Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1558.260ON29592959153060.0
Smik_12.1468.260ON29582959141540.0
YLR087C (CSF1)8.260ON29582959141320.0
Suva_10.1718.260ON29582960139770.0
NCAS0B050108.260ON2952297290570.0
NDAI0B019808.260ON2959296886750.0
KAFR0B027208.260ON2982300883590.0
CAGL0L12210g8.260ON2981300482420.0
KNAG0G020308.260ON2998301980260.0
TDEL0F038708.260ON2942298178540.0
ZYRO0C01694g8.260ON3006304771310.0
Kpol_392.78.260ON2995302969160.0
TBLA0E044208.260ON3148257961170.0
TPHA0J007308.260ON3046306359350.0
SAKL0H17072g8.260ON2997305556620.0
KLTH0G13728g8.260ON2966302049570.0
Kwal_YGOB_56.238088.260ON2941301149180.0
Kwal_56.23810singletonOFF2763280545200.0
Ecym_43108.260ON2943156323620.0
AGR088W8.260ON2887151520990.0
KLLA0F19096g8.260ON2923158620690.0
Kwal_56.23808singletonOFF62601629e-13
CAGL0H05159g8.527ON48563830.98
TBLA0C033305.312ON65855776.5
CAGL0K11132g8.464ON477123758.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.155
         (2959 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  5900   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  5456   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  5448   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  5388   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3493   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3346   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3224   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  3179   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3096   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  3029   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2751   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2668   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2360   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2290   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2185   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1914   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1899   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1745   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   914   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   813   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   801   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    67   9e-13
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    37   0.98 
TBLA0C03330 Chr3 complement(806178..808154) [1977 bp, 658 aa] {O...    34   6.5  
CAGL0K11132g Chr11 complement(1085316..1086749) [1434 bp, 477 aa...    33   8.9  

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 5900 bits (15306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2871/2959 (97%), Positives = 2871/2959 (97%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
            NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180
            LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG
Sbjct: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSD 360
            DTGKVSKLWKTFVRVLRIV                  SFFQKWKGLSLYKAAPGDAKPSD
Sbjct: 301  DTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPSD 360

Query: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480

Query: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540
            IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF
Sbjct: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600
            QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840
            TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960
            SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS
Sbjct: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020
            DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020

Query: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY
Sbjct: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYG                 
Sbjct: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200
                FIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA
Sbjct: 1141 DTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200

Query: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260
            FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN
Sbjct: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260

Query: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320
            LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL
Sbjct: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320

Query: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620
            IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK
Sbjct: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620

Query: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSXXXXX 1740
            IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMS     
Sbjct: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSTTEQT 1740

Query: 1741 XXXXXXXRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800
                   RESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH
Sbjct: 1741 VTVITEIRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860
            EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARM 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN              P      APARM
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARM 1920

Query: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980
            INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL
Sbjct: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980

Query: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040
            IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL
Sbjct: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040

Query: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100
            DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL
Sbjct: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100

Query: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160
            MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF
Sbjct: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160

Query: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220
            KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN
Sbjct: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220

Query: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280
            PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI
Sbjct: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280

Query: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340
            NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT
Sbjct: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340

Query: 2341 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2400
            KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE
Sbjct: 2341 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2400

Query: 2401 QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF 2460
            QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF
Sbjct: 2401 QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF 2460

Query: 2461 NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT 2520
            NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT
Sbjct: 2461 NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT 2520

Query: 2521 NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA 2580
            NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA
Sbjct: 2521 NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA 2580

Query: 2581 SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG 2640
            SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG
Sbjct: 2581 SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG 2640

Query: 2641 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP 2700
            ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP
Sbjct: 2641 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP 2700

Query: 2701 ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT 2760
            ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT
Sbjct: 2701 ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT 2760

Query: 2761 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE 2820
            DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2761 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE 2820

Query: 2821 EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXX 2880
            EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQ     
Sbjct: 2821 EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEEL 2880

Query: 2881 XXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2940
                        FNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV
Sbjct: 2881 EESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2940

Query: 2941 QKLVYLAEKQYVKILDGTH 2959
            QKLVYLAEKQYVKILDGTH
Sbjct: 2941 QKLVYLAEKQYVKILDGTH 2959

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5456 bits (14154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2621/2959 (88%), Positives = 2766/2959 (93%), Gaps = 1/2959 (0%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILT+V CLTM+FYMGRIYAYLV+FILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
             +KINVETLRVSLLGGRIHFKHLSVIHKDYTIS+LEGS+TWKYWLLNCRKAELI+NNK  
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120

Query: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180
               NVKLPCKF LECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE FSDG
Sbjct: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGK P+FLKFLPIEL F+RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYE+GEG++DVLPPKER+DLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSD 360
            DTGKVSKLWK F+RVL++V                  SF+QKWKGLSLYKA  G+AK +D
Sbjct: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360

Query: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDDIEFD TNHEYAKFTSILKCPK+TI+YDVDV G VPHGAHPTI DIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRT+KP+KKLPPGSRR+YTLFRMN+ 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480

Query: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540
            I EDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFN+ +CPTVEGF
Sbjct: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600
            QNNFHVHFVETEIRSSVNHDILLKSKVFN+DGDIGYPLGWNSKAIWIINMKS+QLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAG+PTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGD+L ID+TVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFT+KG+YLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840
            TSEEYTGVLGAR+VG++ TKSSV+DLAST+DSGYQNSS+KN SE K P+KRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVWNGALILPETIYS DPCIALHF+ELVVDFRSCNYYMDIMAVL+GTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900

Query: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960
            SK INEVFDFIRRNNGA+EQEHG+LSDLTIHGHRM+GLPPTEPTYFCQWDINLGDL+IDS
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020
            D+EFIKGFF+SFYKIGFGYNDLENILLYDTET+DDMTSLTVHAERI+IS  DPVMKSQSV
Sbjct: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020

Query: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            ++AES+LFTLIDFENE YSQRIDVK+PKL ISL+CVMGDGVD SFLKFETKLRFTNFEQY
Sbjct: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQR+YIT HDSPYHRC FLLPLFYQDSDTYQKLYG                 
Sbjct: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200
                FIIEDIVGEYATLLE  NPFKD FAETPSTVEPS+AS TEDDNDE A    FKP A
Sbjct: 1141 DTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200

Query: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260
            FTE  + ++ NYV+DVSYILLD+DPLLFVFTKSLL++ YSE+MVQVLDDIEIGIVK+LSN
Sbjct: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320
            LQEGITSISNID+HIAY+NLIWQETGEEGFELYLDRIDYQM EKSLEKNRT+KLLEVA L
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320

Query: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            AR+KTVRVTVNQK+NPDLSEDRPPALSLGLEGFE+WSSTE RQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLF+YCSDQ NL+QE   SFHSIQ TR SSKTELIS+LTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ+NI+KVLKERKYTSA DAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLFS DN +HKQNL+KKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620
            +ADANLVVDLTPPVTSLSLNREETIEITGR+GSVKGKFSDRLLKLQDLIPLVAAVG  DK
Sbjct: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620

