            NPGNPTGA+LS ES+ +IF+VAA +G VVIADEVYQENIFPG +FHSMKK+LR LQR  P
Sbjct: 267  NPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP 326

Query: 1189 GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALV 1368
            GK++NVQLASLHSTSKGVSGECGQRGGYMELTGFS E++  ILKL SISLCPVVTGQALV
Sbjct: 327  GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALV 386

Query: 1369 DLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKI 1548
            DLM  PP +GE S+E DQ ER++IH +L  RA  L+  FN +EG+ CQKPQG+MYLFPKI
Sbjct: 387  DLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKI 446

Query: 1549 DLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWI 1728
            D+P KA+++A+ L++TPDE YC  LLE+TGICTVPGSGFGQ+PGT+HLRTTFLAPG  WI
Sbjct: 447  DIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWI 506

Query: 1729 KKWETFHKEFFDQYRD 1776
             +W  FH+ F ++YRD
Sbjct: 507  DQWREFHQIFCNKYRD 522

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
            YDR111C
          Length = 497

 Score =  687 bits (1773), Expect = 0.0
 Identities = 327/495 (66%), Positives = 409/495 (82%)
 Frame = +1

Query: 292  LKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINA 471
            L   N+DF PA +L+L+D+NENV+ AK+A+RG+I ++AE+L+ QL K+P  LPFD+I  A
Sbjct: 4    LSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVA 63

Query: 472  NIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGS 651
            NIGNPQ+L QKPLT+ RQV+S+LQYPELLN N   L   K+F  D+  RA+ L+ DIGGS
Sbjct: 64   NIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGS 122

Query: 652  VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 831
            VGAYS+SQGV GIRK+ AE+ITKRD GE SYPEDIFLT GA++A +YLLS+ CRGP+TGV
Sbjct: 123  VGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGV 182

Query: 832  LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 1011
            LIPIPQYPLYTATLALN S  +PYYLDE+S WSTN  EIE +V ++I+  IKP+V+VVIN
Sbjct: 183  LIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVIN 242

Query: 1012 PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPG 1191
            PGNPTGAVLS  ++++IF++AAKYG VV+ADEVYQENIF G +FHS KK+LR LQ+++PG
Sbjct: 243  PGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPG 302

Query: 1192 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 1371
            KFDN+QLAS+HSTSKGV GECGQRGGYMEL GF+ E+RQ++LKLA +++C VVTGQA+VD
Sbjct: 303  KFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVD 362

Query: 1372 LMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKID 1551
            LM+ PP +G+ S+ELD+ ER  I + +  RA  LY  F+ L+GIECQKPQGAMYL+P + 
Sbjct: 363  LMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLI 422

Query: 1552 LPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 1731
            L  KA+ +A  L LTPDEFYC  LL++TGICTVPGSGFGQ+ GTYHLRTTFLAPG+EWI 
Sbjct: 423  LSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWIN 482

Query: 1732 KWETFHKEFFDQYRD 1776
            KWE FHK F+++Y+D
Sbjct: 483  KWEKFHKHFYEKYQD 497

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
            YDR111C
          Length = 521

 Score =  681 bits (1756), Expect = 0.0
 Identities = 336/500 (67%), Positives = 406/500 (81%), Gaps = 7/500 (1%)
 Frame = +1

Query: 298  TGNDD------FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 459
            TG+D       F PA +L  +D+N+N++ A+YAVRGAIPM+AEEL+ QL + P  LPF+ 
Sbjct: 23   TGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNA 82

Query: 460  IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 639
            I  ANIGNPQQL QKPLT+ RQV+S+LQYP LL+  E+QLV S  +K DA KRA  L+E 
Sbjct: 83   ITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQ 141

Query: 640  IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 819
            IGGSVGAYS +QGV GIR+SVA+FIT+RD+GE + P+DIFLT GAS A  YLLSI CR  
Sbjct: 142  IGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDS 201

Query: 820  ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 999
             TG++IPIPQYPLYTA++ + NS  LPYYLDE+SGWST  EEIE  V ++I+  + P V+
Sbjct: 202  STGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVI 261

Query: 1000 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 1179
            VVINPGNPTGAVLS ++++QI  +AAKYG VV+ADEVYQ NI+ G KFHSMKK+LR+LQR
Sbjct: 262  VVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQR 321

Query: 1180 EHP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTG 1356
            +HP G++DNVQLAS+HSTSKGVSGECGQRGGYMEL GFS+E+RQVILKLASIS+C VVTG
Sbjct: 322  DHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTG 381

Query: 1357 QALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYL 1536
            QALVDLM+ PP EG++S+ELD  ER  IH  + TR   LYDTF  LEGIECQ+PQGAMYL
Sbjct: 382  QALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYL 441

Query: 1537 FPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPG 1716
            FPK+ L  KA++EA+ L L PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG
Sbjct: 442  FPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPG 501

Query: 1717 LEWIKKWETFHKEFFDQYRD 1776
             +WIK WETFHK F+D+YRD
Sbjct: 502  TQWIKDWETFHKAFYDKYRD 521

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
            YDR111C (REAL)
          Length = 507

 Score =  673 bits (1736), Expect = 0.0
 Identities = 322/489 (65%), Positives = 401/489 (82%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 489
            +F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L++ P  LPFD IINANIGNPQ
Sbjct: 19   NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78

Query: 490  QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 669
            QL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L+EDIGGS+GAYS 
Sbjct: 79   QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138

Query: 670  SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 849
            SQGV GIR+SVAEFITKRDDGE + PE+I+LT GAS+A   LLS+ C+  +TG+LIPIPQ
Sbjct: 139  SQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQ 198

Query: 850  YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 1029
            YPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPGNPTG
Sbjct: 199  YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258

Query: 1030 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 1209
            AVLS +++++I  +AAKYG  +I+DEVYQEN+F G KFHSMKK+LR LQR +PGKFDNVQ
Sbjct: 259  AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318

Query: 1210 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 1389
            LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 319  LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 1390 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 1569
              G+ES++ D +ER  I  ++ TRA  L++TFN LEGIECQKPQGAMYLFP++ LP KA+
Sbjct: 379  QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438

Query: 1570 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 1749
            +E+  L + PDEFYC SLLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 439  RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498

Query: 1750 KEFFDQYRD 1776
            ++FF++YRD
Sbjct: 499  QDFFNKYRD 507

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
            to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
            putative alanine transaminase (glutamyc pyruvic
            transaminase)
          Length = 519

 Score =  671 bits (1731), Expect = 0.0
 Identities = 332/481 (69%), Positives = 396/481 (82%)
 Frame = +1

Query: 334  TLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLT 513
            TL DVN+ VL AKYAVRG IP+RAEEL+ +L ++P SLPF+KIINANIGNPQQL QKPLT
Sbjct: 41   TLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLT 100

Query: 514  YYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIR 693
            +YRQVLSLLQ P L+       +  KLFK DA++RAK +++ +GGSVGAYS+SQGV G R
Sbjct: 101  FYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFR 159

Query: 694  KSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATL 873
            +SVAEFI +RD GE +   DIFLTAGAS+AV+ +LS+FC G E G LIPIPQYPLYTATL
Sbjct: 160  QSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATL 218

Query: 874  ALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESV 1053
            ALN++ ALPYYLDE SGWS + E++E VVK+AI+  ++PT LVVINPGNPTGA+LSPE++
Sbjct: 219  ALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAI 278

Query: 1054 SQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTS 1233
             +I  VAAKY  VVIADEVYQEN F    F SMKK+LR LQ+  PGK+DNVQLASLHSTS
Sbjct: 279  EKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTS 338

Query: 1234 KGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFE 1413
            KGVSGECGQRGGYMEL GFS E++QV LKLASISLCPVVTGQALVDLMVRPP +G+ S+E
Sbjct: 339  KGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYE 398

Query: 1414 LDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLEL 1593
            LD+ ERN+IH  L  ++  LY+TF SLEG+ CQKPQGAMYLFPK+DL  KA+++A  L +
Sbjct: 399  LDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGM 458

Query: 1594 TPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYR 1773
             PDE+YCK LLE+TGICTVPGSGF Q PGTYHLRTTFLAPG EW+  W+ FH++F D++R
Sbjct: 459  APDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHR 518

Query: 1774 D 1776
            D
Sbjct: 519  D 519

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] {ON}
            Anc_8.263 YDR111C
          Length = 562

 Score =  669 bits (1726), Expect = 0.0
 Identities = 325/492 (66%), Positives = 409/492 (83%)
 Frame = +1

Query: 298  TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 477
            T  +  Y AE+L  ED+N NV+KAKYAVRGAIP  A++LK QL K P +LPF+ +IN+NI
Sbjct: 73   TSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNI 132

Query: 478  GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 657
            GNPQQL QKPL++ RQVLS+L+YP LL+ +E+ LVDS  +  D+I+RAK+L+ DIG S+G
Sbjct: 133  GNPQQLGQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIG-SIG 190

Query: 658  AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 837
            AYS+SQGV GIR++VA+FIT RDDGE++YP+DIFLTAGAS+AV+ +LSI C+G +TGVLI
Sbjct: 191  AYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLI 250

Query: 838  PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 1017
            PIPQYPLYTATL LN++ ALPYYLDE +GWST+  EI  V +++++  IKPT LVVINPG
Sbjct: 251  PIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPG 310

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 1197
            NPTG+VL+ E++  +F+VAAKYG VVIADEVYQ+NIFPG++FHSMKKILR LQ+E P K+
Sbjct: 311  NPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKY 370

Query: 1198 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 1377
            DN+QLASLHS SKG+ GECG RGGY E  GF+ E++QVI KL+SISLC  V GQALVDLM
Sbjct: 371  DNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLM 430

Query: 1378 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 1557
              PP +GE S+ELDQ ER +I      R+  LY+ FNSLEG+ CQKPQGAMY+FP I LP
Sbjct: 431  CCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLP 490

Query: 1558 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 1737
            F A++ A++L++TPDEFYC+ LL++TGICTVPGSGFGQ+PGTYH+RTTFLAPG+EW+K+W
Sbjct: 491  FNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRW 550

Query: 1738 ETFHKEFFDQYR 1773
            E FH EFF++YR
Sbjct: 551  EKFHIEFFEKYR 562

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
            YDR111C (REAL)
          Length = 507

 Score =  664 bits (1713), Expect = 0.0
 Identities = 318/489 (65%), Positives = 397/489 (81%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 489
            DF PA ++T +D+N +V KA+YAVRG+IP RA+ELK +L+K+P  LPFD IINANIGNPQ
Sbjct: 19   DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 490  QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 669
            QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L++DIGGSVGAYS 
Sbjct: 79   QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138

Query: 670  SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 849
            SQGV GIR++VA+FIT RD GE + PEDI+LT GAS+A   LLS+ C+   TG+LIPIPQ
Sbjct: 139  SQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQ 198

Query: 850  YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 1029
            YPLYTA+ +L N+Q LPYYLDE+  WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 199  YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258

Query: 1030 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 1209
            AVL+ E++++I  +AAKYG  VI+DEVYQEN+F   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 259  AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318

Query: 1210 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 1389
            LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319  LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378

Query: 1390 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 1569
              G+ES+E D+ ER+ I  ++ TRA  LY+TFN LEGIECQ PQGAMYLFP++ LP KA 
Sbjct: 379  QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438

Query: 1570 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 1749
            +E+  L + PDEFYC SLLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 439  RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498

Query: 1750 KEFFDQYRD 1776
            + FF++YRD
Sbjct: 499  QSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
            ALT2Putative alanine transaminase (glutamic pyruvic
            transaminase)
          Length = 507

 Score =  664 bits (1712), Expect = 0.0
 Identities = 318/489 (65%), Positives = 396/489 (80%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 489
            DF PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L+K+P+ LPFD IINANIGNPQ
Sbjct: 19   DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 490  QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 669
            QL QKPLT+ RQVL++L+YPE+L     +L    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 79   QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138

Query: 670  SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 849
            SQGV GIR++VA+FIT+RD GE + PEDI+LT GAS+A   LLS+ C+  +TG+LIPIPQ
Sbjct: 139  SQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQ 198

Query: 850  YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 1029
            YPLYTA+ +L N+Q LPYYLDE+S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 199  YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258

Query: 1030 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 1209
            AVLS E++++I  +AAKYG  +I+DEVYQENIF   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 259  AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318

Query: 1210 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 1389
            LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 319  LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 1390 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 1569
              G+ES+E D  ER  I  ++ TRA  LY+TF  LEGIECQKPQGAMYLFP++ LP KA+
Sbjct: 379  QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438

Query: 1570 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 1749
             E+  L + PDEFYC SLLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 439  CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498

Query: 1750 KEFFDQYRD 1776
            ++FF +YR+
Sbjct: 499  QDFFSKYRN 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
            Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  662 bits (1708), Expect = 0.0
 Identities = 329/506 (65%), Positives = 403/506 (79%)
 Frame = +1

Query: 259  LRHLNRFPHHTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDP 438
            LRHL+  P   L+          + TL+D+NE VL AKYAVRG IP+RAEELK +L ++P
Sbjct: 17   LRHLSTRPG--LRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEP 74

Query: 439  QSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKR 618
             SLPFDKIINANIGNPQQL QKPLT+YRQVL+LLQ P+L++      +  K FK DA++R
Sbjct: 75   GSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELH-KFFKPDAVER 133

