Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1568.261ON61261230680.0
YLR088W (GAA1)8.261ON61461527650.0
Suva_10.1728.261ON61461427340.0
Smik_12.1478.261ON61361426810.0
SAKL0H17050g8.261ON58461218640.0
TDEL0F038808.261ON57961218310.0
ZYRO0C01672g8.261ON56961518120.0
CAGL0L12232g8.261ON59161217940.0
NCAS0B038608.261ON58361017780.0
TBLA0F030808.261ON58360717630.0
Kpol_543.378.261ON57861117510.0
AGR087C8.261ON57761117460.0
Ecym_43098.261ON57761117160.0
NDAI0J013908.261ON58360517130.0
Kwal_56.238048.261ON57861516840.0
KLLA0F19118g8.261ON57861316770.0
KNAG0H032508.261ON58561716640.0
KLTH0G13706g8.261ON58459816540.0
KAFR0B055508.261ON55558316270.0
TPHA0A018208.261ON58161415390.0
Kpol_1023.1004.351ON91697840.17
Kwal_26.71547.86ON121344733.3
KNAG0C018401.338ON21258704.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.156
         (612 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...  1186   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...  1069   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...  1057   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...  1037   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   722   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   709   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   702   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   695   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   689   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   683   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   679   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   677   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   665   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   664   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   653   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   650   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   645   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   641   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   631   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   597   0.0  
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    37   0.17 
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    33   3.3  
KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.33...    32   4.3  

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/612 (95%), Positives = 583/612 (95%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                       LNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480
           LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF
Sbjct: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480

Query: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXXXX 540
           PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLE                
Sbjct: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLLVL 540

Query: 541 TNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFES 600
           TNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFES
Sbjct: 541 TNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFES 600

Query: 601 RSVVVKSKEKQS 612
           RSVVVKSKEKQS
Sbjct: 601 RSVVVKSKEKQS 612

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/615 (84%), Positives = 555/615 (90%), Gaps = 4/615 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIALLPVIS LCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWN+LRGYRSQI+EM NMTS ERNN MGSWLQEFGTKTAIYE++QYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNSDDEFN+GGAALGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSS EDFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLP DQL NN+FWSRLKIL LGIRDWALSGVK PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                       LNAFINNAYA+ISLFSEYNLVALLVWF+SLV+SF++SQ FLL+PS GL
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480
           LMTIS+A+CFLPL+LS K+HISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIG+LAF
Sbjct: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRD--DLFEHHGDTV-LEXXXXXXXXXXXXX 537
           PMTF++TI V  S+EHE+ T+S   +KTE +D  +L E+H DT                 
Sbjct: 481 PMTFVKTI-VESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVL 539

Query: 538 XXXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASS 597
              TNPFISITLF L FD+EFHGFDI+NKL+SAWLDLKCW+WFVLCIGWLPCWLLILASS
Sbjct: 540 LILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASS 599

Query: 598 FESRSVVVKSKEKQS 612
           FES+SVVV+SKEKQS
Sbjct: 600 FESKSVVVRSKEKQS 614

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score = 1057 bits (2734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/614 (83%), Positives = 552/614 (89%), Gaps = 2/614 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRR+VDMGLVPR+IALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRE+EWN+LRGYRSQIEE  NMTS+ERNN MGSWLQEFGTKTAIYE++QYGETL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLAIPWFNS+ EFNVGGA+LGVSLARFFSRWPVWSKNIIVVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P AALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVE+SYDGLNGELPNLDLVN+
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEGMKVSLHGLPY+QL +NDF+SRLKIL LGIRDWALSGVKNPHGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                       LNAFINN YASISLFSEYNLVA+LVWFI++VVSF+ISQ+FL V   GL
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480
           LMTISLA CFLP+ LS KVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIG+LAF
Sbjct: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDD--LFEHHGDTVLEXXXXXXXXXXXXXX 538
           PMTFI+TI V +  E E GT+S+ S+KTE  D+  L +H+ +  LE              
Sbjct: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLLL 540

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             TNPFISIT+F L+FD+EF GFDI+NKL+SAW+DLKCW+WF+LC+GWLPCWLLILASSF
Sbjct: 541 ILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILASSF 600