Query: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SD K ELSKQF+MNTVLLVDKSE+QLVMD+TKLMSRTVGGRVSLLWENLKDSTSQAGS+V
Sbjct: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680

Query: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSXXXXX 1740
            IFSQKSEVWLKHASIIL EAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMS     
Sbjct: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740

Query: 1741 XXXXXXXRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800
                   RES LKIK+RIKFKPKSKK+SQFVG KIN VL+CYFSNVSSEIMPLSPFYIRH
Sbjct: 1741 VTAITEIRESALKIKERIKFKPKSKKKSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860
            EAKQLDIYFNKFGSNE+L+SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG+SKE YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARM 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN              P       PA M
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQ-VPALM 1919

Query: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980
            INWTLDTSI+YFGIL+PVASTYFVFELHMLLLSLTNTNNGMLPEE KVTGQFSIENILFL
Sbjct: 1920 INWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFL 1979

Query: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040
            IKERSLPIGLSK+LDFSIKVSTLQRT+DTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL
Sbjct: 1980 IKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2039

Query: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100
            DLGHYY++ HAPNIW+IKMFTGKSDKPKEIP+NFRSIHILSYKFCIGWLFQYG GSDPGL
Sbjct: 2040 DLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGL 2099

Query: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160
            MLGYNRLFSAYE+DFGKFTVVD+FFSVANGN SSTFFSEGNEKDKYNRSFLPNMQISYWF
Sbjct: 2100 MLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWF 2159

Query: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220
            KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQS+RAFQELK+NILDVSE+SH ED N
Sbjct: 2160 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSN 2219

Query: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280
             YA SS+E+A +SLAPFL+NIRSVNSNFKYDGGVFRVYTY+DIEAKSEPSFEIKSPVVTI
Sbjct: 2220 IYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTI 2279

Query: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340
            NCTYKH+E++ +PH+IR LI VDPT NTLYAGCAPLLMEFSESLQKMIKKHSTD+KP+FT
Sbjct: 2280 NCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFT 2339

Query: 2341 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2400
            KPS QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFS+TTNEFDSE
Sbjct: 2340 KPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSE 2399

Query: 2401 QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF 2460
             PLEFSLTL+ TKASI+HIFSREVSTSFEVGFMDLT+LFTHPDVISMYG  LVSDL+VFF
Sbjct: 2400 HPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFF 2459

Query: 2461 NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT 2520
            NVKQLQNLYLFLDIWRFSSILHTRP Q S++K IDM SLTST++VD+G EIPWCFTLIFT
Sbjct: 2460 NVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFT 2519

Query: 2521 NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA 2580
            NVSGDVDLGPSLGVISLRTQRTWLATDHY EKRQLLHAFTDG+SLTSEGRLSGLFEVANA
Sbjct: 2520 NVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579

Query: 2581 SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG 2640
            SW+SEVKWS EK KN+HPLVSTSLNIDD+A+KAAFDYHMFLIGTINNI FQLHNEKDAKG
Sbjct: 2580 SWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKG 2639

Query: 2641 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP 2700
            +LPDLLQVSFSSDEI LSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGES+QP
Sbjct: 2640 VLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699

Query: 2701 ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT 2760
            +LYKDILRSLKLLRTDLS++ISSLKVQISPISLFDVEVLVVRI  VSIRSETHSGKKLKT
Sbjct: 2700 VLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759

Query: 2761 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE 2820
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDY+HYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819

Query: 2821 EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXX 2880
            EKTNN+EYLFACSFSDKISV+WNLGPVNFIKEMWTTHVKALAVR+SQIAN+SFGQ     
Sbjct: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEEL 2879

Query: 2881 XXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2940
                        FNYIALEEPQI+VPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV
Sbjct: 2880 EESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2939

Query: 2941 QKLVYLAEKQYVKILDGTH 2959
            QKLVYLAEKQYVKILD TH
Sbjct: 2940 QKLVYLAEKQYVKILDDTH 2958

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 5448 bits (14132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2630/2959 (88%), Positives = 2768/2959 (93%), Gaps = 1/2959 (0%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            MEAISQLRGVPLTHQKDFSWVFLVDWILTVV+CLTMIFYMGRIYAYLV+FILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
             IKINVETLRVSLLGGRIHFK+LSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNK S
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180
              K  KLPCK S+ECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE FSDG
Sbjct: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASI+NDRDYQETDIGK PK L FLPIELKF+RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYE+G+G+IDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK+
Sbjct: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300

Query: 301  DTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSD 360
            D GKVSKLWKTFVRV +IV                  +F+ KWKGLSLYKA+ GDAK SD
Sbjct: 301  DRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360

Query: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDD+EFD TNHEYAKFTSILKCPK+TIAYDVDV G VPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRT+KP+KKLPPGSRRIYTLFRMN+ 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480

Query: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540
            IMEDTTWRIPTRE+SKD EFL+HYKET+EEYRPFGWMDLRFCKDTYANFN+ +CPTV+GF
Sbjct: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600
            QNNFHVHF+ETEIRSSVNHDILLKSKVF++DGDIGYPLGWNSKAIWIINMKS+QLEAFLL
Sbjct: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAG+PTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGD+L ID+TVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFT+KGSYLLYSELDIDNVDTLVIEC S STVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840
            TSEEYTGVLGAREVG++ TKSSV DLAST+DSGYQNSSLKNESEDK P+KRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVW+GALILPETIYS DPCIALHF ELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960
            SK INEVFDFIRRNNGA+EQEHG LSDLTIHGHRM+GLPPTEPTYFCQWDINLGDL IDS
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020
            DIEFIKGFFNSFYKIGFGYNDLENILLYDTET++DMTSLTVH E+I+I   DPVMKSQSV
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020

Query: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            ++AES+LFTLIDFENE+YSQRIDVKIPKL ISL+CVMGDGVDTSFLKFETKLRFTNFEQY
Sbjct: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQRRYIT HDSPYHRCPFLLPLFYQDSDTYQ LYG                 
Sbjct: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200
                +IIEDIVGEYATLLETTNPFK+IFAETPST+EPSRAS +EDDNDE ADP  FKP+A
Sbjct: 1141 DTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200

Query: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260
            FTE RNH+R NYV+DVSYILLDVDPLLF+F KSLL++ YSE+MVQVLDDIEIGIVK+LSN
Sbjct: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320
            LQEGITSISNID+HIAY+NLIWQETGEEGFELYLDRIDYQMSEKSLEKNRT+KLLEVA L
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320

Query: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            A++KTVRVTVNQK+NPDLSEDRPPALSLG+EGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLFEYCSDQGNLIQE   SF+SIQ+TR +SKTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ NI++VLKE+KYTSAKDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF+ +N +HKQNL+KKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620
            +ADANLVVDLTPPVTSL  NREETIEITGRVGSVKGKFSDRLLKLQDLIPL+AAVG  DK
Sbjct: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620

Query: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SD K ELSKQFKMNTVLLVDKSE+QLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSXXXXX 1740
            IFSQKSEVWLKH S+IL EAQLRDFS+LATTEAWSHKPTILINNQCADLHFRAMS     
Sbjct: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740