Query: 619  AKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLL 798
            AK +++ +GGSVGAYS+SQGV G R+SVAEFI +RD GE +  +DIFLT GAS AV+Y+L
Sbjct: 134  AKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYIL 192

Query: 799  SIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQN 978
            S+FC GPE G LIPIPQYPLYTA+LALNNS ALPYYLDE+SGWS + E+IE VV+++I+ 
Sbjct: 193  SLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKK 252

Query: 979  EIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 1158
             I+PT LVVINPGNPTGA+L+ +++  + +VAAKY  V+IADEVYQEN F   +F SMKK
Sbjct: 253  GIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKK 312

Query: 1159 ILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISL 1338
            +LR LQ+  PGK+DNVQLASLHSTSKGVSGECGQRGGYMEL GFS E++QV LKLASISL
Sbjct: 313  VLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISL 372

Query: 1339 CPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKP 1518
            CPVVTGQAL+DLMVRPP +G+ S+E D+ ER  IH+ L  R+  LY  F S+EG+ CQ+P
Sbjct: 373  CPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEP 432

Query: 1519 QGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRT 1698
            QGAMYLFPK++L  KA+ +A    L PDE+YCK LLE+TGICTVPGSGFGQ PGT+HLRT
Sbjct: 433  QGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRT 492

Query: 1699 TFLAPGLEWIKKWETFHKEFFDQYRD 1776
            TFLAPG EWI  W+ FH++F + +RD
Sbjct: 493  TFLAPGTEWIDSWKKFHEKFTEDHRD 518

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
            YDR111C (REAL)
          Length = 507

 Score =  657 bits (1696), Expect = 0.0
 Identities = 314/489 (64%), Positives = 395/489 (80%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 489
            DF PA +LT +D+N +V KA+YAVRGAIP RAEELK +L++   SLPF+ IINANIGNPQ
Sbjct: 19   DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78

Query: 490  QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 669
            QL QKPLT+ RQVLS+L+YPE+L  +  +L    LF  DA+KRA+ L++DIGGSVGAYS 
Sbjct: 79   QLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSH 138

Query: 670  SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 849
            SQGV GIR++VA+FIT+RD GE + PEDI+LT GAS+A   LLS+ C+  +TG+L+PIPQ
Sbjct: 139  SQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQ 198

Query: 850  YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 1029
            YPLYTA+ +L N+Q LPYYLDE++ WST  +EIE VV +A++  I+P+VLVVINPGNPTG
Sbjct: 199  YPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTG 258

Query: 1030 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 1209
            AVL+  ++++I  +AAKYG  +I+DEVYQENIF   KFHSMKKILR LQ  HPGKFDNVQ
Sbjct: 259  AVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQ 318

Query: 1210 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 1389
            LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C V TGQA++DLMV+PP
Sbjct: 319  LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPP 378

Query: 1390 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 1569
              G+ES++ D+ ER  I+ +++TRA  LY+TFN LEGI+CQKPQGAMYLFPK+ LP KA+
Sbjct: 379  QPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKAL 438

Query: 1570 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 1749
            +E+  L + PD  YC SLLESTGICTVPGSGFGQ+ GTYH+RTTFL PG +WI+ W  FH
Sbjct: 439  RESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFH 498

Query: 1750 KEFFDQYRD 1776
            ++FF++YRD
Sbjct: 499  QDFFNKYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  656 bits (1692), Expect = 0.0
 Identities = 322/490 (65%), Positives = 402/490 (82%), Gaps = 2/490 (0%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDKIINANIGN 483
            +F PA+++TL+D+N+NVLK++YAVRG+IP RAEEL+ +L       SL F+ I++ANIGN
Sbjct: 27   NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 484  PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 663
            PQQL QKPLT+ RQV+S+LQYPELLNQ    LV + +FK DA++RA++L+  IGGSVGAY
Sbjct: 87   PQQLDQKPLTFSRQVISILQYPELLNQRNI-LVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 664  SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 843
            SSSQGV GIR++VA +IT RD+GE + P+DIFLT GAS A +YLLS+ C+   TGVLIPI
Sbjct: 146  SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 844  PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 1023
            PQYPLYTAT+ L +++ LPYYL+E+SGWSTN  EIE VV +AI + +KP+V+VVINPGNP
Sbjct: 206  PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 1024 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 1203
            TG+VLS + +  I  + AKYG V+IADEVYQENIF G +FHSMKK+LR+LQ+++PGK+D 
Sbjct: 266  TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324

Query: 1204 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 1383
            VQLASLHSTSKGVSGECGQRGGYMEL GF  E+RQ ILKLASISLC V+TGQALVDLMV 
Sbjct: 325  VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 1384 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 1563
            PP +G+ES+ELD  ER +IHE L  RA  LY+ F  L+G+ECQKPQGAMYLFPK+  P  
Sbjct: 385  PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 1564 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 1743
             + EA +  ++PDEFYC +LLE+TGICTVPGSGFGQ+ GTYHLRTTFLAPG +W +KW+ 
Sbjct: 445  LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 1744 FHKEFFDQYR 1773
            FH+EFF +Y+
Sbjct: 505  FHEEFFSKYQ 514

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
            complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  649 bits (1674), Expect = 0.0
 Identities = 309/489 (63%), Positives = 394/489 (80%), Gaps = 3/489 (0%)
 Frame = +1

Query: 313  FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 492
            F PAE+L++ D+N++ + A YAVRG+IPMRAE+L AQ+  DP SLPFDKII ANIGNPQQ
Sbjct: 3    FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 493  LQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYS 666
            + QKPLT+ RQVLS+L+YP +LN  E  ++LV   +++ D I+RA+ +++ IGGSVGAYS
Sbjct: 63   VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 667  SSQGVEGIRKSVAEFITKRDD-GEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 843
            +SQGV G R++VA+FI KRD   +++ P DIFLT GAS+AV+YLLSI C GPE GVLIPI
Sbjct: 123  ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 844  PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 1023
            PQYPLYTATL L+NS A+PYYL E + WSTN +EIE  +KE++ N +KP  +V+INPGNP
Sbjct: 183  PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 1024 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 1203
            TGA+LS   ++ I  ++AKYG  +IADEVYQENIFPG +FHSM+K+L  LQ E PG +DN
Sbjct: 243  TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 1204 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 1383
            VQLASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKLASIS+C VVTGQAL+DL+  
Sbjct: 303  VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 1384 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 1563
            PP  G+ S++LDQ ERN I + L+ RA  LY  F SLEG+ECQ+PQGAMYLFPK+ LP K
Sbjct: 363  PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 1564 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 1743
            A+++A  LE+ PDE+YC+ LL++TGICTVPGSGFGQ+PGTYHLRTTFL PG EWI++W  
Sbjct: 423  AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 1744 FHKEFFDQY 1770
            FH++F++++
Sbjct: 483  FHQQFYERF 491

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  647 bits (1670), Expect = 0.0
 Identities = 307/497 (61%), Positives = 399/497 (80%), Gaps = 2/497 (0%)
 Frame = +1

Query: 286  HTLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKII 465
            HT++T   DF PA +L+++D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF++I 
Sbjct: 4    HTIQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEIT 63

Query: 466  NANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQ-NEQQLVDSKLFKLDAIKRAKSLMEDI 642
             ANIGNPQ+L QKPLT+ RQV+S+LQYPELLN+ NE       ++  D+  RA+ L+ +I
Sbjct: 64   VANIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEI 123

Query: 643  GGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 822
            GGSVGAYS+SQGV GIRK++A +IT+RD GE + P DIF+T GA+AA +YLLSI   GP+
Sbjct: 124  GGSVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQ 183

Query: 823  TGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIE-TVVKEAIQNEIKPTVL 999
            TGVL+PIPQYPLYTA LAL+N+  LPYYL+E+SGWS +  EIE T+ K A+   I+P V+
Sbjct: 184  TGVLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVM 243

Query: 1000 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 1179
            V+INPGNPTG++LS +S+ +IF +AAKYG V+IADEVYQEN+F G KFHS KK+LR+LQ+
Sbjct: 244  VIINPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQK 303

Query: 1180 EHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ 1359
            + P +++NVQLASLHSTSKG+ GECGQRGGYME+ GF++++R +ILKLA I +CPVVTGQ
Sbjct: 304  QFPTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ 363

Query: 1360 ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF 1539
            A++DLM+ PP +G++S++LD  ER  IH  ++ RA  LYD F+ +EGI+CQKPQGAMYLF
Sbjct: 364  AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF 423

Query: 1540 PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL 1719
            P++ L  K + EA+  E+ PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG 
Sbjct: 424  PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD 483

Query: 1720 EWIKKWETFHKEFFDQY 1770
            +WI KWE FHK F  +Y
Sbjct: 484  QWINKWEKFHKAFLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8.263
            YDR111C
          Length = 510

 Score =  632 bits (1631), Expect = 0.0
 Identities = 311/497 (62%), Positives = 394/497 (79%), Gaps = 2/497 (0%)
 Frame = +1

Query: 289  TLKTGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL--EKDPQSLPFDKI 462
            T  +   DF PA ++++ D+N+ ++ A+YAVRG+I MRAEEL+ +L  +  P S PF++I
Sbjct: 16   TSDSNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERI 75

Query: 463  INANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDI 642
            I ANIGNPQQL QKPLT+ RQV+S+L+YP LL   +  L+   ++K DA++RA+ L   I
Sbjct: 76   IYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDV-LLSQGIYKKDALERAELLQSQI 134

Query: 643  GGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 822
            G SVGAYS +QGV GIR++ A FI+KRD+ E +  +DIFLT GAS AV YL+   C+   
Sbjct: 135  GASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEH 194

Query: 823  TGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLV 1002
            TG+LIPIPQYPLYTA++ ++N++ LPYYLDE+SGWST  EEIE  V  AI+N IKP+ +V
Sbjct: 195  TGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMV 254

Query: 1003 VINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQRE 1182
            VINPGNPTGAVLS + + +I  VAAKYG V+IADEVYQ+NIF G +FHSMKKILR LQ++
Sbjct: 255  VINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKK 313

Query: 1183 HPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQA 1362
            +PGK+DNVQLASLHSTSKGVSGECGQRGGYME+ GFS E+R ++LKLASI++C VVTGQA
Sbjct: 314  YPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQA 373

Query: 1363 LVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFP 1542
            LVDLMV PP  G+ES+E DQ ERN IH  L  RA  LYDTF++LEGIECQKPQGAMYLFP
Sbjct: 374  LVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFP 433

Query: 1543 KIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLE 1722
            ++ LP +A++EA+ L++  DEFYC  LLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG E
Sbjct: 434  RLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTE 493

Query: 1723 WIKKWETFHKEFFDQYR 1773
            WI  W+ FH++F  +Y+
Sbjct: 494  WIDDWKKFHEKFMKEYQ 510

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YLR089C (ALT1) and YDR111C
            (ALT2)
          Length = 521

 Score =  631 bits (1628), Expect = 0.0
 Identities = 310/488 (63%), Positives = 385/488 (78%)
 Frame = +1

Query: 313  FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 492
            F PAE +TL DVNENV+KAKYAVRG IP RAEEL+ +LE+ P SLPF KII ANIGNPQQ
Sbjct: 37   FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 493  LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 672
            L QKPLT+YRQV+SL+Q P+LL    + L   + FK D + RA+ +++D GGSVGAYS+S
Sbjct: 97   LGQKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSAS 154

Query: 673  QGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQY 852
            QGV+G R++VA+FI +RD G  + P++++LTAGAS+AV+ LLS FC+GPETGVLIPIPQY
Sbjct: 155  QGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213

Query: 853  PLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 1032
            PLYTAT+  NN+ ALPYYL+E  GWSTNP+E+E V+ ++ +  I P  LVVINPGNPTG+
Sbjct: 214  PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273

Query: 1033 VLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQL 1212
            VLS + +  I  +AAKYG VVIADEVYQ+N+F   KFHSM+K+L+ LQ   P  + NVQL
Sbjct: 274  VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333

Query: 1213 ASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPV 1392
            ASLHS SKG+SGECGQRGGYMEL GF  E+R+V +KLASISLCPVVTGQALVDLMV PP 
Sbjct: 334  ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393

Query: 1393 EGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQ 1572
            +G+ S+E    E  SI+ +L  R+  L+ TF SLEGIEC  PQGA+YLFPK+ LP KA++
Sbjct: 394  QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453

Query: 1573 EARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHK 1752
             A+ L +  DE YC  LL+ TGICTVPG+GFGQ PGTYH+RTTFL PG +WI+ W+ FHK
Sbjct: 454  AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513

Query: 1753 EFFDQYRD 1776
            +F+D+YRD
Sbjct: 514  KFYDKYRD 521

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
            YDR111C
          Length = 498

 Score =  627 bits (1618), Expect = 0.0
 Identities = 294/490 (60%), Positives = 387/490 (78%), Gaps = 2/490 (0%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 489
            DF P  ++TL+D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPF+KIINANIGNPQ
Sbjct: 8    DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 490  QLQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 663
            QL QKPL++ R+VLS+LQYP++L      Q L++ ++++ D ++RA+ L+ +IGGSVGAY
Sbjct: 68   QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 664  SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 843
            S SQGV GI+++VA++ITKRD GE++YPEDIFLT GAS+AV+++L +FC GP TGVLIPI
Sbjct: 128  SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 844  PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 1023
            PQYPLYTAT+ L  + A+ YYL+E+  WS N  E+E  ++E+I++ IKPT +V+INPGNP
Sbjct: 188  PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 1024 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 1203
            TG++L+ + ++ I  ++AKYG ++IADEVYQEN+F G +FHS+KK+LR LQR++ G ++ 
Sbjct: 248  TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 1204 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 1383
            VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V 
Sbjct: 308  VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 1384 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 1563
            PP  G+ES+E+DQ ERN+I   LI+R+  L+  F SLEG+EC +PQGAMYLFPK   P K
Sbjct: 368  PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 1564 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 1743
             +  A+ L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 428  FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 1744 FHKEFFDQYR 1773
            FH EF ++YR
Sbjct: 488  FHTEFCERYR 497