Query: 599 ESRSVVVKSKEKQS 612
           ES+SVVVKSKEKQS
Sbjct: 601 ESKSVVVKSKEKQS 614

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/614 (81%), Positives = 547/614 (89%), Gaps = 3/614 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIA LPV+S +CALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWN+LRGYRSQIEEM NMTS ERNN MGSWLQEFGTKTAIYE++QYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNSDD+FNVGGAALGVSLARFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P AALRSWVEAYHTSLDLTGGSIEAAVV+DYSSAEDFFEYVEISYDGLNGELPNLDLVN+
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLP DQL  N++WSRLK+L LGIRDWAL+GVKNPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                       LNAFINN YASIS+FSEYNLVALLVWFISLV+SF++SQ+FLL+PS GL
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480
           LM IS+ +CFLPL+LS+KVHISEPLSYRLKNVAFLYFSLV TSLLMINFAMALLIG+LAF
Sbjct: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480

Query: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRD--DLFEHHGDTVLEXXXXXXXXXXXXXX 538
           PMT ++TI +  S EHE+  K + S+KTE ++  +L E++ D +                
Sbjct: 481 PMTLVKTI-IESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLL 539

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             TNPFISIT+F   FD+EF GFD++NKL+SAWLDLKCW+WFVLCIGWLPCWLL+LASSF
Sbjct: 540 VLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599

Query: 599 ESRSVVVKSKEKQS 612
           ES+ V++KSKEKQS
Sbjct: 600 ESKRVMLKSKEKQS 613

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/612 (58%), Positives = 446/612 (72%), Gaps = 39/612 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MAL+EKLHRR +DMGL+P+ IALLP +S  CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119
           PSQAYSYFRE+EWNVLRGYR+QIE  +  ++ ERN ++ SWLQ+FG KTAIY +++YGET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LYG++HAPRGDGTEAMVLA PW+NS++++N GG AL VSL+RFFSRWPVWSKNII+V SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P+AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299
           +A+ ITEHEGMKVSLHG+  ++L  NDF+SR+K + LG+++ ALSG+K  HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P             LN  +NN Y S+ L S YN+ ALL + ++L VSFI +Q FL  P  
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
            LL+++++    +P++ + +V I  P SYRLK+ A+LYFS+V TSLL++NF++A  +G L
Sbjct: 421 ELLLSLNVLLLLMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFPMT +RT                      +  +L     + VL               
Sbjct: 480 AFPMTLVRT----------------------TSGNLRARLKNCVL--------------L 503

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             +NPFI+I LFA+  D E  G  +   L SAW DL CW WFV+CIGWLP WLL+  S  
Sbjct: 504 LISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYSGI 563

Query: 599 ESRSVVVKSKEK 610
           +S S+VV   EK
Sbjct: 564 DSVSIVVPQDEK 575

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/612 (56%), Positives = 450/612 (73%), Gaps = 36/612 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+L+ KLHRR++D+GLVP+I+A LP++S L A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRE+EWN LRGYR+QIE + N TS ERN ++  WL+EFG KTAIY+ +++G+TL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV+HA RGDGTEA++LA PW N+D   N+ G ++G++L RFFSRWPVWSKNIIVV SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P+ ++RSWVEAYHTSLDLTGGSIEAAVVLDY    D+F++VEI YDGLNGE PNLDLVNI
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHG+  D++++NDFWSRL I+  GI++ ALSG++  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 XXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419
                        L+A INN Y  + L S YNL++L +W ISL+  F I+Q+FL   +  
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 LLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLA 479
           +L++ S    FLPL+L +K  I+EPL+YRLK+VAFL+FSLV TSLLM+NF +A  +G  A
Sbjct: 421 ILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 480 FPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXXX 539
           FPMT +RT            + ++ S++ + ++ +                         
Sbjct: 479 FPMTLVRT-----------SSLNNYSLRIKLKNSIL----------------------LL 505

Query: 540 XTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFE 599
            +NPFI+  +F   F+ +  GF +  +  +AW +L CW WFV+CIGWLP WL++  S+  
Sbjct: 506 LSNPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALSTLN 565