Query: 1741 XXXXXXXRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800
                   RES++ IK+RIKFKPKSKK+SQFV  KIN VLSCYFSNVSSE+MPLSPFYIRH
Sbjct: 1741 VTAITEIRESLMMIKERIKFKPKSKKKSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860
            EAKQLDIYFNKFGSNE+LLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGIS+E YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARM 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN              P      AP+ M
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQ-APSIM 1919

Query: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980
            INWTLDTSITYFG+LVPVASTYFVFELHMLLLSLTNTNNGMLPEE KVTGQFSIENILFL
Sbjct: 1920 INWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFL 1979

Query: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040
            IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL
Sbjct: 1980 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2039

Query: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100
            DL HYYSRRHAPNIW+ KMFTGKSDK KE+PINFRSIHILSYKFCIGW+FQYGAGS+PGL
Sbjct: 2040 DLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGL 2099

Query: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160
            MLGYNRLFSAYEKDFGKFTVVDAFFSVANGN SSTFFSEGNEKDKYNRSFLPNMQISYWF
Sbjct: 2100 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWF 2159

Query: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220
            KRCGELKDWFFRFHGEALDVNFVPSFMDVI+STLQS+RAFQELKKNILDVSE    E+DN
Sbjct: 2160 KRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDN 2219

Query: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280
             YA++S+ESAS+SLAPFLDNIRSVNSNFKYDGGVFRVYTY+DIE KSEPSFEIKSPVVTI
Sbjct: 2220 SYASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTI 2279

Query: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340
            NCTYKH+E++ KPH+ R LI VDPT NTLYAGCAPLLMEFSESLQKMIKKHSTD+KP+FT
Sbjct: 2280 NCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFT 2339

Query: 2341 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2400
            KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSM TNEFDSE
Sbjct: 2340 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSE 2399

Query: 2401 QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF 2460
            QPLEFSLTL+ TKASI+HIFSREVSTSFEVGFMDLTLLFTHPDVISMYGT LVSDLSVFF
Sbjct: 2400 QPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFF 2459

Query: 2461 NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT 2520
            NVKQLQNLYLFLDIWRFSSILHTRPVQ +++KEI+MSSLTSTNY D G EIPWCFTLIFT
Sbjct: 2460 NVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFT 2519

Query: 2521 NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA 2580
            NVSGDVDLGPSLG+ISLRTQRTWLATDHY+EKRQLLHAFTDG+SLTSEGRLSGLFEVANA
Sbjct: 2520 NVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579

Query: 2581 SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG 2640
            SW+SEVKW  EKSKN+HPLVSTSLNIDD+AVKAAFDYHMFLIGTI+NI F LHNEKDAKG
Sbjct: 2580 SWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKG 2639

Query: 2641 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP 2700
            +LPDLLQVSFSSDEI LSSTALV ANILDIYNTIVRMRQDNKISYMETLRDSNPGES+QP
Sbjct: 2640 VLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699

Query: 2701 ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT 2760
            ILYKDILRSLKLLRTDLS+NISS KVQISPISLFDVEVLV+RI  VSIRSETHSGKKLKT
Sbjct: 2700 ILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKT 2759

Query: 2761 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE 2820
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDY+HYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819

Query: 2821 EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXX 2880
            EKTNN+EYLFACSFSDKISV+WNLGPV+FIKEMWTTHVKALAVR+SQ+AN+SFGQ     
Sbjct: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEEL 2879

Query: 2881 XXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2940
                        FNYIALEEPQI+VPQIRDLGDATPPMEWFGVNRK+FPKFTHQTAVIPV
Sbjct: 2880 EESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPV 2939

Query: 2941 QKLVYLAEKQYVKILDGTH 2959
            QKLVYLAEKQYVKILD TH
Sbjct: 2940 QKLVYLAEKQYVKILDDTH 2958

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5388 bits (13977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2586/2960 (87%), Positives = 2746/2960 (92%), Gaps = 3/2960 (0%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILTV+ CLT IFYMGRIYAYLV+FILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
             IKINVETLR+SLLGGRI+FKHLSVIHKDYTIS+LEGSLTWKYWLLNCRKAELIEN K+S
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180
              KN++LPCKF LECEGLE FIYNRT+AYDNVINLLSKDERDKFEKYLNEHSFPE FSDG
Sbjct: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSD+SIINDRDYQET+IGK PK L F PIELK NRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240

Query: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYENGEG+IDVLPPKERLDLYRNKT +E KNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSD 360
            DTGKVSKLWKTFVRVLR+V                  +FFQKWKGLSLYKA+ GDAK SD
Sbjct: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDD-AFFQKWKGLSLYKASAGDAKTSD 359

Query: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420
            LDDIEFDFT+HEYAKFTSILKCPK+T++YDVDV G VPHGAHPTIPDIDGPDVGNNGAPP
Sbjct: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRT+KP+KKLPPGSRR+YTLFRMN+L
Sbjct: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479

Query: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540
            IMEDTTWRIPTRE+SKDAEFLQHYK+TSEEYRPFGWMDLRFCKDTYANFN+ +CPTVEGF
Sbjct: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600
            +N+FHVHFVETEIRSSVNHDILLKSKVF+LDGDIGYPLGWNS  IWIINMKS+QLEAFLL
Sbjct: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599

Query: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAG+PTPYELFRPFVYK+NWEM+GYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659

Query: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGD+L IDITVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719

Query: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            +YDFT+KG YLLYSELDIDNVD+L I CTSNSTVLHCYGFVMRYL NVKMNYFGEFFNFV
Sbjct: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779

Query: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840
            TSEEYTGVLGAREVGE++TKSSV+DLASTLDS YQN S+KN++ED  P+KRSDLKRTTNE
Sbjct: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNE 839

Query: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900
            TDIWFTFSVWNGALILPETIYS DPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV
Sbjct: 840  TDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 899

Query: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960
            SK INEVFDFIRRNNGA+EQEHG LSDLTIHGHRM+GLPPTEPTYFCQWDINLG+L I+S
Sbjct: 900  SKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINS 959

Query: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020
            DIEF+KGFF SFYK+GFGYNDLENILLYDTET++DMTSLTVHAERI IS NDPVMKSQS+
Sbjct: 960  DIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI 1019

Query: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080
            V+ ESLLFTLIDFENERYSQRID+K+PKL +SLSCVMGDG +TSFL FETKLRFTNF QY
Sbjct: 1020 VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQY 1079

Query: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KD DKKRSEQRRYI  +DSPYHRCPFLLPLFYQDSDTYQKLYG                 
Sbjct: 1080 KDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1139

Query: 1141 XXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200
                +IIEDIVGEYATLLE TNPFKD+FAETPSTVEP RAS TEDD++E ADPLEFKP+A
Sbjct: 1140 DTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADPLEFKPVA 1199

Query: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260
            FTE  NH+R NYVIDVSYILLD+DPLLFVFTKSLL++FYSEDMVQVLDDIEIGIVK+LSN
Sbjct: 1200 FTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSN 1259

Query: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320
            LQEGI SISNID+H+AY+NLIWQETGEEGFELYLDRI+YQMSEKSLEKNRTSK LEVA L
Sbjct: 1260 LQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVL 1319