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
            Ashbya gossypii AGR085W
          Length = 534

 Score =  627 bits (1616), Expect = 0.0
 Identities = 312/510 (61%), Positives = 390/510 (76%), Gaps = 7/510 (1%)
 Frame = +1

Query: 268  LNRFPHHTLK-------TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQL 426
            L+  PH T+        T    F P + L LED+N NVL+AKYAVRG IP RA EL+ QL
Sbjct: 28   LHGLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQL 87

Query: 427  EKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLD 606
             +DP SLPF KII ANIGNPQQL QKPL++ R+VLSLL+ P LL    + L  + ++K D
Sbjct: 88   SRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPD 145

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            A++RAK +M D+  S+GAYS SQGV G RK+VAE+++ RD GE +  EDIFLT GAS   
Sbjct: 146  AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGA 204

Query: 787  NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE 966
            + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE+SGWS N +++E ++ E
Sbjct: 205  SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIE 264

Query: 967  AIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFH 1146
            +I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVYQEN+F G KF+
Sbjct: 265  SIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFY 324

Query: 1147 SMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLA 1326
            SMKK+LR+LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS ++R+VILK+A
Sbjct: 325  SMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMA 384

Query: 1327 SISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIE 1506
            SI LC  V GQALVDLM+  P  G+ES+E D +ER+SI   L  R+ +L++TFN+LEG+E
Sbjct: 385  SIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVE 444

Query: 1507 CQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTY 1686
            C+KPQG+MYLFP++ LP KA++ A  L++ PDEFYC  LL STGICTVPGSGFGQ P T 
Sbjct: 445  CRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTC 504

Query: 1687 HLRTTFLAPGLEWIKKWETFHKEFFDQYRD 1776
            HLRTTFL PG EWI+ WE FHK F+D+YRD
Sbjct: 505  HLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
            YDR111C
          Length = 500

 Score =  617 bits (1590), Expect = 0.0
 Identities = 299/494 (60%), Positives = 383/494 (77%), Gaps = 7/494 (1%)
 Frame = +1

Query: 313  FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQ 492
            F PA + +L D+NE++LKA+YA+RG IP RAEEL  QL ++ +SLPF KI+ ANIGNPQQ
Sbjct: 8    FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 493  LQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSS 672
            L Q+PLT+ RQV+SL+Q+P+LL +++  L+  K++  D+I+RA  L+  IGGSVGAYSSS
Sbjct: 68   LDQQPLTFQRQVMSLVQFPDLL-KSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 673  QGVEGIRKSVAEFITKRD-------DGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 831
            QGV  IRK+VA FI KRD       D       ++FLTAGAS AV+++L +F +    GV
Sbjct: 127  QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 832  LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 1011
            L+PIPQYPLYTA + L  S+ LPYYL+E + WST+P++IE +V +AI+  IKPT LVVIN
Sbjct: 187  LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 1012 PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPG 1191
            PGNPTGA+L+ +S+  I ++AA+YG V+IADEVYQEN++   +FHS KK+L  L++ +P 
Sbjct: 247  PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 1192 KFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVD 1371
            K+DNVQLASLHS SKGV+GECGQRGGYME+TGFS+++++V+LK+ASIS+C VVTGQ LVD
Sbjct: 307  KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 1372 LMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKID 1551
            LMV PP  G+ES+ELDQ ER+ IH  LI ++ TLYD F  L GI CQKPQGAMYLFP++ 
Sbjct: 367  LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 1552 LPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK 1731
            L   A+  A  L L PDEFYC  LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG+EWI 
Sbjct: 427  LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 1732 KWETFHKEFFDQYR 1773
             WE FH EF ++Y+
Sbjct: 487  SWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  616 bits (1588), Expect = 0.0
 Identities = 299/497 (60%), Positives = 384/497 (77%), Gaps = 9/497 (1%)
 Frame = +1

Query: 310  DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 489
            D  PA + +L D+++++L  +YA+RG IP RA+EL+ QL   P  LPF KII ANIGNPQ
Sbjct: 5    DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 490  QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 669
            QL+Q+PLT+ RQVLSL++YP L+N ++  LV++K++  DAIKRA++++  IGGSVGAYSS
Sbjct: 65   QLEQEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 670  SQGVEGIRKSVAEFITKRDDGEISYPED---------IFLTAGASAAVNYLLSIFCRGPE 822
            SQG+  IRK+VA+ I +RD+ E+   ++         IFLT GA+ AV+Y+L +F +   
Sbjct: 124  SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 823  TGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLV 1002
             GVL+PIPQYPLYTA + L NS+ LPYYL+E   WST+PEEIET++K+AI   IKPT LV
Sbjct: 184  CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 1003 VINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQRE 1182
            +INPGNPTGA+LS ES++QI  +AAKYG V+IADEVYQ NI+   KFHS KKIL +L+ +
Sbjct: 244  IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 1183 HPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQA 1362
            +P K+DNVQLASLHS SKGV+GECGQRGGY EL GFS E++++ILKLASI +C VVTGQ 
Sbjct: 304  YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 1363 LVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFP 1542
            LVDLM +PP +G+ S++LDQ ERN+I   LI ++ TLYD F+ L GI CQKPQGAMYLFP
Sbjct: 364  LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 1543 KIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLE 1722
            ++ L    + EA+   L PDEFYC  LLE+TGICTVPGSGFGQ+ GTYH+RTTFL  G+E
Sbjct: 424  RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 1723 WIKKWETFHKEFFDQYR 1773
            WIK WE FH EF +QY+
Sbjct: 484  WIKLWEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
            (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 60.5 bits (145), Expect = 5e-09
 Identities = 48/167 (28%), Positives = 79/167 (47%), Gaps = 1/167 (0%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 840
            Y + QG   +RK +AE  +  D       E++ LT GA AA N+L      G     +  
Sbjct: 55   YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 841  IPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN-PG 1017
             P Y   ++   +  ++    +L +++ +  N  E+E ++K         T  +V+N P 
Sbjct: 112  SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPN-------TKCIVLNTPN 164

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKK 1158
            NP  +V+  E++ +I E+A K+G VV  DEVY         FHS +K
Sbjct: 165  NPLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEK 205

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa] {ON}
            conserved hypothetical protein
          Length = 379

 Score = 56.6 bits (135), Expect = 8e-08
 Identities = 42/186 (22%), Positives = 80/186 (43%)
 Frame = +1

Query: 556  LNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGE 735
            LN NE   +  + F+ D   R              Y S  G   +R  VA+        E
Sbjct: 32   LNLNELSSLTGESFEFDQNMRL------------TYGSIWGTPVLRDLVAKI---HSSDE 76

Query: 736  ISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDE 915
            I    D  L    +   N+L+     GP   ++   P Y   ++  ++  +     +L+ 
Sbjct: 77   IQLTADNVLITNGAIGANFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEA 136

Query: 916  QSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVV 1095
            + G++ N +++++ V+   +       +V+ NP NP G+V+S E +++I + A +    +
Sbjct: 137  EDGYTPNIQKLKSKVRANTK------YIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFI 190

Query: 1096 IADEVY 1113
            + DEVY
Sbjct: 191  VCDEVY 196

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
            similar to uniprot|P53090 Saccharomyces cerevisiae
            YGL202W ARO8 Aromatic aminotransferase expression is
            regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 53.9 bits (128), Expect = 8e-07
 Identities = 44/155 (28%), Positives = 71/155 (45%), Gaps = 4/155 (2%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDD--GEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 831
            Y  SQG    +  + EF+ K      +I Y + D+  TAG + A    L +FC   +T +
Sbjct: 106  YGFSQG----QPELMEFVRKHTSLVHDIKYADWDVLATAGNTNAWESTLRVFCNRGDT-I 160

Query: 832  LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVIN 1011
            L     +               P  LDE   +   PE++E+++        KP +L  I 
Sbjct: 161  LAEAYSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIP 217

Query: 1012 PG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
             G NPTG+ LS +  ++I+ +A K+  ++I DE Y
Sbjct: 218  TGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
            (HIS5) - histidinol-phosphate aminotransferase [contig 5]
            FULL
          Length = 389

 Score = 50.8 bits (120), Expect = 6e-06
 Identities = 31/124 (25%), Positives = 64/124 (51%), Gaps = 2/124 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--ALPYYLDEQS 921
            E++ L  G+   ++ L+   C   +  +LI  P Y +Y+    +N+ +   +P  +++ S
Sbjct: 88   ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
                  + IET     +QN+    ++ + +PGNPTGA++ PE++ ++  ++      V+ 
Sbjct: 148  FQMDTEKVIET-----LQNDPSIKLVFITSPGNPTGALIKPENIEKL--LSQWQSGFVVV 200

Query: 1102 DEVY 1113
            DE Y
Sbjct: 201  DEAY 204

>Kwal_56.23794 s56 complement(707600..707947) [348 bp, 115 aa] {OFF}
            [contig 173] FULL
          Length = 115

 Score = 47.4 bits (111), Expect = 6e-06
 Identities = 36/115 (31%), Positives = 55/115 (47%)
 Frame = -1

Query: 1224 VQRS*LNIIEFTWMFSL*SSQNFFH*MELGARENVFLINFVSYHNCAILGCNFKNLGYRF 1045
            +QR  L+II F     L + Q+FFH  +LG  E +FL++ +S  + AI   +F N+    
Sbjct: 1    MQRGQLHIIIFARFCFLKNPQHFFHGDKLGVVEPIFLVHLISDDHHAIFRSDFDNIFNCI 60

Query: 1044 WR*NSTGRITWIDNY*HSRLDFVLYSFFDDGFYFFWIS*PP*LLVQIVRQSLRIV 880
                 +  ITW+D       D +     +D    F I  P    V+IV + +RIV
Sbjct: 61   GVQKRSSWITWVDYNQAGWSDSLFDGVLNDLLNLFGIHGPAGFFVKIVGECMRIV 115

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
            Anc_1.472
          Length = 384

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 39/164 (23%), Positives = 76/164 (46%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 840
            Y S +G + +R  +A        G     +++ +T GA AA N+L+     GP   V+  
Sbjct: 55   YGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICV 108

Query: 841  IPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 1020
             P Y    +   +  ++     L ++ G+  N E ++ ++K   +      ++++ NP N
Sbjct: 109  DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNN 162

Query: 1021 PTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSM 1152
            P G+ +S E+++ I ++  +    +  DEVY+        FHSM
Sbjct: 163  PLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
            (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 39/169 (23%), Positives = 78/169 (46%), Gaps = 2/169 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            +++ L  G+   ++ L+   CR     +L   P Y +Y+    +N+ + +  P   ++ S
Sbjct: 85   DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
                 PE + T     ++N+ K  +L + +PGNPTG +++ + +  I E       +V+ 
Sbjct: 145  FQMNVPEVLST-----LKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWT--NGLVVV 197

Query: 1102 DEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 1248
            DE Y +        +SM K++         K+ N+ +    S S G++G
Sbjct: 198  DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSFGLAG 238

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
            YJL060W (REAL)
          Length = 444

 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 43/185 (23%), Positives = 86/185 (46%), Gaps = 11/185 (5%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AIK A+  +E     V  YS ++G   +  S+ +  T   + E+   E++ +T GA+  +
Sbjct: 72   AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGI 128

Query: 787  -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSG----WST 933
             + L+ +   G E  V++  P +  Y   + L   + +      P  LD+++     W+ 
Sbjct: 129  LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 934  NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            + E+ E  +        K   +++  P NP G V + + ++ +  +  K+  V+I+DEVY
Sbjct: 187  DFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVY 240

Query: 1114 QENIF 1128
            +   F
Sbjct: 241  EHLYF 245

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
            weakly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060W BNA3 Arylformamidase, involved in biosynthesis of
            nicotinic acid from tryptophan via kynurenine pathway;
            potential Cdc28p substrate
          Length = 383

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 35/152 (23%), Positives = 72/152 (47%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 840
            Y + +G + +R  VA   +   D E+   +D  L    +   N+L+S    GP   V+  
Sbjct: 55   YGAIKGSDELRSLVASLYS---DKEVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 841  IPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 1020
             P Y   ++   +  ++     L+ ++ +  +  ++++++K   +       +V+ NP N
Sbjct: 112  DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 1021 PTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 1116
            P G+V+   ++ +I  +A K    VI DEVY+
Sbjct: 166  PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
            Anc_1.321 YJL060W
          Length = 443

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 40/168 (23%), Positives = 76/168 (45%), Gaps = 9/168 (5%)
 Frame = +1

Query: 652  VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 828
            V  YS ++G   + KS+ +  +      +  PE++ +T GA+  +   L+ I  +  E  
Sbjct: 84   VNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEGILACLMGILNQNDEVI 142

Query: 829  VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 984
            V  P     IP   L    +    +N  + L   + + + W+ + E+ E V+        
Sbjct: 143  VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN------ 196