Query: 600 SRSVVVKSKEKQ 611
           ++   +  ++K+
Sbjct: 566 TQPAQLDDRKKK 577

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/615 (56%), Positives = 444/615 (72%), Gaps = 50/615 (8%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E+L RR+V+MGLVP+IIALLP++S +CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWN+LRGYRSQIE    ++++ERN QM  WLQEFG KT+IY +++YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG++HA RGDGTEA++LA+PW+N++ + NVGGA+LG+SL+RFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+VLDY    D+F+Y EISY GLNGELPNLDLVNI
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           A+SITEHEG+ VSLHG+  + + +  +WSRLKIL  GI   A +G++   GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTLKAHGH--GGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           QSVT+KAHG   G +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P             LN+ + N Y+++S +S YNL ALL W +S++VSF+ SQ+FL VPS 
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
            LL+   +    LPL       I+EPLS+RL+  AFLY SLV TSL+M+NF +A ++G L
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFPMT + T                       R   F+ +   ++               
Sbjct: 481 AFPMTAVGT----------------------QRSLTFKKYALLII--------------- 503

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             +NP +S   F +V  +      ++ KLISAW DL CW WFVLC+GWLP W LI  S+ 
Sbjct: 504 --SNPLVS---FFIVKPHP----QLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALSAC 554

Query: 599 ESRSV--VVKSKEKQ 611
            S ++  V  SK++Q
Sbjct: 555 SSTNLDPVATSKKEQ 569

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/612 (57%), Positives = 455/612 (74%), Gaps = 35/612 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP +S L  +   + +AILP+DGQYRRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRE+EWN+LRGYRSQIE +E+ +  +RN  +  WLQE G KTA+YE +++G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV+HA RGDGTEAMVLAIPW N DD+FN+GGAALGVSL++FF RWPVWSKNIIVVFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
             AALR+WV+AYHTSLDLT GSIEAAVVLDY S  DFFEYVEISYDGLNGELPNLDLVNI
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP +++ N D+++RLKI+ +GI++WALSGVK  HGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+AHG+ G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 XXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419
                        L++ INN Y SI   S   LV  ++   S+ VSF+IS++ +++P V 
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 420 LLMTISLATCFLPLVLSEK-VH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477
            L+  S+A  FLPLV+S+K +H I++ ++YRLK++  +Y+SL+ TSLLM+NFA+  +IG 
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXX 537
           LAFP+T             ++   S  ++  ESR  + ++                    
Sbjct: 481 LAFPLT-------------KLAVISTKTIADESRKSILKN-----------------TFI 510

Query: 538 XXXTNPFISITLFALVFDNEFHG-FDIV-NKLISAWLDLKCWNWFVLCIGWLPCWLLILA 595
              TNPFIS+ LF    D +F+G F ++ N++I++W  L CW WF++C+GWLP WL+ + 
Sbjct: 511 LFITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWLISVI 570

Query: 596 SSFESRSVVVKS 607
           SS  S+ +V ++
Sbjct: 571 SSIPSQPIVERT 582

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/610 (57%), Positives = 445/610 (72%), Gaps = 33/610 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E++ R+++  GL+P++I+LLP+ISTLC + G + I ILP +GQYR TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWN++RGYRSQI E+ N ++ ERN  M  WLQ+FGTKT IY++ + G+TL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV HAPRGDGTE+MVLAIPWFN+D EFNV GAALGV+LAR+FSRWPVWSKNIIVVF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P+AALRSWVEAYHTSLDLTGGSIEAA+VLD++   D F+Y+EI YDGLNGELPNLD+VNI
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
            +   EHEGMKVSLHG P+D++  +  +SRLKIL   I++ ALSGVK  +GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+A G  G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 XXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419
                        LN++ NN Y ++  FS Y L+++L WF+SLVV+FI+S IF+  P   
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 LLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLA 479
           +L+ +++  C  P +L     + + LSYRL++ AFL+ SL+ TSLLM+NF +A  +G L+
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 480 FPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXXX 539
           FPMT ++TI        +  T S T VK            ++VL                
Sbjct: 481 FPMTQVKTIT------SDTPTISRTRVK------------NSVL--------------LL 508

Query: 540 XTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFE 599
            +NPFI+  LF+L+ DNEF G D+  +L+SA  +L CW W VLC+GW   WLL+  S+ +
Sbjct: 509 VSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISALD 568