Query: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380
            A++KTVR TVNQK+NP+LSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ
Sbjct: 1320 AKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1379

Query: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440
            MEWLFEYCSDQGNLIQE   S +SIQ+TR S+KTELISKLTAASEYYQISHDPYVITKPA
Sbjct: 1380 MEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPA 1439

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ NI+KVLKERKY+ AKDAKNIFMSVF
Sbjct: 1440 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVF 1499

Query: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF  D+A+HK N +KKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1500 STWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1559

Query: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620
            +ADANLVVDLTPPVTSLS NREETIEITG+VGSVKGKFSD+LLKLQDLIPLV AV   DK
Sbjct: 1560 VADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDK 1619

Query: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680
            SD KAELSKQFKMNTVLLVDKSEIQ+VMD+TK+MSRTVGGRVSLLWENLKDSTSQAGSLV
Sbjct: 1620 SDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLV 1679

Query: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSXXXXX 1740
            IFSQKSEVWLKH S IL EAQL DFSILATTEAWSHKPTIL+NNQCADLHFRAMS     
Sbjct: 1680 IFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQM 1739

Query: 1741 XXXXXXXRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800
                   +ESVLK+K++IKFKPKSK +SQFVG +IN VLSCYFSNVSSEIMPLSPFYIRH
Sbjct: 1740 VNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRH 1799

Query: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860
            EAKQLDIYFNKFGSNE+LLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG SKE YSLIN
Sbjct: 1800 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN 1859

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARM 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGI               P       PA+M
Sbjct: 1860 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGI-NLLSSLNSLFLTTDPMNAKKETPAKM 1918

Query: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980
            INWTLDT+I+YFGILVPVASTYFVFELHMLLLSLTNTNNG+LPE+ ++TGQ SIENILFL
Sbjct: 1919 INWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFL 1978

Query: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040
            IKERSLPIGLSKLLDFSIKVSTLQRT DTEQSFQVESSHFRVCLSPDSLLRL+WGA+KLL
Sbjct: 1979 IKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLL 2038

Query: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100
            D+  YYS+RHAPNIW+I+MFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAG DPGL
Sbjct: 2039 DMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGL 2098

Query: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160
            M GYNRLFSAYEKDFGKFT+VDAFFSV+NGN SSTFFSEGNEK+KYNRSFLPNMQISYWF
Sbjct: 2099 MFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWF 2158

Query: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220
            KRCGELKDWFFRFHGEALDVNF+PSFMDVIDSTLQS+RAFQELKKNILD+  +S+ME+ +
Sbjct: 2159 KRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSS 2218

Query: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280
            P A  + E+ASNSLAPFLDNIRSVN NFKYDGGVFRVYTYDDIEAKSEPSFE+KSPVVTI
Sbjct: 2219 PDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTI 2278

Query: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHST-DDKPSF 2339
            NCTYKH+E++AKPHRIR LI VDPT NTLYAGCAPLLMEFSESLQ MIKKHST + KP+F
Sbjct: 2279 NCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNF 2338

Query: 2340 TKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS 2399
            TKPS+QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS
Sbjct: 2339 TKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS 2398

Query: 2400 EQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVF 2459
            EQPL FSLTL+QTKASI+HIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSD+SVF
Sbjct: 2399 EQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVF 2458

Query: 2460 FNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIF 2519
            FNVKQLQNLYLFLDIWRFSSILHTRP Q   +KE++MS+L+S + VDVG EIPWCFTLIF
Sbjct: 2459 FNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIF 2518

Query: 2520 TNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVAN 2579
            TN+SGDVDLGPSLGVISLR+QRTWLATDHY EKRQLLHAFTDG+SLTSEGRLSGLFEVAN
Sbjct: 2519 TNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVAN 2578

Query: 2580 ASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAK 2639
            ASW+SEVKW LE SKN+HPLVSTSLNIDDVAVKAAFDYHMFLIGTINNI+F LHNEKD+K
Sbjct: 2579 ASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSK 2638

Query: 2640 GILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQ 2699
            GILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNP ESKQ
Sbjct: 2639 GILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQ 2698

Query: 2700 PILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLK 2759
            PILYKDILRSLKLLRTDLS+NISSLKVQISPISLFDVEVLVVRI  VSIRSETHSGKKLK
Sbjct: 2699 PILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLK 2758

Query: 2760 TDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQ 2819
            TDLQLQVLDVSAALSTSKEELDEEIGASIAIDDY+HYASKIVGGTIIDIPKLAVHMTTLQ
Sbjct: 2759 TDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQ 2818

Query: 2820 EEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXX 2879
            EEKTNN+EYLFACSFSDKISV+WNLGP+NFIKEMWTTHVKALAVR+SQ AN+SFGQ    
Sbjct: 2819 EEKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEE 2878

Query: 2880 XXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIP 2939
                         FNYIALEEPQI+VPQIRDLG+ATPPMEWFGVNRKR PKFTHQTAVIP
Sbjct: 2879 LEESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIP 2938

Query: 2940 VQKLVYLAEKQYVKILDGTH 2959
            VQKLVYLAEKQYVKILD TH
Sbjct: 2939 VQKLVYLAEKQYVKILDDTH 2958

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3493 bits (9057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1659/2972 (55%), Positives = 2191/2972 (73%), Gaps = 40/2972 (1%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M+A+SQ +GVPLT Q++FSW+FLV WILTV++ L+ IFY+GR  AY++TFILEWLLWK A
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
             +K+N+++LR+SLLGGRI FK++++IHKD TIS+LEG++TW+YWL N RK E  E + D 
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  LS------KNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFP 174
                    KN +LPC+F +  EGLEIF+YN+TVAYDN+I + SK+ER +FEK+LNE    
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176

Query: 175  ESFSDGSSADKLDE---DLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFN 231
            +  SD ++   +D+   D SES  T  S++S  NDR +QE +      FL+FLPI+    
Sbjct: 177  QILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDT-SSFLRFLPIQFLVT 235

Query: 232  RGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYD 291
            RGSL+LGNKFTPS++I+S ++ + ++D   PKE+LDLY+ K   E  N E ++KQNIG+D
Sbjct: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295

Query: 292  DAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKA 351
            + + +KFKLD GKVS++W  F R+L I+                   F  KW+GL+LYK 
Sbjct: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355

Query: 352  APGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGP 411
                 + +D+DDIEFDF NHEYAKF+SILK PK+T     D+ G VPHGAHPTI  +DGP
Sbjct: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415

Query: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRI 471
            DVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRT+KPVK+L PG RRI
Sbjct: 416  DVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRI 475

Query: 472  YTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNV 531
            YT  ++ V IM+D TWRIPTRE+SKD EFLQHY+ET+ EYRPFGW+DL+F K+T  N   
Sbjct: 476  YTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTF 535

Query: 532  VLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMK 591
             LCPTV+GF+NN  +H  E E RSSVNHDILLK K F+ D D  +PLGWN +A W IN+ 
Sbjct: 536  ALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLN 595

Query: 592  SQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651
            S Q+EAF+LREHITL+ADTL+DFS+GEPTPYELFRPF+Y +NW+++GYS+YLNVNDHNIV
Sbjct: 596  SSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIV 655