Query: 985  KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            K   +++  P NP G V + E + +I ++  K+  ++I+DEVY    F
Sbjct: 197  KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar to
            uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
            Histidinol-phosphate aminotransferase catalyzes the
            seventh step in histidine biosynthesis responsive to
            general control of amino acid biosynthesis mutations
            cause histidine auxotrophy and sensitivity to Cu Co and
            Ni salts
          Length = 387

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 39/170 (22%), Positives = 85/170 (50%), Gaps = 3/170 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQ--ALPYYLDEQS 921
            +++ L  G+  +++ L+   C   +  +LI    Y +YT    +N+ +   +P  L E+ 
Sbjct: 88   DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGT-VVI 1098
             +  + E+I     E +QN+    ++ + +PGNPTG  +    V++I ++ +++ T +V+
Sbjct: 148  KFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFI---DVNRIEKILSQWQTGLVV 200

Query: 1099 ADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 1248
             DE Y + +  G+   S+  +          K++N+ +    S S G++G
Sbjct: 201  VDEAYIDFV-EGSDKGSLAPLAT--------KYENIAVLQTLSKSFGLAG 241

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
            YJL060W (REAL)
          Length = 460

 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 43/185 (23%), Positives = 86/185 (46%), Gaps = 11/185 (5%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AIK A+  +E     V  YS ++G   +  S+ +  +   D ++   E++ +T GA+  +
Sbjct: 88   AIKEAQKALEI--PLVNQYSPTRGRPSLINSLIKLYSPIYDTDLR-AENVTVTTGANEGI 144

Query: 787  -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSG----WST 933
             + L+ +   G E  V++  P +  Y   + L   + +      P  LD+++     W+ 
Sbjct: 145  LSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTI 202

Query: 934  NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            + E+ E  +        K   +++  P NP G V + E ++ +  +  K+  V+I+DEVY
Sbjct: 203  DFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 256

Query: 1114 QENIF 1128
            +   F
Sbjct: 257  EHLFF 261

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
            YJL060W
          Length = 443

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 39/168 (23%), Positives = 78/168 (46%), Gaps = 9/168 (5%)
 Frame = +1

Query: 652  VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 828
            V  YS ++G   + +S+ +  +   + E+   E++ +T GA+  + + L+ I   G E  
Sbjct: 84   VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 829  VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 984
            V  P     IP   L    +    +N  + +   + + + W+ + E+    + +      
Sbjct: 143  VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 985  KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            K   +++  P NP G V + E +++I E+  K   V+I+DEVY+   F
Sbjct: 197  KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYF 244

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
            YGL202W
          Length = 492

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 9/160 (5%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFIT-----KRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPET 825
            Y  SQG   + K + E        + DD E+       +TAG ++A    L IFC   +T
Sbjct: 103  YGHSQGQPELLKFIREHTEIIHTMQYDDWEL------LVTAGNTSAWESTLRIFCNRGDT 156

Query: 826  GVLIPIPQYPLYTATLALNNSQAL---PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTV 996
                 + +   ++++L+   +Q +   P  +D++      PE++  ++        KP +
Sbjct: 157  ----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG---IIPEKLAAIMDNWNPETPKPKL 209

Query: 997  LVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            L  I  G NPTG+ L  E  SQ++++A K+  +++ DE Y
Sbjct: 210  LYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 65/250 (26%), Positives = 101/250 (40%), Gaps = 10/250 (4%)
 Frame = +1

Query: 574  QLVDSKLFKLDAIKRAKSLMEDIGGSVGA-YSSSQGVEGIRKSVAEFITKRDD--GEISY 744
            +L + ++ K+D  K  K    DI  +    Y  SQG    +  + EFI + +    ++ Y
Sbjct: 74   ELSNDEVCKVDLKKDVKVHEGDIPLARSLQYGFSQG----QPELLEFIREHNKLIHDMQY 129

Query: 745  PE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQS 921
             + D+  TAG + A    L +FC   +  +L     +    A          P  +D++ 
Sbjct: 130  EDWDVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVI 1098
                 P ++E ++        KP +L  I  G NPTG  L+ E   +IF +A K+  ++I
Sbjct: 189  ---IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLII 245

Query: 1099 ADEVYQENIFPGTKFHSMKKILRTLQ-----REHPGKFDNVQLASLHSTSKGVSGECGQR 1263
             D  Y         F  M K  R LQ     R  P +     LASL  T   V  +    
Sbjct: 246  EDAPYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTD---- 293

Query: 1264 GGYMELTGFS 1293
            G  + L  FS
Sbjct: 294  GRVIRLDSFS 303

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1.321
          Length = 448

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 47/179 (26%), Positives = 87/179 (48%), Gaps = 9/179 (5%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AIK A+  +E     V  YS ++G   +  S+ +  +     E+   E+I +T GA+  +
Sbjct: 76   AIKEAQKALEI--PLVNQYSPTRGRASLLNSLIKLYSPFYGKELKQ-ENITITTGANEGI 132

Query: 787  -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSGWSTNPEE 945
             + L+ +   G E  V++  P +  Y + + L   + +      P  LD++    T    
Sbjct: 133  LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTE--- 187

Query: 946  IETVVKEAIQNEIKP-TVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 1116
              T+  E  +N I P T  V++N P NP G V + E ++++ E+  +   ++I+DEVY+
Sbjct: 188  -WTIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYE 245

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
            Ashbya gossypii AGR167W
          Length = 488

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 53/199 (26%), Positives = 95/199 (47%), Gaps = 7/199 (3%)
 Frame = +1

Query: 538  LQYPELLN-QNEQQLVDSKLFKLDAIKRAKSLMEDIG-GSVGAYSSSQGVEGIRKSVAEF 711
            ++ PE+L+ + ++  V  KL KL    + +   +DI       Y +S+G   +   + E 
Sbjct: 60   IEIPEMLSSKGDEGSVTGKLCKL---AKDQENPKDIPLARALQYGNSRGQRELVSFLKEH 116

Query: 712  ITKRDDGEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNS 888
            I K    +I Y + D+ +TAG++ A +  L +FC  P   VL+   +   Y++++    +
Sbjct: 117  IVKFH--QIPYSDWDVLITAGSTQAWDASLRLFC-NPGDSVLL---ESWTYSSSVEAAEA 170

Query: 889  QALPYYLDEQSGWSTNPEEIETVVK---EAIQNEIKPTVLVVINPG-NPTGAVLSPESVS 1056
            Q +     E  G    PE++E +++   +       P +L VI  G NP G  L+ E   
Sbjct: 171  QGMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKP 230

Query: 1057 QIFEVAAKYGTVVIADEVY 1113
             I+ +  KY  V+I D+ Y
Sbjct: 231  LIYNIIQKYDMVLIEDDPY 249

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
            complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 52/188 (27%), Positives = 78/188 (41%), Gaps = 37/188 (19%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGP 819
            Y S++G   +R ++ EF+ +      RDD   S PE + LT+GAS  V N LL      P
Sbjct: 51   YGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNILLQATL--P 108

Query: 820  ETGV----LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE------- 966
             TGV     I  P Y L                +DE+   S + E +E  +K        
Sbjct: 109  HTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPN 168

Query: 967  ----------AIQNEI---------KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGT 1089
                       I+N I         K  + V+    NP+G   + E+  ++ E+A KY  
Sbjct: 169  PVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDM 228

Query: 1090 VVIADEVY 1113
            ++I D+VY
Sbjct: 229  LIITDDVY 236

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 56/240 (23%), Positives = 97/240 (40%)
 Frame = +1

Query: 529  LSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAE 708
            L+L +  +L N    QL         AIK +K L   I G  G   S+            
Sbjct: 32   LTLAEISQLSNDKPFQLDPDMRLTYGAIKGSKDLRTLIAGLYGVQFSA------------ 79

Query: 709  FITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNS 888
                         +++ +T GA  A N+LL     G    V+   P Y    +   +  +
Sbjct: 80   -------------DNVLVTNGAIGA-NFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGA 125

Query: 889  QALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFE 1068
            +     L E+  +  N + +    K+AI++  K  ++++ NP NP G V+S E ++ I E
Sbjct: 126  EVTLLELSEKDSFLPNLDTL----KKAIKSNTK--LIIINNPNNPLGCVISDELLTSICE 179

Query: 1069 VAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 1248
            +  +    +  DEVY+        FHS+   + T  R     +DN  ++   S +  ++G
Sbjct: 180  LCKEKNVYLHCDEVYR------PIFHSLPSGV-TTPRSAAQIYDNAVVSGSMSKAFSLAG 232

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] {ON}
            highly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060w
          Length = 433

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 44/177 (24%), Positives = 84/177 (47%), Gaps = 3/177 (1%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AI  AKS ++     V  YS ++G   + KS+ E + K   G+    +++ +T GA+  +
Sbjct: 61   AINAAKSALDV--PLVNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGI 117

Query: 787  -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVK 963
             + L+ I   G E  V  P     +    L     + +P +  ++        +   +  
Sbjct: 118  LSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDW 177

Query: 964  EAIQNEIK-PTVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            +A++      T  V+IN P NP G V + + ++++ ++  ++ TVVI+DEVY+   F
Sbjct: 178  DALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYF 234

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynurenine
            aminotransferase, catalyzes formation of kynurenic acid
            from kynurenine; potential Cdc28p substrate
          Length = 444

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 42/185 (22%), Positives = 86/185 (46%), Gaps = 11/185 (5%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AIK A+  ++     V  YS ++G   +  S+ +  +   + E+   E++ +T GA+  +
Sbjct: 72   AIKEAQKALDI--PMVNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGI 128

Query: 787  -NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PYYLDEQSG----WST 933
             + L+ +   G E  V++  P +  Y   + L   + +      P  LD+++     W+ 
Sbjct: 129  LSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTI 186

Query: 934  NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            + E+ E  +        K   +++  P NP G V + E ++ +  +  K+  V+I+DEVY
Sbjct: 187  DFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY 240

Query: 1114 QENIF 1128
            +   F
Sbjct: 241  EHLYF 245

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] {ON}
            Anc_1.321 YJL060W
          Length = 445

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 44/185 (23%), Positives = 86/185 (46%), Gaps = 11/185 (5%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AIK A+  ++     V  YS ++G   +  ++ +  T     E+   E++ +T GA+  +
Sbjct: 73   AIKEAQKALDI--PLVNQYSPTRGRVSLLNALIKQYTPIYGSELKQ-ENVTITTGANEGI 129

Query: 787  -NYLLSIFCRGPETGVLIPIPQYPLYTATLAL----------NNSQALPYYLDEQSGWST 933
             + L+ +   G E  V++  P +  Y + + L          N  + L   + E + W+ 
Sbjct: 130  LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTV 187

Query: 934  NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            + E+     K AI ++ K   +++  P NP G V + E + QI  +  +   ++I+DEVY
Sbjct: 188  DMEQF----KNAITSKTK--AVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVY 241

Query: 1114 QENIF 1128
            +   F
Sbjct: 242  EHLYF 246

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2.102
          Length = 565

 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 43/170 (25%), Positives = 80/170 (47%), Gaps = 13/170 (7%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDD----GEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 828
            YS +QG++ +   +  FITK ++     E  Y  DI L  G+S ++  +    C    T 
Sbjct: 137  YSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLCDESTTV 194

Query: 829  VLIPIPQYPLYTATLALNNSQALPYYLD---EQSGWSTNPEEIETVV-----KEAIQNEI 984
            ++      P+ +  +A   ++ +P  L+   E  G   + E +E ++     K   ++  
Sbjct: 195  LMEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLS 251

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            KP +L  I+ G NP G  LS E   +I+ +A ++  +++ D+ Y    FP
Sbjct: 252  KPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPYCYLTFP 301

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
            Ashbya gossypii ADL249W
          Length = 386

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 32/126 (25%), Positives = 63/126 (50%)
 Frame = +1

Query: 736  ISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDE 915
            ISY ++I L  G+   V+ L+   C      VL+  P Y +Y+    +N+++ +   L  
Sbjct: 85   ISY-KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 916  QSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVV 1095
            +   ++   +++ V+ E + N+    +L +  PGNPTGA +S + +  +    +    +V
Sbjct: 144  ED--NSFDMDLDNVL-ETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWS--AGIV 198

Query: 1096 IADEVY 1113
            + DE Y
Sbjct: 199  VVDEAY 204

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar to
            uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
            Histidinol-phosphate aminotransferase catalyzes the
            seventh step in histidine biosynthesis responsive to
            general control of amino acid biosynthesis mutations
            cause histidine auxotrophy and sensitivity to Cu Co and
            Ni salts
          Length = 389

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 2/124 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            +++ L  G+  +++ L+   C   +  +LI  P Y +Y+    +N+ + +  P  +++ S
Sbjct: 88   DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
                  + IET     +Q +    +  V +PGNPTGA++   S+ +I  ++     +V  
Sbjct: 148  FQMNTDKVIET-----LQGDSNIKIAFVTSPGNPTGALIDIASIEKI--LSQWQSGIVAI 200

Query: 1102 DEVY 1113
            DE Y
Sbjct: 201  DEAY 204

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
            YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 22/68 (32%), Positives = 36/68 (52%)
 Frame = +1

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            W+ N +E+E  +        K   L++  P NP G V + E + +I E+  K+  V+I+D
Sbjct: 183  WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 1105 EVYQENIF 1128
            EVY+   F
Sbjct: 237  EVYEHLYF 244