Query: 600 SRSVVVKSKE 609
           +  +   S++
Sbjct: 569 TVKLSNDSED 578

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/607 (55%), Positives = 441/607 (72%), Gaps = 37/607 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALL  +HRR++DMGLVP+I+  LP++S   A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWN+LRGYR++I+   +M S +RN  M  WL+EFGTKT++Y + +YG+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG+ +APRGDGTEA+VLAIPW+N+D EFN GGAALG++L+RFFSRWP+WSKNIIVVFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVEI Y G+NGELPNLDL+NI
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AI ITEHEGM+VSLHGLP + L  N+++SRL+ L LG +D  LSG+K  HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTLKAH---GHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           Q++TLKA     +  HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPS 417
           LP             L+++INN+Y+++ +FSEYNL+A L++ IS+  SF ++++ LL   
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 VGLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477
             LL+  S+    LP +L  +  I EPLSYRLK++AFLY SLV TSLL++NF++A  IG 
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXX 537
           L F MT ++TI +            H+S++   R+ +                       
Sbjct: 481 LGFAMTAVKTITI------------HSSMRVRVRNTM----------------------H 506

Query: 538 XXXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASS 597
              +NPF S+ LF  +FD + +G  I  + I +W  L CW WF++C+GWLP W+L+  SS
Sbjct: 507 LLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSISS 566

Query: 598 FESRSVV 604
            ++ +V+
Sbjct: 567 IQTNTVM 573

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/611 (53%), Positives = 432/611 (70%), Gaps = 35/611 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M++LE L RR++D GL+P+ +A LP +S L      + +  LPMDGQ+RRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRE+EWN+LRGYR +IE + + +S ERN  M SWL+EFG KT++Y++Q+YG++L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV +APRGDGTE+MVLA+PW+N++DEFNV GAALGVSLARF SRWPVWSKNIIVVFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           PR ALRSWVEAYHTSLDLTGGSIEAAVVLDY    D+FEY+E+ Y+G NG LPNLDLVNI
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  D++ N D+WSRLK++SLG ++ AL+GV+  +GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           Q++TLKA G   HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP 
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                       +++F+NN Y S+   S YNL++ + W +S++V F +   F   P   L
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480
           L+  ++    +PL   + + ISEPL+YRLK ++F+Y SLV TSLL++NF +A  +G  A+
Sbjct: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480

Query: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXXXX 540
           PM    T+V+  +T++         ++ ++R+ +                          
Sbjct: 481 PM----TLVMLNNTDN---------LRLKTRNSIL----------------------LAI 505

Query: 541 TNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSFES 600
           +NPFI+  LF  + +++  G + +  L+ AW  L  W WF+ CIGW P W+L+  S+ + 
Sbjct: 506 SNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISALKV 565

Query: 601 RSVVVKSKEKQ 611
             V  +   K+
Sbjct: 566 EQVQTEPNSKK 576

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/611 (53%), Positives = 430/611 (70%), Gaps = 38/611 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHR++VDMGLVP+II  L  IS +  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119
           PSQAYSYFRESEWN+LRGYRS+I+ M  +T+ ERN  + SW++E+G K A+Y   ++GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LY V+HA RGDGTEAMVLA PW   + ++N GG AL V++ R+FSRWPVWSKNII+V SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV+AYHT LDLTGGSIEAA+VLDY    D+F++VEISY+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299
           +A+ ITEHEGMKV+LHG P+++L  + ++SR+++L  GI+D ALSG+K   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P              ++ +NN +AS+ L S YN+ ALL + ++L+VS I +++F  +P+ 
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
            LL+  ++   F+P  L  K  I +P S+R K  A+LYFS V +SLL++NF +A ++G L
Sbjct: 421 ALLLAFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFPMTF+RT V             H SV+ + +                           
Sbjct: 480 AFPMTFVRTTV-------------HASVRQKMK----------------------NSLLL 504

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             +NPFISI +F  +F+ E  GF +   LI AW DL CW W+VLC+GW P W+++  SS 
Sbjct: 505 LLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYSSI 564

Query: 599 ESRSVVVKSKE 609
           +S  +   +K+
Sbjct: 565 DSVPIAAPAKK 575

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/611 (53%), Positives = 427/611 (69%), Gaps = 38/611 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHRRIVDMGLVPRIIA LP IS  CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119
           PSQAYSYFRESEWN+LRGYR ++E ++++   ERN  + SW++E+G KT+I  + QYGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LYG++H  RGDGTEAMVLA PW  +D  +N GGAAL +SLAR+F+RWPVWSKNIIVV S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P+A+LR+WV+AYHT LDLTGGSIE+AVVLDY    D+F+Y+EI Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299
            A+ I+EHEGMKVSLHG+P+ +L+ + +  RLK L  GI+D  L+G+KN  G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P              ++ +NN Y+ + L S YN+ AL  + ++L++SF+ ++ F  +P  
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
            LL+  ++A  F+   +  K  I +P SYR K  A LYFS+V TSLL++NFA+AL +G L
Sbjct: 421 SLLLAFNVALSFISFTVI-KYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFPM+  +             T ++ +++ + R+ L                        
Sbjct: 480 AFPMSLTK-------------TTTNATMQQKLRNSLL----------------------L 504