Query: 652  NNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNE 711
            NNPLDFNENCYLS HGD L +D  +P+ SI   +TDISY I TPMFR++LNTPPWNTLNE
Sbjct: 656  NNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNE 715

Query: 712  FMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMN 771
            FMKHKEVGR+YDF V GSYL+YS+LDIDNVDT++++CTS  T L CYGFV+RYL NVKMN
Sbjct: 716  FMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMN 775

Query: 772  YFGEFFNFVTSEEYTGVLGAREVG-EIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVK 830
            YFG+FF+FVTSEEYTG + A E   +  ++S     + +     Q +           ++
Sbjct: 776  YFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLHTELQ 835

Query: 831  RSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAV 890
            RSDLKRTTNETD+WFTF+VW GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYMD++A 
Sbjct: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895

Query: 891  LNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWD 950
            +N  SIKR+VSK  +E+F+ I +NNG     HG+LS LTIHGHRM+GLPP EPTYFCQWD
Sbjct: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955

Query: 951  INLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISF 1010
             +LG L I SDIEF++GFF+SF +IGFGY DLENILLY+ ET DDMTS+TV+ E++ +  
Sbjct: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015

Query: 1011 NDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFET 1070
             +P +   +     +L FT IDFENE+YS R+D+ IP L  SL     DG        ET
Sbjct: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075

Query: 1071 KLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXX 1130
            K++ TNF Q +D D+ R  QR YI  HD+PYHRC F+LP  YQD++ YQ+L+G       
Sbjct: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSS 1135

Query: 1131 XXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDER 1190
                          FIIED++GE+  LLET++PF+  F++     + S     +D+ +E 
Sbjct: 1136 LPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVS-----DDETEED 1190

Query: 1191 ADPLEFK-PIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDD 1249
             DPLEF  P    +    +R +++IDVS+I +++ P +     + L  F +E++VQ++DD
Sbjct: 1191 IDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQIIDD 1250

Query: 1250 IEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKN 1309
            IEI  V +LSNL+EG   ++N+ ++I Y++L W    + G  +YLDRID+ M EK++E+N
Sbjct: 1251 IEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEEN 1310

Query: 1310 RTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNL 1369
            +  KL+E+  L +I++VR TVNQ      +E+RPPALSL +EG+E+WSST + QVNSLN+
Sbjct: 1311 KEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNI 1370

Query: 1370 TSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQI 1429
             S+DIT+DE+Q+EWLF Y  +QG  IQ+ + +  +IQ  +I S+ ELIS LTAASEYYQI
Sbjct: 1371 LSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQI 1430

Query: 1430 SHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERK-YTS 1488
            SHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW   I + L + K   +
Sbjct: 1431 SHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAAT 1490

Query: 1489 AKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTV 1548
             +DAK IF+SVFS WRNWEFSD+ARSYIY KLF   ++  + +  KK +   + SF++TV
Sbjct: 1491 TQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTV 1550

Query: 1549 YGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDL 1608
            Y  GYEVEHNF+I   NL+++   P +  SL+RE    ITG +G+ KGK SD+++ +++L
Sbjct: 1551 YSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNL 1610

Query: 1609 IPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWEN 1668
            +P +    GG KS    +  K FK+NT++L ++ E+Q+ +  T+L+SR  G R+S+LWE+
Sbjct: 1611 LPSLKITDGG-KSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWES 1669

Query: 1669 LKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCAD 1728
             KD TSQA SL +++Q++E+ LKH +  L E Q+RDFS++ TTE+WS+KPTIL+N+QC+D
Sbjct: 1670 PKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSD 1729

Query: 1729 LHFRAMSXXXXXXXXXXXXRESVLKIKDRIKFKPKSKK----RSQFVGPKINIVLSCYFS 1784
            LH  AM+             E++ +I+  +    +++K     S    PK+N +L+C+F+
Sbjct: 1730 LHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFT 1789

Query: 1785 NVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGD 1844
            N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNE+LLS+WD D ++TSH TK+QY RFSFGD
Sbjct: 1790 NISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGD 1849

Query: 1845 IEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXX 1904
            +++KG +  + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I           
Sbjct: 1850 LQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGL 1908

Query: 1905 XXXXPXXXXXXAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPE 1964
                             +W++DT+I YFG+L P+ S YF+FEL MLL SLT   +  +P 
Sbjct: 1909 SKN--QKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD-IPN 1965

Query: 1965 EAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCL 2024
            ++ ++GQFS+EN+LF IKER+LP+ LSKLLDFSIKVS LQ+  +T  ++Q+ESSHFRVCL
Sbjct: 1966 QSDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCL 2025

Query: 2025 SPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKF 2084
            SP+SL+RL+W  +++     YY   H  N WD++       K  ++P+N  S HILSY F
Sbjct: 2026 SPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNF 2085

Query: 2085 CIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKD 2144
            C+GWLF   + S+PGL+LGYNRLFSAYEK+ GK T+VD FFS+ANGN S  FFSEG EKD
Sbjct: 2086 CVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKD 2145

Query: 2145 KYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELK 2204
            KYNRS+LPNMQISYWFK  G ++D F RFHGEALDV F+ S++DVI+S L SV+ FQELK
Sbjct: 2146 KYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELK 2205

Query: 2205 KNIL-DVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDI 2263
            K+++  + +   + DD            N+L+PFL NIRS++  FKYDGGVF++++ +D 
Sbjct: 2206 KDLIPGLPKKQKVNDDKTLEL-------NTLSPFLANIRSISCQFKYDGGVFKIFSLEDA 2258

Query: 2264 EAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSES 2323
            E +SEPSFE+ SP V I+  YKH EN  K H IR LI ++ T N LYA CAPLL +F E 
Sbjct: 2259 ETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFER 2318

Query: 2324 LQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADV 2383
            +Q M+KKHS+ ++ + +KPSSQN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAKVQAD+
Sbjct: 2319 IQGMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADI 2378

Query: 2384 GFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPD 2443
            GF+SF+F++TTN+ D+ +PL FSL++++T+ASI+HIFSRE STS  V F+D+TL+FTHPD
Sbjct: 2379 GFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPD 2438

Query: 2444 VISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTN 2503
            VI+++GT+L+S++++FFNVKQLQNLYLFLDIWR S +L ++P    +  + D SSL+   
Sbjct: 2439 VINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQ 2497

Query: 2504 YVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGV 2563
              D  + IPWCFTLIFTNV GDVDLGPSLGVIS++ +RTW ATDHY   R++LHAFTDG 
Sbjct: 2498 LSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGT 2557

Query: 2564 SLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIG 2623
            SL+S+GRLSG+FE+  ASWISEV W  + + N+HPLVS ++NID+++ KAAFDYHMFLIG
Sbjct: 2558 SLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIG 2617

Query: 2624 TINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKI 2683
             INN +  LH+EKD  G++PDLL+V+F  + ITL STALVAANILDIYNT +RMRQDNKI
Sbjct: 2618 AINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKI 2677