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa] {ON}
            highly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060W BNA3 Arylformamidase involved in biosynthesis of
            nicotinic acid from tryptophan via kynurenine pathway
            potential Cdc28p substrate
          Length = 453

 Score = 45.4 bits (106), Expect = 3e-04
 Identities = 68/353 (19%), Positives = 134/353 (37%), Gaps = 15/353 (4%)
 Frame = +1

Query: 652  VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 828
            V  YS ++G   +  S+ +  +     E+   E++ +T GA+  + + L+ I   G E  
Sbjct: 92   VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 829  VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 984
            V  P     IP   L    +    +N  + +   + E   W+ + EE+            
Sbjct: 151  VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTS------ 204

Query: 985  KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKIL 1164
            K   L++  P NP G V + E +++I  +  +   V+I+DEVY+   F  +         
Sbjct: 205  KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDS--------- 255

Query: 1165 RTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCP 1344
                          ++A+L      ++   G  G     TG+       ++ L    L  
Sbjct: 256  ------------YTRIATLSPEIGQLTLTVGSAGKTFAATGWRIGW---VISLNPELLSY 300

Query: 1345 VVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSL---EGIECQK 1515
            V  G   +      P++   +  ++ A +    E + T  +  ++ F S+    G+    
Sbjct: 301  VSKGHTRICFSSPSPIQEAVANSIEDALKGDYFEAMRTDYIRKFEIFTSVFKEMGLPYTI 360

Query: 1516 PQGAMYL---FPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGF 1665
            P+G  ++   F K+++P         L+   D      L+   G+  +P + F
Sbjct: 361  PEGTYFILVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINELGVVAIPPTEF 413

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
            complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 9/168 (5%)
 Frame = +1

Query: 652  VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 828
            V  YS ++G   +  S+ +  +     +++ PE++ +T GA+  + + L+ I   G E  
Sbjct: 85   VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIINPGDEVI 143

Query: 829  VLIP-----IPQYPLYTATLA---LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI 984
            V  P     IP   L    +    +N  + L   + + + W+ + +E    +        
Sbjct: 144  VFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP------ 197

Query: 985  KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            K   +++  P NP G V + E ++++  +  +   ++IADEVY+   F
Sbjct: 198  KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYF 245

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
            (REAL)
          Length = 444

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 43/168 (25%), Positives = 83/168 (49%), Gaps = 9/168 (5%)
 Frame = +1

Query: 652  VGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG 828
            V  YS ++G   +  S+ +  +   + +++  E++ +T GA+  + + L+ +   G E  
Sbjct: 85   VNQYSPTRGRPSLINSLIKLYSPIYNKDLT-TENVTVTTGANEGILSCLMGLLNAGDE-- 141

Query: 829  VLIPIPQYPLYTATLALNNSQAL------PYYLDEQSGWSTNPEEIETVVKEAIQNEIKP 990
            V++  P +  Y + + L   + +      P  LD ++   T  EE  T+  E  +  I P
Sbjct: 142  VIVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRN---TRGEEW-TIDFEQFEKAITP 197

Query: 991  -TVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
             T  V+IN P NP G V + E ++ +  +  K+  ++I+DEVY+   F
Sbjct: 198  KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYF 245

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (REAL)
          Length = 500

 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = +1

Query: 751  DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 930
            D+F TAG + A    L +FC   +    + + +   ++++LA   +Q +  +        
Sbjct: 134  DVFATAGNTNAWESTLRLFCNRGD----VILAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 931  TNPEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADE 1107
              PE++  ++     N  KP +L  I  G NPTG  ++      I+++A K+  +++ DE
Sbjct: 190  IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 1108 VY 1113
             Y
Sbjct: 250  PY 251

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
            similar to uniprot|P07172 Saccharomyces cerevisiae
            YIL116W HIS5 Histidinol-phosphate aminotransferase
            catalyzes the seventh step in histidine biosynthesis
            responsive to general control of amino acid biosynthesis
            mutations cause histidine auxotrophy and sensitivity to
            Cu Co and Ni salts
          Length = 386

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 2/124 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P    + S
Sbjct: 87   ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
              +   E I+T      QN+    ++ + +PGNPTGA +    + +I +   +   +V+ 
Sbjct: 147  FQANTDEVIKTA-----QNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR--GMVVV 199

Query: 1102 DEVY 1113
            DE Y
Sbjct: 200  DEAY 203

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
            Anc_2.252 YIL116W
          Length = 386

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 28/123 (22%), Positives = 61/123 (49%), Gaps = 1/123 (0%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY-YLDEQSG 924
            E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +    L + + 
Sbjct: 89   ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNS 148

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            +  + E + TV    +QN+    +L + +PGNPTGA +  E +  + +       +V+ D
Sbjct: 149  FQMDTESVLTV----LQNDPLIKLLFITSPGNPTGARIETERIETVLQNWT--DGLVVVD 202

Query: 1105 EVY 1113
            E Y
Sbjct: 203  EAY 205

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
            similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 9/137 (6%)
 Frame = +1

Query: 745  PEDIFLTAGASAAV-NYLLSIFCRGPETGVLIPIPQYPLYTATLA--------LNNSQAL 897
            PE+I +T GA+  +   L+S+   G E  VL P     +Y   +         L   + L
Sbjct: 99   PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 898  PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAA 1077
                 + S W+ + ++  + + E      K   +++ +P NPTG V + E +  +  +  
Sbjct: 159  KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 1078 KYGTVVIADEVYQENIF 1128
            +    +I+DEVY EN++
Sbjct: 213  EKNVYIISDEVY-ENLY 228

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
            similar to uniprot|P07172 Saccharomyces cerevisiae
            YIL116W HIS5 Histidinol-phosphate aminotransferase
            catalyzes the seventh step in histidine biosynthesis
            responsive to general control of amino acid biosynthesis
            mutations cause histidine auxotrophy and sensitivity to
            Cu Co and Ni salts
          Length = 384

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 28/126 (22%), Positives = 61/126 (48%), Gaps = 4/126 (3%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            E+I L  G+  +++ L+ + C   +  ++I  P Y +Y+    +N+   +  P   ++ S
Sbjct: 88   ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTV--LVVINPGNPTGAVLSPESVSQIFEVAAKYGTVV 1095
                  + +ET+ ++       PT+  + + +PGNPT A++    + ++       G +V
Sbjct: 148  FQMDTSKVLETLAQD-------PTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLV 198

Query: 1096 IADEVY 1113
            + DE Y
Sbjct: 199  VVDEAY 204

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1.321
            YJL060W
          Length = 433

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 41/164 (25%), Positives = 80/164 (48%), Gaps = 8/164 (4%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETGVLI 837
            YS ++G   + K++A+  T     ++S  ++I +  GA+ A+ + L+ +  +G E  V++
Sbjct: 77   YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDE--VIV 133

Query: 838  PIPQYPLYTATLALNNSQAL------PYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 999
              P +  Y + + L            P  LD++    T  E    ++++ I +  K    
Sbjct: 134  FEPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINSRTK---C 190

Query: 1000 VVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            V+IN P NP G V + E + ++ ++      V+I+DEVY+   F
Sbjct: 191  VIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar to
            uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
            Aromatic aminotransferase expression is regulated by
            general control of amino acid biosynthesis
          Length = 480

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 3/124 (2%)
 Frame = +1

Query: 751  DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 930
            D+  TAG++ A +  L +FC   ET   + + +Y  Y+++L    +Q L     +     
Sbjct: 128  DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 931  TNPEEIETVVKE---AIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
               +++  ++++   A+Q      +  + N  NPTG  L  E   ++  +A++Y  ++I 
Sbjct: 184  IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 1102 DEVY 1113
            D+ Y
Sbjct: 244  DDPY 247

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [1143
            nt, 381 aa]
          Length = 380

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 36/153 (23%), Positives = 72/153 (47%)
 Frame = +1

Query: 658  AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 837
            +Y + +G + +R S+A        G     +DI LT GA  A N+L      G    V+ 
Sbjct: 54   SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 838  PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 1017
              P Y    +   +  ++     L ++  +  N + +++++K    N  K  ++++ NP 
Sbjct: 108  VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIK----NNTK--LIIINNPN 161

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 1116
            NP G+V+  + + QI ++  +    + +DEVY+
Sbjct: 162  NPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
            Anc_2.252 YIL116W
          Length = 392

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 37/175 (21%), Positives = 81/175 (46%), Gaps = 8/175 (4%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            +++ L  G+   ++ L+   C+     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85   KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
                    +ET+ K+ +       +L + +PGNPTG +++ + +  + E   K G VV+ 
Sbjct: 145  FQMDVKRTLETLKKDDLIR-----LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 1102 DEVYQE------NIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSG 1248
            DE Y +           T++ S+ K++         K+ N+ +    S S G++G
Sbjct: 198  DEAYVDFSTYFNEETKKTEYFSVAKLVT--------KYPNLTVLQTLSKSFGLAG 244

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
            Anc_1.321 YJL060W
          Length = 435

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 40/185 (21%), Positives = 79/185 (42%), Gaps = 11/185 (5%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV 786
            AIK A+  +E     V  YS ++G   +  S+ +F T   + ++        T    A  
Sbjct: 63   AIKEAQRALEI--PLVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 787  NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE 966
            + L+ +   G E  V++  P +  Y   + L+  + +   +       T P+ ++T V +
Sbjct: 121  SILIGLLNPGDE--VIVFEPFFDQYIPNIELSGGKVVYVPI-------TPPKNLDTRVTK 171

Query: 967  AIQNEI-----------KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
              + +I           K   +++  P NP G V +   + ++ ++  K   V+I+DEVY
Sbjct: 172  GEEWQIDWDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVY 231

Query: 1114 QENIF 1128
            +   F
Sbjct: 232  EHLYF 236

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
            highly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060W BNA3 Arylformamidase involved in biosynthesis of
            nicotinic acid from tryptophan via kynurenine pathway
            potential Cdc28p substrate
          Length = 447

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 66/324 (20%), Positives = 133/324 (41%), Gaps = 17/324 (5%)
 Frame = +1

Query: 745  PEDIFLTAGASAAV-NYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL------PY 903
            P ++ +T GA+ A+ + L+ +  +G E  V++  P +  Y + + +   +        P 
Sbjct: 118  PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 904  YLDEQ----SGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEV 1071
             L+ +    + W+ + +E+   +        K   L++  P NP G V + E + +I  +
Sbjct: 176  ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 1072 AAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGE 1251
              +   V+I+DEVY E+++    F S    + TL  E      N+ L      S G +G+
Sbjct: 230  CVENNVVIISDEVY-EHLY----FTSEFTRIATLSPE----IGNLTL------SVGSAGK 274

Query: 1252 CGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAER 1431
                 G+    G+       +LK AS++          +      P +   +  ++ A +
Sbjct: 275  TFAATGWR--IGWIVSQNAELLKYASMA-------HTRICFASPSPFQEACAKSIEIALQ 325

Query: 1432 NSIHEKLITRAMTLYDTFNSL---EGIECQKPQGAMYL---FPKIDLPFKAVQEARHLEL 1593
            N+  EK+    +  +D F  +    G+   +P+G  ++   F K+ +P         L  
Sbjct: 326  NNYFEKMRQEYINKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSK 385

Query: 1594 TPDEFYCKSLLESTGICTVPGSGF 1665
              D      L+   G+  +P + F
Sbjct: 386  AKDFRISYWLINELGVVAIPPTEF 409

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
            highly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060W BNA3 Arylformamidase involved in biosynthesis of
            nicotinic acid from tryptophan via kynurenine pathway
            potential Cdc28p substrate
          Length = 443

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 40/177 (22%), Positives = 79/177 (44%), Gaps = 4/177 (2%)
 Frame = +1

Query: 610  IKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVN 789
            ++ A+  ++D    V  YS ++G   +  S+ +  +   + ++    +I +T GA+  + 
Sbjct: 72   VEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYNTQLQ-ANNIQVTTGANEGIL 128

Query: 790  YLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIE--TVVK 963
              L +    P   V++  P +  Y + + +   +     L      S  P E    TV  
Sbjct: 129  ACL-VGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTVDY 187

Query: 964  EAIQNEIKPTV--LVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            + ++  I P    L++  P NP G V + E + QI ++  +   V+I+DEVY+   F
Sbjct: 188  DELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYEHLYF 244

>YDR112W Chr4 (679544..679852) [309 bp, 102 aa] {OFF}  IRC2Dubious
           open reading frame, unlikely to encode a protein, based
           on available experimental and comparative sequence data;
           partially overlaps YDR111C; null mutant displays
           increased levels of spontaneous Rad52p foci
          Length = 102

 Score = 38.5 bits (88), Expect = 0.006
 Identities = 29/70 (41%), Positives = 34/70 (48%), Gaps = 5/70 (7%)
 Frame = -2

Query: 476 ILALIILSNGKD*GXXXXXXXXXXALMGMAPLTAYLAFKTFSFTSSKVNCSAG*KS---- 309
           + ALII S GK  G          AL+G+APLTAY A  T  F S  V   AG KS    
Sbjct: 1   MFALIISSKGKTSGFFFNSSFSSSALVGIAPLTAYSALVTPVFKSFLVILPAGLKSKSFA 60

Query: 308 -SLPVFNVWC 282
            + P  + WC
Sbjct: 61  VNTPFKSCWC 70

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 44/176 (25%), Positives = 76/176 (43%), Gaps = 1/176 (0%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGW 927
            ++I L  G+  +++ ++   C   E  V++  P Y +Y     +N+      Y++     
Sbjct: 88   KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG----YVEVPLIS 143