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             +NPFI+  +   +F+ +  G  + + LI AW  L CW W+VLCIGW P W+L+  SS 
Sbjct: 505 MSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYSSI 564

Query: 599 ESRSVVVKSKE 609
           +S  +V  SK+
Sbjct: 565 DSIPIVTTSKK 575

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/605 (55%), Positives = 424/605 (70%), Gaps = 40/605 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M LLE++ R IV  GL+P+I+A LP IS +      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRE+EWN++RGYR+++  MEN TS ERN  M SWL EFG KT IYE++   E L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV HAPRGDGTEA+VLA+PWFN D EFN  GAA+GV+LAR+FSRWPVWSKNIIVVFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P +ALRSWVEAY+TSLDLTGGSIEAA+VLD     D+F+Y+E+ YDGLNGELPNLDLVNI
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
            I I EHEGM+VSLHG P+DQ+  N++W+RLKIL   I+  A SG+   HGNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTLKAHGHGGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  G+ G  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 XXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVG 419
                        ++++INN   ++  FS Y L+  +VW ++LV  FI++Q+FL++P   
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 420 LLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLA 479
           LL+ I++      +++  K      +S RL++ AFL+ SL+ TSLLM+NF ++ +IG +A
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 480 FPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXXX 539
           FPMT +R+I    + +          +K E+                             
Sbjct: 480 FPMTKVRSITANTAPQ----------IKLEN------------------------IILLM 505

Query: 540 XTNPFISITLFALVFDNE----FHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILA 595
            +NPFI++ ++  V  N       G  ++N+LISAW D++CW WFVLC+GWLP W+++  
Sbjct: 506 ISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMVAI 565

Query: 596 SSFES 600
           S  E+
Sbjct: 566 SVIEN 570

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/615 (54%), Positives = 430/615 (69%), Gaps = 41/615 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFG-FISIAILPMDGQYRRTYISENALM 59
           MAL+E+L R+++D+GL+PRI+  LP +S LC + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119
           PSQAYSYFRE+EWN+LRGYR+QI+ +EN +S ERN  +GSWLQEFG KTA+YE +  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           LYGV+HAPRGDGTEAMVL+ PWFN D EFN GG AL V+LAR+FSRWPVWSKNIIVVFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P+A+LRSWV+AYHTSLDLTGGSIE+AVVLDY    DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299
           +AI +TEHEGMKVSL+G+P D++ N D+++R+K + +GI+  ALSGV+  +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ+V L+A G HG  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P             L+  +    ++       N+ A++ + ++L+ SF +S  F      
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
            +L++ S+ T   P++L+ +V I    ++RLK VA+LY S+V TSLL++NFA+A  IG L
Sbjct: 421 VILISWSVMTALAPILLN-RVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLL 479

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFP+     I+V  ST   +  K+   +   +                            
Sbjct: 480 AFPL-----ILVKNSTTPRLLFKNSLLLLLSN---------------------------- 506

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
               PFIS  LFA  F+    G  I+ +L+ AW +  CW W V+CIGWLP WLLI  SS 
Sbjct: 507 ----PFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSSM 562