Query: 2684 SYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRI 2743
            SY+ETLR+SN  ESK PI Y DILRSL LL+TD+S++I +L +QISPI+LFDVEVLV+ I
Sbjct: 2678 SYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITI 2737

Query: 2744 KNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGG 2803
            +++S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YASKIVGG
Sbjct: 2738 ESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGG 2797

Query: 2804 TIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAV 2863
            TII+IPKL V MTT QEEK++ +EYL+ C F DK+SV+WNLGP+NFIKEMWTTH++A+AV
Sbjct: 2798 TIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAV 2857

Query: 2864 RQSQIANVSFGQXXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGV 2923
            R+SQ+  V  GQ                 F Y+ALE P+I +PQIRDLGDATPPMEWFGV
Sbjct: 2858 RRSQVVGVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGV 2917

Query: 2924 NRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            NRKRFP FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2918 NRKRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3346 bits (8675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1604/2968 (54%), Positives = 2177/2968 (73%), Gaps = 31/2968 (1%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M+AISQ + +PLT QKDFSWVFLVDWIL +++ L +IFY+ R  AY ++FILEW LWKR+
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNK 118
            N+KIN+E++R+S LGGR+ FK++ +IH+DYTIS LE ++TW+YWLLN RK+  +  E   
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 119  DSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFS 178
             + + +VKLPC+F LE EGLEIF+YNR VAYDN+I   SK+ER++FEK+LNE  F +S +
Sbjct: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTDSKA 180

Query: 179  DGSSAD-KLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLL 237
            + S+++   +ED  ESA T  SD+S  NDR +QE ++ + P+FL FLPI+ K + GSL++
Sbjct: 181  EVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGSLII 239

Query: 238  GNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297
            GNKFTPS+MI S  +  G+IDV  P E+LDLY+ +  ++FK F I IKQNIG+++   +K
Sbjct: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299

Query: 298  FKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAK 357
            FK+D  +VSK+W+ F +VL                      F++KW+GLSLY+       
Sbjct: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFGKS 359

Query: 358  PSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNG 417
              D++DI+FDF NHEYAKF+SI++ P+    ++ D+ G VPHGAHPT+   DGPDVGN+G
Sbjct: 360  NDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNSG 419

Query: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRM 477
            APP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR +KP K+L PG  RIYT F+ 
Sbjct: 420  APPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQFKT 479

Query: 478  NVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTV 537
             +   E+TTWRIPTRE+SKD EFLQHY+ET+EEYRPFGW+DL+F KDTY    V  CPT 
Sbjct: 480  TISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCPTK 539

Query: 538  EGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEA 597
            EGF+N   +H  + EIRSSVNHDILLK K FN   DIG+PLGWN +A W I+++S QLEA
Sbjct: 540  EGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQLEA 599

Query: 598  FLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657
            F+LREHITL+ADTL+DFS+GEPTPYELFRPFVY++NW++ GYS+YLNVNDHNIVNNPLDF
Sbjct: 600  FILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPLDF 659

Query: 658  NENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKE 717
            NENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK+KE
Sbjct: 660  NENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKE 719

Query: 718  VGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFF 777
            VGR++DF + GSYL+YSELDIDNVDT++IEC+S STVL CYGFV+RYLTNVKMNYFG+FF
Sbjct: 720  VGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGDFF 779

Query: 778  NFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDS--GYQNSSLKNESEDKDPVKRSDLK 835
            +FVTSEEYTG + A EV    T   + +  ++L S    + SS++ E      +KRSDLK
Sbjct: 780  HFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRSDLK 839

Query: 836  RTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTS 895
            R TNETD+WFTF+VW GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A +N  S
Sbjct: 840  RATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDIS 899

Query: 896  IKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGD 955
            ++R++ K  NE+++ +R++NG   +++G+LSD+ IH HRM+GLPP EPTYFCQWD +LG 
Sbjct: 900  LRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGT 959

Query: 956  LTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVM 1015
            L ++ DI F++GF  SF KI FG  DLENILLY+ E +DDMTSLTV  ++I I   +  M
Sbjct: 960  LDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRESEM 1019

Query: 1016 KSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFT 1075
             +  + TAE L F+ I+FENE+Y  R+D++IP   + +  + G   +  F +FETK+  +
Sbjct: 1020 DTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKVNLS 1078

Query: 1076 NFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXX 1135
            NFE+  DI   +S+Q+ YIT HD+PYHRC F+LP   QDS+ YQ L+G            
Sbjct: 1079 NFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLP 1138

Query: 1136 XXXXXXXXXFIIEDIVGEYATLLETTNPFKDIF--AETPSTVEPSRASSTEDDNDERADP 1193
                     +I++D++G +  +LE+ NPF+  F  A +P    P   S TE  +DE  DP
Sbjct: 1139 IPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTE--SDEELDP 1196

Query: 1194 LEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIG 1253
            LEFK     +       N+VID+SY  L ++P L+ +  +  + F S+D+VQ+LDDIEIG
Sbjct: 1197 LEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQILDDIEIG 1256

Query: 1254 IVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSK 1313
            IV  LS+LQEGI +  NI + I Y++L W +    G  LYLDRID +M +K LE+N  +K
Sbjct: 1257 IVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLEENNETK 1316

Query: 1314 LLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSD 1373
            + EV  L +I++VR T+N+  +   +++RPPALSL +EG E+WS   + QVNSLN+ S+D
Sbjct: 1317 ITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSAD 1376

Query: 1374 ITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDP 1433
            ITIDE+Q++WLF+Y   Q  L QE  ++  SIQ +R +++ +L+SKL  ASEYYQISHDP
Sbjct: 1377 ITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDP 1436

Query: 1434 YVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAK 1493
            YVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   I+++  ++   +  D  
Sbjct: 1437 YVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPG 1496

Query: 1494 NIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGY 1553
            N F+SVFS WRNWEFSD+ARSYIY  +FS  +++ ++N M+  +K  + S + TVY  GY
Sbjct: 1497 NAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFTVYSTGY 1556

Query: 1554 EVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVA 1613
            EVEHNF++   N+VV+  P ++  S+ +E+ I +TG +G++KGK S +L+ L+ L+P ++
Sbjct: 1557 EVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKKLLPELS 1616

Query: 1614 AVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDST 1673
                   S       + FK+N +LL ++SE+Q V+  +K+MSR  GG++S+LWE+ KD  
Sbjct: 1617 MKKNLKPS---TPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWESPKDLA 1673

Query: 1674 SQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRA 1733
            S+A S+ +++Q+SE+W+KH +IIL E+Q+R+FSI+ T E+WS+KPT+L+N QC D+HFRA
Sbjct: 1674 SKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCTDIHFRA 1733

Query: 1734 MSXXXXXXXXXXXXRESVLKIKDRIKFKPKS--KKRSQF--VGPKINIVLSCYFSNVSSE 1789
            M+             E++ +++        S  ++ SQ+  +  KIN+VL+CYF+NV+ E
Sbjct: 1734 MTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQKINMVLTCYFTNVNLE 1793

Query: 1790 IMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKG 1849
            IMPLSPF  RH AKQLDIYFN+ GSN+++LS+WDTD F+ SH TKE+Y RFSFG+I++KG
Sbjct: 1794 IMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKG 1853