Query: 928  STNPEEI-ETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            S N  +I E  + E +  +    V+ + +PGNPTGA +    V ++         +V+ D
Sbjct: 144  SDNSFQIDEDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLRNWT--AGIVVVD 201

Query: 1105 EVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGY 1272
            E Y +       F + K  L  L  +HP       L  L + SK  SG  G R G+
Sbjct: 202  EAYID-------FSADKPSLSPLVNKHP------NLVVLQTLSK-ASGLAGIRLGF 243

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
            HIS5Histidinol-phosphate aminotransferase, catalyzes the
            seventh step in histidine biosynthesis; responsive to
            general control of amino acid biosynthesis; mutations
            cause histidine auxotrophy and sensitivity to Cu, Co, and
            Ni salts
          Length = 385

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 26/123 (21%), Positives = 60/123 (48%), Gaps = 1/123 (0%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSG- 924
            +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +   L    G 
Sbjct: 88   DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            +  + E + T++K    N+    ++ V +PGNPTGA +    + ++ +       +V+ D
Sbjct: 148  FQMDTEAVLTILK----NDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ--NWDNGLVVVD 201

Query: 1105 EVY 1113
            E Y
Sbjct: 202  EAY 204

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
            YER152C
          Length = 475

 Score = 40.8 bits (94), Expect = 0.009
 Identities = 46/183 (25%), Positives = 73/183 (39%), Gaps = 32/183 (17%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLL---SIFCR 813
            Y S +G   +R+++  F         RDD   S PE + L++GAS  V  +L   ++   
Sbjct: 51   YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 814  GPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE--------- 966
            G      I  P Y L           +    +DE    S +   +E  ++E         
Sbjct: 111  GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 967  -------------AIQNEIKPTVLVVINP-GNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
                         A+  +I   V+  I    NPTG   S E+  ++ E+A KY  ++IAD
Sbjct: 171  DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 1105 EVY 1113
            +VY
Sbjct: 231  DVY 233

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
            homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 40.8 bits (94), Expect = 0.010
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 7/158 (4%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDG--EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 831
            Y +S+G    +  + EF+ +  +   ++ Y + D+ +TAG++ A +  + +FC   ++ V
Sbjct: 98   YGNSRG----QSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVV 153

Query: 832  LIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE---AIQNEIKPTVLV 1002
            +        Y++++    +Q L     E       PE +  ++ E         +P VL 
Sbjct: 154  MEAFT----YSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVLY 209

Query: 1003 VINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
             I  G NP G+ L     +QI+ +A +Y  +++ D+ Y
Sbjct: 210  TIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (REAL)
          Length = 386

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 26/124 (20%), Positives = 62/124 (50%), Gaps = 2/124 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +  P  + + S
Sbjct: 88   DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
             +  + E + T+    ++N+    ++ V +PGNPTGA +    + Q+ +       +V+ 
Sbjct: 148  -FQMDVEAVLTI----LENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ--NWQNGLVVV 200

Query: 1102 DEVY 1113
            DE Y
Sbjct: 201  DEAY 204

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (REAL)
          Length = 388

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLD-EQSG 924
            +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +   L    + 
Sbjct: 88   DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGT-VVIA 1101
            +  N E + T+    + N+    ++   +PGNPTGA +       I EV  K+   +V+ 
Sbjct: 148  FQMNTEAVLTI----LNNDPLIKIMFATSPGNPTGAKI---KTCLIEEVLQKWDNGIVVV 200

Query: 1102 DEVY 1113
            DE Y
Sbjct: 201  DEAY 204

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
            Ashbya gossypii AEL170C
          Length = 430

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 31/132 (23%), Positives = 58/132 (43%), Gaps = 9/132 (6%)
 Frame = +1

Query: 748  EDIFLTAGA-SAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLA--------LNNSQALP 900
            E+I +T GA  A +  L+++   G E  V+ P     ++   +A        L N     
Sbjct: 99   ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 901  YYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 1080
              + E + W  + E +     +      K  ++++ NP NP G V + + + ++  +   
Sbjct: 159  KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 1081 YGTVVIADEVYQ 1116
             G  +IADEVY+
Sbjct: 213  NGAYIIADEVYE 224

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
            highly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 40.4 bits (93), Expect = 0.012
 Identities = 38/182 (20%), Positives = 84/182 (46%), Gaps = 11/182 (6%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 840
            YS ++G   + KS+ +F +   +  ++   ++ +T GA+  +   L +    P   V++ 
Sbjct: 88   YSPTRGRPSLLKSLTDFYSPIYNETLN-ESNVTITTGANEGILASL-VGLLNPGDEVIVF 145

Query: 841  IPQYPLYTATLALNNSQA------LPYYLDEQ----SGWSTNPEEIETVVKEAIQNEIKP 990
             P +  Y + + +   +        P  L E+    + W  + + +   + E        
Sbjct: 146  EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINER------- 198

Query: 991  TVLVVIN-PGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILR 1167
            T  +++N P NP G V + E ++Q+ ++  K    +I+DEVY E+++ G +F  +  I +
Sbjct: 199  TKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISK 257

Query: 1168 TL 1173
             +
Sbjct: 258  EI 259

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
            YIL116W
          Length = 384

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 25/122 (20%), Positives = 60/122 (49%), Gaps = 1/122 (0%)
 Frame = +1

Query: 751  DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYL-DEQSGW 927
            +I L  G+  +++ ++   C      +L+  P Y +Y+    +N+ + +   L  E + +
Sbjct: 89   NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 928  STNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADE 1107
              + ++    V + + N+ +  +L + +PGNPTGA +    + ++ +   +   +V+ DE
Sbjct: 149  QMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR--GLVVVDE 202

Query: 1108 VY 1113
             Y
Sbjct: 203  AY 204

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
            to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
            Aromatic aminotransferase catalyzes the first step of
            tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 40.0 bits (92), Expect = 0.017
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 13/170 (7%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEF---ITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGV 831
            YS ++G+     SV EF   I KR +       D+ L  G+S ++  +    C   + GV
Sbjct: 132  YSETRGLP----SVVEFSKKIVKRFNPPAYDNWDVLLANGSSDSLFKIFETLC---DEGV 184

Query: 832  LIPIPQYPLYTA--TLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEI------- 984
             + + ++        +  +  + +P  ++      T   +++ +       E+       
Sbjct: 185  TVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKHLS 244

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            KP VL  I  G NPTG  LSPE    I+E+A  +  +++ D+ Y    FP
Sbjct: 245  KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPYGYLKFP 294

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] {ON}
            Anc_2.252 YIL116W
          Length = 385

 Score = 39.7 bits (91), Expect = 0.019
 Identities = 24/123 (19%), Positives = 61/123 (49%), Gaps = 1/123 (0%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLD-EQSG 924
            E++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +   L  E + 
Sbjct: 88   ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            +  N +++  ++K    N+    ++ + +PGNPTG  +  + + ++ +       +V+ D
Sbjct: 148  FQLNSDKVLDILK----NDPLIKLVFITSPGNPTGVKIETKRIEKVLQ--NWDNGLVVVD 201

Query: 1105 EVY 1113
            E Y
Sbjct: 202  EAY 204

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
            similar to uniprot|P38840 Saccharomyces cerevisiae
            YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 39.7 bits (91), Expect = 0.023
 Identities = 36/169 (21%), Positives = 74/169 (43%), Gaps = 9/169 (5%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPE-DIFLTAGASAAVNYLLSIFCRGPETGVLI 837
            Y+   G+  IR      + K +    S  + D+ L++G+  ++      FC    T ++ 
Sbjct: 125  YNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLME 184

Query: 838  PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVK-------EAIQNEIKPTV 996
                 P+ +   A   ++ +P  ++     ST   +++ + +          ++  KP +
Sbjct: 185  EFTFTPVISHVKA-TGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRI 243

Query: 997  LVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTK 1140
            L  I  G NPTG  +  E+  +I+E+A K+  +++ D+ Y    FP  K
Sbjct: 244  LYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPSYK 292

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
            Anc_2.102 YHR137W
          Length = 546

 Score = 39.7 bits (91), Expect = 0.023
 Identities = 17/50 (34%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            +P++L  I+ G NPTG  +S E+ ++I+++A KY  +++ D+ Y    +P
Sbjct: 225  RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPYSYMSYP 274

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] {ON}
            Anc_8.204 YER152C
          Length = 444

 Score = 39.3 bits (90), Expect = 0.028
 Identities = 49/178 (27%), Positives = 69/178 (38%), Gaps = 27/178 (15%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG--- 828
            Y S +G   +R+ V   I +      S PE I LT+GAS  + N LL      P TG   
Sbjct: 51   YGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTL--PHTGYTK 108

Query: 829  -VLIPIPQYPL---------------------YTATLALNNSQALPYYLDEQSGWSTNPE 942
               I  P Y L                     YT+       + L Y+  E      N  
Sbjct: 109  QAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNST 168

Query: 943  EIETVVKEAIQNEIKPTVLVVINP-GNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            +I    K  +Q +I   V   I    NP+G     E+  Q+ ++A KY  ++I D+VY
Sbjct: 169  DI-IQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
            similar to uniprot|P38840 Saccharomyces cerevisiae
            YHR137W ARO9 Aromatic aminotransferase catalyzes the
            first step of tryptophan phenylalanine and tyrosine
            catabolism
          Length = 504

 Score = 38.9 bits (89), Expect = 0.038
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            KP  L  +  G NPTG  LSP    +I+E+A K+  +++ D+ Y    FP
Sbjct: 207  KPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFP 256

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
            YHR137W
          Length = 503

 Score = 38.5 bits (88), Expect = 0.051
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            KP +L  I  G NPTG  LS E   +I+E+  K+  +++ D+ Y   +FP
Sbjct: 208  KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFP 257

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
            YER152C (REAL)
          Length = 443

 Score = 38.1 bits (87), Expect = 0.063
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 27/178 (15%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFIT----KRDDGEISYPE--DIFLTAGAS-AAVNYLLSIFC--R 813
            Y S +G   +R+ +  F+     K DDG  +  +   + L +GAS   +N LL       
Sbjct: 50   YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 814  GPETGVLIPIPQYPLYTATL----------ALNNS-------QALPYYLDEQSGWSTNPE 942
            G      I  P Y L               A+N         ++L   LD   G S    
Sbjct: 110  GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 943  EIETVVKEAIQNEIKPTVLVVINP-GNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
              E +   A+  +I   VL  I    NP+G   S E+  ++ ++A KY  +VI+D+VY
Sbjct: 170  TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
            uniprot|P10356 Saccharomyces cerevisiae YER152C
            Hypothetical ORF
          Length = 448

 Score = 38.1 bits (87), Expect = 0.064
 Identities = 43/183 (23%), Positives = 75/183 (40%), Gaps = 32/183 (17%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKR-----DDGEISYPEDIFLTAGASAAVNYLLSIFCRGPET 825
            Y S  G   +R  +AEF  K           + P+ + LT+GAS  +  +L +    P T
Sbjct: 49   YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 826  G----VLIPIPQYPL---------YTATLALNNSQA-----------LPYYLDEQSGW-- 927
            G      I  P Y L         +T  +     +            L  + +  +G   
Sbjct: 108  GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 928  STNPEEIETVVKEAIQNEIKPTVLVVINP-GNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
                E ++ +  +  Q ++   V+ ++    NPTGA+ S  S  ++ E+A KY  ++I+D
Sbjct: 168  QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 1105 EVY 1113
            +VY
Sbjct: 228  DVY 230

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
            Anc_2.252 YIL116W
          Length = 383

 Score = 37.7 bits (86), Expect = 0.078
 Identities = 27/126 (21%), Positives = 62/126 (49%), Gaps = 4/126 (3%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGW 927
            E++ L  G+  +++ ++   C   +  ++   P Y +Y+   ++N+ + +   L      
Sbjct: 85   ENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVT---- 140

Query: 928  STNPEEIETVVKEAIQNEIKPTVLV----VINPGNPTGAVLSPESVSQIFEVAAKYGTVV 1095
            S N  +++T   EA+ + +K   L+    + +PGNPTGA +    + +I +   +   ++
Sbjct: 141  SDNSFQVDT---EAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQNWDQ--GIL 195

Query: 1096 IADEVY 1113
            + DE Y
Sbjct: 196  VVDEAY 201

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa] {ON}
            similar to uniprot|P10356 Saccharomyces cerevisiae
            YER152C Hypothetical ORF
          Length = 468

 Score = 37.7 bits (86), Expect = 0.085
 Identities = 45/184 (24%), Positives = 72/184 (39%), Gaps = 33/184 (17%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKR-----DDGEISYPEDIFLTAGASAAV-NYLLSIFCRGPE 822
            Y S  G   +R  +AEF  +           + PE + LT+GAS  + N LL      P 
Sbjct: 48   YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTL--PH 105

Query: 823  TG----VLIPIPQYPLYTAT-------------------LALNNSQALPYYLDEQSGWST 933
            TG      I  P Y L                       L L   +A     +  S   +
Sbjct: 106  TGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGES 165

Query: 934  NPEEIETV----VKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
              +  E++     ++  +   +  + +V    NPTGA+ S  S  ++ E+A KY  ++I+
Sbjct: 166  GQKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIIS 225

Query: 1102 DEVY 1113
            D+VY
Sbjct: 226  DDVY 229

>Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W
           (REAL)
          Length = 186