Query: 599 ESR-SVVVKSKEKQS 612
            +  S ++ S EK+S
Sbjct: 563 ITDVSTLLNSAEKKS 577

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/613 (52%), Positives = 420/613 (68%), Gaps = 38/613 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIA-ILPMDGQYRRTYISENALM 59
           MAL+EKLHRRI+ +GL+P+ I+ L  +S LC + G   +  +LP DGQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENM-TSSERNNQMGSWLQEFGTKTAIYESQQYGE 118
           PSQAYSYFRESEWN+LRGYR+Q++  + + T+ + N ++  WLQEFG KTAIY+ +QYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFS 178
           TLYG+ HAPRGDGTEAMV+A PW+N + E+N GGAAL +SL RFFSRWPVWSKNII+V S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLV 238
           E+P+A+LRSWV AYHTSLDLTGGSIE+A+VLDY    D F+Y+EI YDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NIAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGW 298
           N+A+ I EHEG+KVSLHGLP+ +L  ND+ SRLK + LGI+D  LSG+KN +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPS 417
           L              LN  +NN Y  + L S YN+ ++L + ISLV +F  SQ+F+  P 
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 VGLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477
             +L+ +S     LPL+   ++ I EP SYR K  A++Y ++V TSLL++NF++A+++G 
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXX 537
           LAFPMT   TI+          +    S+K                              
Sbjct: 481 LAFPMTRTTTII---------ESNLRLSIKN--------------------------LVL 505

Query: 538 XXXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASS 597
              +NPFI+        +    GF +   LI A   L CW W+++C+GW P WLL+  +S
Sbjct: 506 LIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTYAS 565

Query: 598 FESRSVVVKSKEK 610
            ++  V    K++
Sbjct: 566 IDAIEVQTPIKKE 578

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/617 (54%), Positives = 435/617 (70%), Gaps = 38/617 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E L R+ V +GL+P+++A LP++S L A+   + I I+PM+GQYR TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMEN--MTSSERNNQMGSWLQEFGTKTAIYESQQYGE 118
           SQAYSYFRE+EWN+LRGYR++IE + +  +++S+R + +  WL EFG KTA+Y +++ G+
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFS 178
           TLYGV+HAPRGDGTEAMVL  PW NS+ EFN+GG+AL ++L+R+FSRWPVWSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLV 238
           +NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDY S  D+F Y EI ++GLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NIAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGW 298
           N+A+ IT+HEGMKVSLHGLP  +L  N++WSRLK+L LG++D  L+G+K  HGNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           RIQ+VTLKA G G  DITTFGRIPEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P             ++A +NNAYAS +L   Y L+A L   ISL+VSF+++  FL   + 
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYSTTS 419

Query: 419 GLLMTI-SLATCFLPLVLSEKVH-ISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIG 476
            L + + S+     PLV+S   + + EP+ YR++ + ++Y+SL+ TSLLM+NF +A  IG
Sbjct: 420 PLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSIG 479

Query: 477 SLAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXX 536
              +PMT ++ +         + +KS  S+K            ++VL             
Sbjct: 480 LFGYPMTLVKPL--------NIYSKSQMSLKLR----------NSVL------------- 508

Query: 537 XXXXTNPFISITLFALVFDN-EFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILA 595
               +NPF++  L   V +N EF   D+   L SAW DL CW WFVLC+GWLP WLL+  
Sbjct: 509 -LVISNPFVATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTF 567

Query: 596 SSFESRSVVVKSKEKQS 612
           SSF S      + EK+S
Sbjct: 568 SSFTSIPAAETTIEKKS 584

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/598 (53%), Positives = 416/598 (69%), Gaps = 40/598 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAIL-PMDGQYRRTYISENALM 59
           MAL+EKL RRI+D+GL+PRI+  LP +S LC + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119
           PSQAYSYFRE+EWN+LRGYR+QI+ +E  +S ERN  + SW QEFG KTA YE   +G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179
           +YGV+HAPRGDGTEAMVLA PW+N D E+N+GGAAL  +L+RFFSRWPVWSKNII+VFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV AYHTSLDLTGGSIE+AVVLDY  + DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299
           +A+ ITEHEGMKVSL+G+  +++   +++S++K + +G++  ALSGV++ +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PXXXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418
           P             L+  + +  ++   FS +NL A++ + ++L++SF +S +F      
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
            LL++ +     LP +   +  I    SY+ K+VAFLY S+V TSLL+INFA+A  IG L
Sbjct: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFP+  ++  +            S   VK            +T+L               
Sbjct: 480 AFPLILVKAPMT-----------SRQRVK------------NTIL--------------L 502