Query: 1850 GISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXP 1909
             I +     IN+D+S S++KLT  + RR++ SFLQDEK+  + +               P
Sbjct: 1854 NILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAP 1913

Query: 1910 XXXXXXAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVT 1969
                     R + W+L+++I YFG+LVP++STYF+ ELHMLL+SL N   G+  +   ++
Sbjct: 1914 STEKS---GRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSKYNGLS 1969

Query: 1970 GQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSL 2029
            GQFSI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCLSP SL
Sbjct: 1970 GQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSL 2029

Query: 2030 LRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWL 2089
              ++W  ++ L    YY + H    W+  +    ++   E+  +F S H+LSY FC+GWL
Sbjct: 2030 AHMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNFCVGWL 2088

Query: 2090 FQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRS 2149
            F     ++PGL++GY+RLFSAYEK+FGK T++DA+FSVANG  S TFFS+G+EKD+YNRS
Sbjct: 2089 FSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRS 2148

Query: 2150 FLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILD 2209
            +LPNMQISYW K  G L+D + RFHGEALDVNF+ SF+DVI+S+L+S++ FQELK++++ 
Sbjct: 2149 YLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVG 2208

Query: 2210 VSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEP 2269
             + +   +       S+ +     ++PF   IRS+N  F+YDGGVF+V++  +     +P
Sbjct: 2209 TASNIKEQ-----TQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKP 2263

Query: 2270 SFEIKSPVVTINCTYKHNENEAK-PHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMI 2328
            SFEIKSP V I+  YK+NE + + P  IR LI ++ T NTL+A CAPL+ EFSE +QKM+
Sbjct: 2264 SFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMV 2323

Query: 2329 KKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESF 2388
            K+HS+D +PS T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+GF+SF
Sbjct: 2324 KRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSF 2383

Query: 2389 LFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMY 2448
             F++TTN++D E+PL F+L++++T+ASI+HIFSRE STSF V F+DLT++FTHP+ I++ 
Sbjct: 2384 TFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINIL 2443

Query: 2449 GTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVG 2508
            GT L+SD+ VFFNVKQLQNLYLFLDIW+ S++L+++P+   +    D+ SL+S    D  
Sbjct: 2444 GTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQSKDTD 2503

Query: 2509 AEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSE 2568
            + IPWCFTLIF+N++GDVDLGP+LGV+SL  +RTW ATDHY   R++LHA+T G++LTS+
Sbjct: 2504 STIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGITLTSK 2563

Query: 2569 GRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNI 2628
            GRLSG+ E+  ASWISEV W + ++ N +PLVS SLNID V  K AFDYHMFL+G INNI
Sbjct: 2564 GRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGAINNI 2623

Query: 2629 QFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMET 2688
               +H+EKD  GI PDLL+V+   + I L STALVAANILDIYNT++R+RQDNKISY+ET
Sbjct: 2624 DVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKISYIET 2683

Query: 2689 LRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSI 2748
            L++SN  E +Q + YKDILRSL L++TD+S++I +L +QISPISLFD E+LVV I+N+S 
Sbjct: 2684 LKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIENISA 2743

Query: 2749 RSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDI 2808
            RSETH+G KLKT+L++QV D S ALSTSKEELDE+I A+I+++DY+HYA +I GG II+ 
Sbjct: 2744 RSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGGVIIEA 2803

Query: 2809 PKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQI 2868
            P+L + MTT Q+EK++ +EYL+ CSF DKISV+WNLGPVNFIKEMW THV+A+AVR+SQI
Sbjct: 2804 PRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAVRRSQI 2863

Query: 2869 ANVSFGQXXXXXXXXXXXXXXX-XXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKR 2927
             +V+FG                   F Y+ LEEP+I +PQIRDLGDATPP+EWFG+NRKR
Sbjct: 2864 -DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKR 2922

Query: 2928 FPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            FP FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2923 FPAFTHQTAVILVQKLVHTAEKEYGSIL 2950

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3224 bits (8359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1561/3008 (51%), Positives = 2132/3008 (70%), Gaps = 77/3008 (2%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M + S+ + VP++  K+FSWVFL+DWIL VV+CL++IFY+GR  AY+ + ILEWLLWKRA
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
            +IK+N+E+LR+SLLGGRI FK++++IHKDYTIS+L+G+LTW+YWLL  RK      +KDS
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  ----LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE- 175
                + KN +LPC+F L CEG EIF+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 176  -------------SFSDGSSADKL-DEDLSESAYTTNSDASIINDRDYQETDIGKLPKFL 221
                         S  + +S  KL DED  ES Y++ S  +  NDR + +    K   FL
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 222  KFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFE 281
            +  P+E++ +R SL  GNKFTPS++I+S E+G G+ID   PKE+LDLY+ K  +E  NF 
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQ 341
            +++K NIGY + + LKFK+D GK+S+LWK F  +  I+                   F Q
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 342  KWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGA 401
            KW+GLSLYK    +    DLDDI+FDF NHEYAKF+S++KCPK    Y+ D+ G VPHGA
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPV 461
            HPT  +IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  PV
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 462  KKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521
            K+  PGS RIYT  ++++ IM+DTTWRI TRE SKD  FL+HYKET+++YRPFGW+DLRF
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 522  CKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWN 581
             K++YA F   L PT EGF+N+ ++H  + EIRSSVNHDIL+K K F+ D D+ YPL WN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 582  SKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSI 641
             +A W I+M S QLE FLLREHITL+ADTL+DF++GEPTPYELFRP    +NW+M+ Y I
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMML 701
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I++T+P E I   + +I+Y I+TPMFR++L
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 702  NTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761
            NTPPWNTLNEFMK+KEVGR+YDF+ KGSYLLYSELD+DNVDT+ I C S  T L CYGFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVL------DLASTLDSGYQ 815
            +RYL NVKMNYFG+FFNF+TSEEYTG+    E+ E +  S++       D+ S  +SG  
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESG-M 839

Query: 816  NSSLKNESEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELV 875
            + ++  E  ++  +KRSDL+RT NETD++ TFSVW+GA+ILPETIY+ D C AL F EL+
Sbjct: 840  DDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELI 899

Query: 876  VDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRM 935
            +D RS NYYMD++A L  T ++R+  K   ++F  +  +N  + +  G LSDL+IHGHRM
Sbjct: 900  IDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRM 959

Query: 936  FGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDD 995
            FGLPP EPTYFC+WD ++G L ++S+ +F+KGF  SF +IGFG+ DLENILLY  E ++D
Sbjct: 960  FGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIND 1019

Query: 996  MTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSC 1055
            MTSLTV+A+ I ++  + V      +  + + FT IDFE+  YS R+D+ IP L +S+  
Sbjct: 1020 MTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYG 1079

Query: 1056 VMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDS 1115
            +  DG       F TK+  T+F Q K+  + RS QR YIT +D+ +HR  FLLP  +Q  
Sbjct: 1080 LDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKK 1139

Query: 1116 DTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTV 1175
            + Y +LYG                     FI+ED +GEY +LL+    F+  F    ST 
Sbjct: 1140 ELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---STN 1196