 Score = 36.6 bits (83), Expect = 0.091
 Identities = 27/70 (38%), Positives = 31/70 (44%), Gaps = 5/70 (7%)
 Frame = -2

Query: 476 ILALIILSNGKD*GXXXXXXXXXXALMGMAPLTAYLAFKTFSFTSSKVNCSAG*KSSLPV 297
           + ALII S G   G          AL+G+ PLTAY A  T  F S  V  +AG KS    
Sbjct: 1   MFALIISSKGNKPGFFFSSSFSSSALVGIEPLTAYSALVTLPFKSFLVILAAGLKSKSLA 60

Query: 296 FNV-----WC 282
            N      WC
Sbjct: 61  INTLFKSCWC 70

>KAFR0B00790 Chr2 (152018..152443) [426 bp, 141 aa] {ON} Anc_5.329
           YDR308C
          Length = 141

 Score = 35.8 bits (81), Expect = 0.10
 Identities = 19/48 (39%), Positives = 32/48 (66%)
 Frame = +1

Query: 556 LNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKS 699
           +N  +Q+LVD +  KL+AIK+ +SL++D+ G +  + S  G+   RKS
Sbjct: 94  INSLQQKLVDVEEQKLEAIKKKESLLKDVNGLIETFVS--GIAESRKS 139

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 26/123 (21%), Positives = 59/123 (47%), Gaps = 1/123 (0%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLD-EQSG 924
            +++ L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+ + +   L    + 
Sbjct: 88   DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            +  + E   T++K    N+    ++ V +PGNPTGA +    + +I +       +V+ D
Sbjct: 148  FQMDTEAALTILK----NDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ--NWENGLVVVD 201

Query: 1105 EVY 1113
            E Y
Sbjct: 202  EAY 204

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
            (AAT1) - aspartate aminotransferase, mitochondrial
            [contig 55] FULL
          Length = 422

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 40/144 (27%), Positives = 60/144 (41%), Gaps = 2/144 (1%)
 Frame = +1

Query: 691  RKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTAT 870
            R S     T  D   IS+ + +  T GA A  + LLS+F       V IP P +P +   
Sbjct: 98   RDSCPRGATFLDQNRISFVQTLSGT-GALAVASKLLSLFM---SRSVWIPNPSWPNHANV 153

Query: 871  LALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINP--GNPTGAVLSP 1044
               N  + + YY   + G       I+ + K A Q E +    +V++    NPTG   S 
Sbjct: 154  FQNNGFKEINYYSYYKDGSLDIEGWIQDLEKHA-QKEGEDPQCIVLHACCHNPTGIDPSK 212

Query: 1045 ESVSQIFEVAAKYGTVVIADEVYQ 1116
            E   +I +   +   + I D  YQ
Sbjct: 213  EQWQRILDKIHELNLIPIIDMAYQ 236

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar to
            uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 24/175 (13%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG---- 828
            Y   +G   +R+ + +F   R  G  S PE + L++G+S     +L +    P T     
Sbjct: 53   YGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGCLSVL-LHTTLPHTNFTRQ 110

Query: 829  VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKE-------------A 969
              I  P Y L           +    +DE+   S N E++ + ++               
Sbjct: 111  AFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVSI 170

Query: 970  IQNEIKPTVLV-------VINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            IQN  KPT  V       V    NP+G   S E+ +++ E+A +Y  ++I D+VY
Sbjct: 171  IQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
            YHR137W (ARO9) - aromatic amino acid aminotransferase II
            [contig 102] FULL
          Length = 525

 Score = 37.0 bits (84), Expect = 0.15
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            +P +L  I  G NPTG  LS E   QI+++A K+  +++ D+ Y    FP
Sbjct: 239  RPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPYGYLKFP 288

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
            Anc_2.252 YIL116W
          Length = 383

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 26/123 (21%), Positives = 58/123 (47%), Gaps = 1/123 (0%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYL-DEQSG 924
            E+  L  G+  +++ ++   C   +  +L+  P Y +Y+    +N+   +   L  E + 
Sbjct: 87   ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 925  WSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
            +  +  EI  +    + N+    ++ + +PGNPTGA +  + +  + +   +   +VI D
Sbjct: 147  FQIDATEILNI----LANDPLIKLVFITSPGNPTGAKIEIDRIEYLLKNWDQ--GLVIVD 200

Query: 1105 EVY 1113
            E Y
Sbjct: 201  EAY 203

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
            similar to uniprot|P07172 Saccharomyces cerevisiae
            YIL116w HIS5
          Length = 383

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 2/124 (1%)
 Frame = +1

Query: 748  EDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQAL--PYYLDEQS 921
            +++ L  G+  +++ ++   C   +  +L   P Y +Y+    +N+ + L  P   ++ S
Sbjct: 87   DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNS 146

Query: 922  GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIA 1101
                + + I  +  + +   IK  ++ + +PGNPTGA +    + +I E  +  G  V+ 
Sbjct: 147  FQPDSQKVISILSSDPL---IK--LVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVV 199

Query: 1102 DEVY 1113
            DE Y
Sbjct: 200  DEAY 203

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2.102
          Length = 510

 Score = 36.6 bits (83), Expect = 0.20
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP 1131
            KP +L  I+ G NP G  LS E   +I+++A ++  +++ D+ Y    FP
Sbjct: 223  KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFP 272

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar to
            uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
            Aromatic aminotransferase catalyzes the first step of
            tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 36.2 bits (82), Expect = 0.27
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 8/129 (6%)
 Frame = +1

Query: 751  DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLD---EQS 921
            D+ L  G+S A   ++   C    T VL+    +    A +       +P  LD   +  
Sbjct: 155  DVTLANGSSDATFKIIETLCDSSVT-VLVEEFTFSPTLAIITAAGGTTVPLKLDITADPD 213

Query: 922  GWSTNPEEIETVVKEAIQNE----IKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYG 1086
                N E +  ++    Q       KP +L  I  G NPTG  LS E   QI+ +A K+ 
Sbjct: 214  VQGINVEYLTDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHD 273

Query: 1087 TVVIADEVY 1113
             ++I D+ Y
Sbjct: 274  FIIIEDDPY 282

>KLLA0E05215g Chr5 (459726..460103) [378 bp, 125 aa] {ON} weakly
           similar to uniprot|Q06707 Saccharomyces cerevisiae
           YLR385C SWC7
          Length = 125

 Score = 34.3 bits (77), Expect = 0.27
 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
 Frame = +1

Query: 307 DDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNP 486
           D     ++L +E + +N +  K+     + + A EL     +  + L  D   N NI  P
Sbjct: 27  DSSLSLDELLVEPIVDNTVVEKFTSHSMVQIYAPELAPLNIRSIKGLISDLFTNTNIQEP 86

Query: 487 QQLQQKPLTYYRQVLSLLQ---YPELLNQNEQQ 576
           + L      YY + L+ LQ    PEL+ Q + +
Sbjct: 87  KNLITLANHYYSERLNYLQEEKIPELIQQMKDE 119

>SAKL0D14630g Chr4 (1206755..1207567) [813 bp, 270 aa] {ON} highly
            similar to uniprot|Q08873 Saccharomyces cerevisiae
            YOR367W SCP1
          Length = 270

 Score = 35.4 bits (80), Expect = 0.34
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = +1

Query: 1045 ESVSQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRTLQREHPGKF 1197
            E +SQ  E A KYG  V  DE++Q     E+  P   + S+K + R   ++HP KF
Sbjct: 161  EQISQFLEFARKYG--VPDDELFQTLDLYEDKDPAIVYQSLKSLSRYANKKHPDKF 214

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
            YHR137W
          Length = 523

 Score = 34.7 bits (78), Expect = 0.81
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            KPT++  +  G NPTG  LS E   QI+ +A ++  +++ D+ Y
Sbjct: 241  KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar to
            uniprot|P10356 Saccharomyces cerevisiae YER152C
            Hypothetical ORF
          Length = 445

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 42/180 (23%), Positives = 71/180 (39%), Gaps = 29/180 (16%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITK----RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 828
            Y   +G + +R ++A F         +   + PE I LTAGAS  V  +L      P TG
Sbjct: 52   YGPDEGSKWVRTAIAAFSNDCFQLPSEEMKTKPEHINLTAGASYGVMNILEQTTL-PHTG 110

Query: 829  ----VLIPIPQYPLYTAT--------------------LALNNSQALPYYLDEQSGWSTN 936
                  I  P Y L   T                    +  +  Q    Y D  S  + N
Sbjct: 111  YTRQAFIVSPTYFLINETFIDAGFGGKLTAIDELGHGKIDFDTLQQKLEYFDSIS--NDN 168

Query: 937  PEEIETVVKEAIQNEIKPTVLVVINP-GNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
              E++ +       ++   V+ ++    NP G   S E+  ++ E+A K+  ++++D+VY
Sbjct: 169  SSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVY 228

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YJL060W
            (BNA3)
          Length = 458

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 14/48 (29%), Positives = 27/48 (56%)
 Frame = +1

Query: 985  KPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
            K   +++ +P NP G V + E + ++  +  + G  +I+DEVY+   F
Sbjct: 212  KTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVYEHLYF 259

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
            Anc_2.102 YHR137W
          Length = 493

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +1

Query: 985  KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF-PGTKFHSMKK 1158
            KP ++  I  G NPTG  LS E   QI+ +A K+  +++ D+ Y    F P    H +K 
Sbjct: 204  KPKMIYTIATGQNPTGMTLSMEKRRQIYALAQKHDLLILEDDPYGYLRFSPYDPVHPLKN 263

Query: 1159 I 1161
            +
Sbjct: 264  L 264

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
            (REAL)
          Length = 517

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 42/184 (22%), Positives = 75/184 (40%), Gaps = 27/184 (14%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRD----DGEISYPEDIFLTAGASAAVNYLLSIFCRGPETG 828
            Y+ S+G   + + V + +++ +      E+    D+ L+ G++ ++  +    C    T 
Sbjct: 102  YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 829  VLIPIPQYPLYTATLALNNSQA---------LPYYLDEQS-------------GWSTNPE 942
            VLI       +T T A++N +A         +   LD  S              WST P 
Sbjct: 161  VLIEE-----FTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGP- 214

Query: 943  EIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQE 1119
                      ++  KP VL  I  G NPTG  +      +I+ +A K+  +++ D+ Y  
Sbjct: 215  ---------YKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGY 265

Query: 1120 NIFP 1131
              FP
Sbjct: 266  LYFP 269

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
            similar to uniprot|P10356 Saccharomyces cerevisiae
            YER152C Hypothetical ORF
          Length = 450

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 38/183 (20%), Positives = 72/183 (39%), Gaps = 32/183 (17%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKR------DDGEISYPEDIFLTAGASAAVNYLL---SIFCR 813
            Y S +G   +R+++  F           D   S PE + L +GAS  V  +L   ++   
Sbjct: 54   YGSDEGALWVRETICHFNNDEAFRLSPGDRARSKPEHLNLNSGASYGVLSILLETTLAHT 113

Query: 814  GPETGVLIPIPQYPLYTATLA----LNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNE 981
            G      +  P Y L           N + A+    D +    +  +++E + K+    +
Sbjct: 114  GYTRQAFVITPTYFLINDCFIDAGFANKTTAIDELGDGKVDLDSLEKKLEELEKQHEGQD 173

Query: 982  IKPTVLVVINP-------------------GNPTGAVLSPESVSQIFEVAAKYGTVVIAD 1104
                + ++ NP                    NP+G   + E+  ++ E+A KY  +++AD
Sbjct: 174  DSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDMLILAD 233

Query: 1105 EVY 1113
            +VY
Sbjct: 234  DVY 236

>TDEL0A02510 Chr1 (449069..450349) [1281 bp, 426 aa] {ON} Anc_2.475
            YKL106W
          Length = 426

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 1/132 (0%)
 Frame = +1

Query: 724  DDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPY 903
            ++G +S+ + +  T GA A  + LL++F       V I  P +P +      N    L  
Sbjct: 109  EEGRVSFAQTLSGT-GALAVASKLLALFL---SRTVWISEPSWPNHQNIFRSNGFTDLRT 164

Query: 904  YLDEQSGWSTNPEEIETVVKEAIQN-EIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAK 1080
            Y   Q+G     E +E +  E  ++ E + ++++     NPTG   + E   +I +   +
Sbjct: 165  YPYYQNGRLVVDEWLEKLKTEVRKDPETRHSIILHACCHNPTGLDPTREEWVRILDTVHE 224

Query: 1081 YGTVVIADEVYQ 1116
             G + I D  YQ
Sbjct: 225  LGMIPILDMAYQ 236

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
            (REAL)
          Length = 560

 Score = 33.5 bits (75), Expect = 1.9
 Identities = 28/136 (20%), Positives = 61/136 (44%), Gaps = 9/136 (6%)
 Frame = +1

Query: 751  DIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWS 930
            D+ L+ G++ ++  +   FC    T V+I    +    + +    +  +P  ++  +   
Sbjct: 184  DVILSGGSNDSMYKVFETFC-DESTTVMIEEFTFTPAVSNVEATGATVVPIKINLSADRE 242

Query: 931  TNPEEIETVVKEAIQNEI--------KPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKY 1083
            T   +++  + + ++N          KP VL  I  G NPTG  +      +I+E+A ++
Sbjct: 243  TQSVDVD-YLSQLLENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRH 301