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILAS 596
             +NPFIS  LF   F+ +  G  + ++L+ AW  L CW W V+CIGWLP WLL+  S
Sbjct: 503 ILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/583 (56%), Positives = 408/583 (69%), Gaps = 42/583 (7%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L+E++ R++  MGLVP++   LP+ S + AL   ISIAILP+DGQYR TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRE+EWN+LRGYR+Q+E M ++  +ERN+ M +WL + G KT  + +     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YG+ H+PRGDGTEA+VLAIPW NS+ +FN GGAALGVSLARFF RWP+WSKNIIVVFSE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
             A+LRSWVEAYHTSLDLTGGSIEAAV+LDY+S  DFF+YVEI YDGLNGELPNLDLVNI
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP ++L     WSR K+L   I+D +L+G+K PHGNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           Q++TLKA G GG DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP 
Sbjct: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                       L  F+N+   SI   S Y L A++VWF+S+  SF  +  +L      +
Sbjct: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416

Query: 421 LMTISLATCFLPLVLSEKVHISE---PLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477
           LM I +   F+PL+ S  + ++E    +++R+K  AF YFSLV TSLLMINF +AL IG 
Sbjct: 417 LMFICILFSFIPLI-SRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXX 537
           LAFPMT +               K   ++ T S+                          
Sbjct: 476 LAFPMTLV---------------KISNTLPTSSQ-------------------ALKNSML 501

Query: 538 XXXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWF 580
              +NP+ISI  F+ +FD+E  G   +++LI AW D+ CW WF
Sbjct: 502 LLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/614 (48%), Positives = 413/614 (67%), Gaps = 36/614 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E LHRR   +GL+P++I  L ++S +  L     I  LP+DGQYRRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120
           SQAYSYFRESEWN+LRGYR+ IE + +  +  RN  + SWL +FG K A+Y++   G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180
           YGV ++ RGDGTEA+VLA+PW+N+D+E N+GGAALG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240
           P  A++SWV+AYH SLDLTGGS+EAA+VLD+ S  ++FE+VE+ ++G+NGELPNLD+VN+
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300
           AIS+ EHEG+KVSL GL   ++  + +++RLK L  G+++ ALSG +  +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPX 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLP 
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 361 XXXXXXXXXXXXLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420
                        +++INN Y ++ L    +++AL+++F S+ +SFI  QI        L
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 421 LMTISLATCFLPL--VLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478
           ++   L   FLPL  +    + I   LSYRLK+ AF+Y SLV TSLL++NFA+A  +G L
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEXXXXXXXXXXXXXX 538
           AFP+TF ++         EM T     +                                
Sbjct: 481 AFPLTFTKSC-------SEMITFKSKVINC---------------------------FYL 506

Query: 539 XXTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598
             +NPFI+I +F  +F+++   F++ + LIS++  +  W W + CIGW   W ++  ++ 
Sbjct: 507 AISNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIANL 566

Query: 599 ESRSVVVKSKEKQS 612
           ++    +    K++
Sbjct: 567 DTPRSALDGDTKKN 580

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 6/97 (6%)

Query: 211 YSSAEDFFEYVEISYDGLNGELPNLDLVNIAISITEHEGMKVSLHGLP--YDQLANNDFW 268
           + SA     Y+++ Y   N   P + L +I  SI E+  + +SL  L   YD+L NND+ 
Sbjct: 340 FPSAIQLNHYIDLYYRHFNNYYPFIHLFSINPSI-ENYPLLISLASLGSLYDKLQNNDYQ 398

Query: 269 SRLKILSLGIRDWALSGVKNPHGNEAFSGWRIQSVTL 305
              KI  L I+++ L   KN H  E+   W IQ + L
Sbjct: 399 ILYKIAWLNIKNF-LEITKNNH--ESTPLWVIQGIVL 432

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 207  VVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNIAISITEHEGM 250
            ++LD+   +D++ Y+E +  G +G +   DL+ +   +TEHE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>KNAG0C01840 Chr3 (363258..363896) [639 bp, 212 aa] {ON} Anc_1.338
           YBR264C
          Length = 212

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 75  LRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETLY-------GVMH 125
           + G +S IEE+ N  + +R N++  WL   G K  +  + Q  +T Y       G+MH
Sbjct: 98  IEGAKSWIEELHNYVNEDRRNKISIWL--VGNKIDLLPTAQDSDTTYPHEDVLRGIMH 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,602,463
Number of extensions: 2401784
Number of successful extensions: 6208
Number of sequences better than 10.0: 24
Number of HSP's gapped: 6283
Number of HSP's successfully gapped: 35
Length of query: 612
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 496
Effective length of database: 40,180,143
Effective search space: 19929350928
Effective search space used: 19929350928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)