Query: 1084 GTVVIADEVYQENIFP 1131
              +++ D+ Y    FP
Sbjct: 302  DFLIVEDDPYGYLYFP 317

>KNAG0C02710 Chr3 (532540..533421) [882 bp, 293 aa] {ON} Anc_5.561
            YDR446W
          Length = 293

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 37/147 (25%), Positives = 61/147 (41%), Gaps = 12/147 (8%)
 Frame = +1

Query: 1147 SMKKILRTLQREHPGKFDNVQLA-------SLHSTSKGVSGECGQRGGYMELTGFSHEMR 1305
            S+K+I    QRE PGK ++ +LA       S  S +K +  EC Q       T   HE  
Sbjct: 48   SLKEISSNKQREFPGKSNDTKLANFANFFLSPSSLTKKLEPECSQ-------TFIKHEPT 100

Query: 1306 QVILKLASISLCPVVTGQALVDLMVRPPV----EGEESFELDQAERNSIHEKLITRAMTL 1473
                  +   L P +T     +  V  PV     G E   + ++++   ++K+  R   +
Sbjct: 101  DT----SKACLIPSITCSPTTNPAVENPVLNTSTGNEEKRVSKSKKRDHNQKMFKRTAEV 156

Query: 1474 YDTFNSLEGIE-CQKPQGAMYLFPKID 1551
              T   ++ +E  +K      +F KID
Sbjct: 157  AATGPIVDEVESLEKSVNDPGVFKKID 183

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 44/180 (24%), Positives = 71/180 (39%), Gaps = 29/180 (16%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITKRD-DGEISYPEDIFLTAGASAAV-NYLLSIFCRGPETG-- 828
            Y S  G   +R+ +A F  ++      + PE + LT+GAS  + N LL      P TG  
Sbjct: 53   YGSDLGALWVREQIARFNNEKIFHVNHTKPEFLNLTSGASYGILNVLLQTSL--PHTGYT 110

Query: 829  --VLIPIPQYPLYTATLALNNSQALPYYLDEQSG--WSTNPEEIETVVKEAIQNEIKPTV 996
                I  P Y L                +DE  G  +  N E +ET +K   + E +   
Sbjct: 111  KQAFIVTPTYFLINDCFIDAGFGGKLTAIDETMGDEYDLNLELLETNLKSFAEEEDEKES 170

Query: 997  LVVINP---------------------GNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            +  I                        NP+G   S ++  ++ E+A +Y  ++I+D+VY
Sbjct: 171  ISCIQRDKIGVENKKIYRFVMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVY 230

>KLLA0F02233g Chr6 (199224..200429) [1206 bp, 401 aa] {ON} similar to
            uniprot|P47051 Saccharomyces cerevisiae YJL046W
            Hypothetical ORF
          Length = 401

 Score = 32.7 bits (73), Expect = 2.9
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = -3

Query: 1702 MLFLNDKCLVLGRIRNQEQYKY-P*ILTSSYNKIRQESVLNGALLERL*KANLSWETS 1532
            +L+ NDKC+V+G+ +N  +  Y   I +  YN +R+ S   GA++  L   N S+ TS
Sbjct: 143  LLYTNDKCVVVGKNQNPWKETYMRNIASRGYNFVRRRSG-GGAVVHDLGNVNYSYLTS 199

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
            aminotransferase II, catalyzes the first step of
            tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 32.7 bits (73), Expect = 3.2
 Identities = 39/186 (20%), Positives = 77/186 (41%), Gaps = 29/186 (15%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 822
            Y+ ++G+  +   V +F+++       D+ E ++  D+ L+ G++ ++  +    C    
Sbjct: 102  YAETKGLPPLLHFVKDFVSRINRPAFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 823  TGVLIPIPQYPLYTATLALNNSQA----------------------LPYYLDEQSGWSTN 936
            T V+I       +T T A++N +A                      + Y       WST 
Sbjct: 159  TTVMIEE-----FTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTG 213

Query: 937  PEEIETVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            P           ++  KP VL  I  G NPTG  +      +I+++A ++  +++ D+ Y
Sbjct: 214  P----------YKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPY 263

Query: 1114 QENIFP 1131
                FP
Sbjct: 264  GYLYFP 269

>Ecym_2328 Chr2 complement(641102..642307) [1206 bp, 401 aa] {ON}
            similar to Ashbya gossypii AFR609C
          Length = 401

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
 Frame = -3

Query: 1714 QVPRMLF-LNDKCLVLGRIRN--QEQYKYP*ILTSSYNKIRQESVLNGALLERL*KANLS 1544
            Q  R+LF +NDKC+V+G+ +N  +E Y Y  ++   Y  +R++S   GA++  L   N S
Sbjct: 135  QHERLLFYVNDKCVVIGKNQNPWKELYLYN-LVNRQYEFVRRKSG-GGAVVHDLGNVNYS 192

Query: 1543 WETS 1532
            + TS
Sbjct: 193  FITS 196

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
            YER152C (REAL)
          Length = 450

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +1

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            NP+G   S E+  ++ E+A KY  +VI D+VY
Sbjct: 203  NPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
            Anc_8.204 YER152C
          Length = 452

 Score = 32.3 bits (72), Expect = 4.0
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +1

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 1113
            NP+G   S E+  ++ ++A KY  ++IAD+VY
Sbjct: 206  NPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
            (REAL)
          Length = 513

 Score = 32.3 bits (72), Expect = 4.2
 Identities = 37/181 (20%), Positives = 76/181 (41%), Gaps = 24/181 (13%)
 Frame = +1

Query: 661  YSSSQGVEGIRKSVAEFITK------RDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPE 822
            Y+ ++G+  +   V + + +       D+ E ++  D+ L+ G++ ++  +    C    
Sbjct: 102  YAETKGLPPLLHFVKDMVCRINRPVFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 823  TGVLIPIPQYPLYTATLALNNSQALPYYLD-----EQSG------------WSTNPEEIE 951
            T V+I    +    + +    ++ +P  +D     E+ G            WST P    
Sbjct: 159  TTVMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTGP---- 214

Query: 952  TVVKEAIQNEIKPTVLVVINPG-NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIF 1128
                   ++  KP VL  I  G NPTG  +      +I+++A K+  +++ D+ Y    F
Sbjct: 215  ------YKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYF 268

Query: 1129 P 1131
            P
Sbjct: 269  P 269

>YJR151C Chr10 complement(712255..715740) [3486 bp, 1161 aa] {ON}
            DAN4Cell wall mannoprotein with similarity to Tir1p,
            Tir2p, Tir3p, and Tir4p; expressed under anaerobic
            conditions, completely repressed during aerobic growth
          Length = 1161

 Score = 32.3 bits (72), Expect = 4.8
 Identities = 21/66 (31%), Positives = 30/66 (45%)
 Frame = -2

Query: 1109 TSSAITTVPYLAATSKIWDTDSGDKTAPVGLPGLITTSTVGLISFCIASLTTVSISSGLV 930
            T+S I+T P  + TS  + T S   ++ +        ST    S   ASLTT + S+   
Sbjct: 283  TTSTISTAPTTSTTSSTFSTSSASASSVI--------STTATTSTTFASLTTPATSTAST 334

Query: 929  DHPDCS 912
            DH   S
Sbjct: 335  DHTTSS 340

>CAGL0H00110g Chr8 complement(2611..3711) [1101 bp, 366 aa] {ON}
           some similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019c STA1
          Length = 366

 Score = 32.0 bits (71), Expect = 4.9
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%)
 Frame = -3

Query: 709 IRRHFSLYLPHPEKKNKHQQNH--QCLPSSFWHV 614
           + +H +LYLP P  K+K + +H    LP  F+H+
Sbjct: 292 VAKHHTLYLPKPNNKDKDKHHHHVNSLPRLFYHL 325

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
            Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 32.0 bits (71), Expect = 5.3
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +1

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHS 1149
            NP+GA  S E   ++ ++A +Y  ++I+D+VY    F G +  S
Sbjct: 200  NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>KLTH0D00836g Chr4 complement(79191..79817) [627 bp, 208 aa] {ON}
            similar to uniprot|Q08873 Saccharomyces cerevisiae
            YOR367W
          Length = 208

 Score = 31.2 bits (69), Expect = 6.2
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = +1

Query: 1045 ESVSQIFEVAAKYGTVVIADEVYQ-----ENIFPGTKFHSMKKILRTLQREHPGKF 1197
            E +SQ    A +YG  V  DE++Q     E   P T + ++K + R   ++HP +F
Sbjct: 99   EQISQFLSFARQYG--VPEDELFQTVDLYEEKDPATVYQALKSLSRYANKKHPHQF 152

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 32.0 bits (71), Expect = 6.3
 Identities = 23/97 (23%), Positives = 51/97 (52%)
 Frame = +1

Query: 355 NVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLS 534
           N ++ KY +R +     EE   QL+++ +     KI + +     ++QQ+ L   R +  
Sbjct: 709 NEIRKKYTMRKSTIGTLEEKLDQLKREARKDVSQKIKDID----DKIQQQLLEQTRLLSK 764

Query: 535 LLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIG 645
           ++   E L +++++L+ S++F+ +A     S+ + IG
Sbjct: 765 MVSSMEDLKKSQKELITSQIFQFEAQNMDISMNDVIG 801

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 31.6 bits (70), Expect = 7.0
 Identities = 54/252 (21%), Positives = 96/252 (38%), Gaps = 9/252 (3%)
 Frame = +1

Query: 607  AIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKR---------DDGEISYPEDIF 759
            ++ RA+ ++E   G   AY    G       V++F+              G +S+ + + 
Sbjct: 84   SVARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLS 143

Query: 760  LTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNP 939
             T   S A  +L +   +     + +P P +  +     LN  + +  Y   + G     
Sbjct: 144  GTGALSLASLFLSNFISKT----IWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVD 199

Query: 940  EEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQE 1119
              +  + + A        +L+     NPTG   + E  S+I  V    G V I D  YQ 
Sbjct: 200  SWLAQLERAAADRPYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQ- 258

Query: 1120 NIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHE 1299
                G +   ++     L+     ++DN  L   HS +K + G  G+R G + +    H 
Sbjct: 259  ----GLESGDLRADAYLLRMCLEHRWDN-GLYVCHSFAKNM-GLYGERVGSLSVV---HP 309

Query: 1300 MRQVILKLASIS 1335
            + Q   K A+ S
Sbjct: 310  LGQFQAKAATDS 321

>Kpol_1004.71 s1004 complement(152942..154954) [2013 bp, 670 aa]
           {ON} complement(152942..154954) [2013 nt, 671 aa]
          Length = 670

 Score = 31.6 bits (70), Expect = 7.7
 Identities = 13/42 (30%), Positives = 26/42 (61%)
 Frame = +1

Query: 517 YRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDI 642
           Y  +LS L+Y E    ++ +++D K ++++ +KR    M+DI
Sbjct: 365 YLPILSPLEYSETQLSSDNEIIDIKTYQMELMKRTVCRMKDI 406

>NDAI0G05620 Chr7 (1389796..1393293) [3498 bp, 1165 aa] {ON} Anc_1.294
            YJL076W
          Length = 1165

 Score = 31.6 bits (70), Expect = 8.3
 Identities = 41/178 (23%), Positives = 70/178 (39%), Gaps = 10/178 (5%)
 Frame = +1

Query: 1180 EHPGKFDNVQLASLHSTSKGVSGECGQRGGY----MELTGFSHEMRQVILKLASISLCPV 1347
            +HP +  N+ + + HS  +G S E     GY    +E  G      + I          V
Sbjct: 691  QHPDQVQNININNDHSDEEG-SYETSSTDGYSSSGVETAGSDTSDNEKIFLREPNDKTKV 749

Query: 1348 VTGQALVDLMVRPPVEGEESFELDQA-ERNSIHEKLITRAMTLYDTFNSLEGIECQKPQG 1524
            +    L + +V    + ++  + + A   ++I  K+I +  +   + N  EG+   +P  
Sbjct: 750  IKTHHLKEAVVTKSNDNDKDTKQETATSTDNILGKVIGKNPSTASSGNVPEGLTKSQPS- 808

Query: 1525 AMYLFPKIDLPF----KAVQEARHLELTPDEFYCKSLLESTGI-CTVPGSGFGQEPGT 1683
                F KI+       K + E + + LTP  FY  S  E   +    P S F   P T
Sbjct: 809  ----FSKINEDDISNNKKINETKSISLTPSNFYSNSKTELKKLNIHKPTSKFTSMPNT 862

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2.420
            YLR027C
          Length = 408

 Score = 31.2 bits (69), Expect = 9.0
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 1018 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQ 1116
            NPTG   +PE   Q+ +  AKY  + + D  YQ
Sbjct: 186  NPTGMDPTPEEWEQVLDAMAKYHHIALFDSAYQ 218

>Kwal_34.15954 s34 complement(132450..132749) [300 bp, 99 aa] {OFF}
           [contig 272] FULL
          Length = 99

 Score = 29.3 bits (64), Expect = 9.8
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = -2

Query: 122 GGLMYGIFFTLVVRVLIWYDLIMSV 48
           G L +GIFF  V R+L +Y+LI+S+
Sbjct: 32  GCLEWGIFFYKVARILKYYELILSL 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 166,965,132
Number of extensions: 3744676
Number of successful extensions: 11004
Number of sequences better than 10.0: 133
Number of HSP's gapped: 10948
Number of HSP's successfully gapped: 133
Length of query: 593
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 478
Effective length of database: 40,294,809
Effective search space: 19260918702
Effective search space used: 19260918702
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)