Query: 1176 EPSRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLL 1235
             P++AS+    ++E  DPLEF     +  +N+Q  N VID+ YI ++++P +  + +SL 
Sbjct: 1197 TPNQAST---HHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLS 1253

Query: 1236 KEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLD 1295
               Y E++VQV+DDIEI  +K LS  QEG +SI+NI + + Y ++ W E    G ELYLD
Sbjct: 1254 STVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLD 1313

Query: 1296 RIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEV 1355
            ++D++MS++++EK+R   LLE+  LA+ +++R +++++ +    ++RPPALSL +EG E+
Sbjct: 1314 KLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCEL 1373

Query: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTE 1415
            WS+T ++QVNS++  S+DITIDESQ+EWLF + ++Q   +Q  + + +S+Q+    S+ +
Sbjct: 1374 WSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRK 1433

Query: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQD 1475
            LISKLTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW+ 
Sbjct: 1434 LISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWES 1493

Query: 1476 NIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKK 1535
             +E  LKE+      +AK +FMSVFS WRNWEFSDVARSYIYG+LF  + AE  +  M++
Sbjct: 1494 GVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRR 1553

Query: 1536 LLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVK 1595
            ++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T   ++RE+ I +TG +GSVK
Sbjct: 1554 IIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVK 1613

Query: 1596 GKFSDRLLKLQDLIPLVAAVGGGDKSDAKAELS---------KQFKMNTVLLVDKSEIQL 1646
            G FSD LL+L++LIPL+      +K   K E S         K FK+N +LL +K+E+QL
Sbjct: 1614 GNFSDELLRLKELIPLL------NKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQL 1667

Query: 1647 VMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFS 1706
            V+ ++KL +R + G+VSLL ++ K++ S AGS+++++++SE  + H +  L E Q+RDFS
Sbjct: 1668 VIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFS 1727

Query: 1707 ILATTEAWSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRESV------LKIKDRIKF 1760
            + AT E+WS KPT+L++ QCA  H ++M+             ++V      L I DR+  
Sbjct: 1728 LSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAE 1787

Query: 1761 KPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLS 1820
                  + +    +I +V  C  SNVS EIMP+SPFYIRHE K+ D+ F +FGS  V++ 
Sbjct: 1788 GENKSPKKKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMID 1845

Query: 1821 IWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVN 1880
            +WDTDFF+ S  TK+QY R SFGD +I   + + ++ +++ ++S SMIKLTFSEP RI++
Sbjct: 1846 VWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILS 1905

Query: 1881 SFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPA--RMINWTLDTSITYFGILVPV 1938
            SFLQDE+ AS+                 P       PA  + + W LDT I YFGILVP+
Sbjct: 1906 SFLQDERTASESFK----LLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPI 1961

Query: 1939 ASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSI 1998
            ++TYFVFE H L+LS+++ +     E+ +   Q SIEN++FLIK+R +P  LS++LDFSI
Sbjct: 1962 STTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSI 2021

Query: 1999 KVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIK 2058
              ST+Q+ ++ + SFQVES+HFR+ LSP SL+RL+WG  + L L +YY  +   ++WDIK
Sbjct: 2022 SFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIK 2081

Query: 2059 MFTGKSDK--PKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFG 2116
                K +K     I +N  S H+LSY FCIGW+F     S PG+MLG++RLFSAYE  +G
Sbjct: 2082 ASKLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYG 2141

Query: 2117 KFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGE 2176
            K T+VDAFFSVA G  S+TF+   +E +  NRS+LPNMQI+YW K+ G +KD F RFHGE
Sbjct: 2142 KLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGE 2201

Query: 2177 ALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAP 2236
            ALDV+F+ +F+ VI+S LQS + FQELK +++        + +     ++ E    SLAP
Sbjct: 2202 ALDVSFLTTFITVIESMLQSFQVFQELKTSLI--------QPNTSTTENNTEPKIKSLAP 2253

Query: 2237 FLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRI 2296
            FL NI+SVN  FKYDGGVF+V++++DIE+  EPSFE+K+P V I+  YKHN    KPH I
Sbjct: 2254 FLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWI 2313

Query: 2297 RILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDK-----PSFTKPSSQNVDYKR 2351
            R L+A+  T NTL+A CAPL+ EF E + +M+KKHS++ K      + +K  SQN+DYKR
Sbjct: 2314 RALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKR 2373

Query: 2352 LLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQ 2411
            LLD FD+A KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D  +PL FSL++++
Sbjct: 2374 LLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKK 2433

Query: 2412 TKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLF 2471
            TKASI+HIFS+E STSF +  +DL  +FTHPD+I+MYGT L+S++ ++FNVKQLQNLYLF
Sbjct: 2434 TKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLF 2493

Query: 2472 LDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPS 2531
            +DIW+ SS +   P   S + + +   LT     ++  EIPW FTLIFTN++G  DLGPS
Sbjct: 2494 IDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPS 2553

Query: 2532 LGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLE 2591
            LGV+SL+ +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV W  E
Sbjct: 2554 LGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKE 2613

Query: 2592 KSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFS 2651
            K  +++PLV+ S+NID++++KAAFDYHMFLIGTI+  +F LH+EKD  G +PDLL+V+F+
Sbjct: 2614 KRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFT 2673

Query: 2652 SDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESK-QPILYKDILRSL 2710
             + I + STALVAANILD+YNT++RMRQDNKI Y+ETLR+S+  E++  P  Y+DILRSL
Sbjct: 2674 CEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSL 2733

Query: 2711 KLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVS 2770
             LL+TD+S NI  LK+Q+SPI+LFD+EVLV+ I+N+S R+ T +G+KLKT L+L+V D  
Sbjct: 2734 NLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGY 2793

Query: 2771 AALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLF 2830
             ALSTSK E+DE+  ++I++ DY+ YASKI GGTII++PKL + MT+ QEE ++ +EYL+
Sbjct: 2794 VALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLY 2853

Query: 2831 ACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXXXXXXXXXXXX 2890
             C+F DKI+VKWNLGPVNFIKEMWTTHVKALAVR+SQ    +  Q               
Sbjct: 2854 KCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENI 2913

Query: 2891 XXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQ 2950
                Y+ +EEP+I +PQIRDLGDATPP+EWFGVNRKR P FTHQT V+PVQKLV+ AEKQ
Sbjct: 2914 SKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQ 2973

Query: 2951 YVKILDGT 2958
            Y  +LD +
Sbjct: 2974 YASLLDNS 2981

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 3179 bits (8242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1567/3004 (52%), Positives = 2127/3004 (70%), Gaps = 81/3004 (2%)

Query: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRAN 61
            ++ +  RG  L  +++FSWVFLVDWILTV++ L  +FY+ R +AY VTFILEWLLWK+A 
Sbjct: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64

Query: 62   IKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-------- 113
            +K+++  LR+SLL GR+ FK+L++I KD TI++LEGS+TW+YWL+  RK+E         
Sbjct: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124

Query: 114  ----IENNKDS--------LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDER 161
                  N++D         + K +KLPC+F  ECEG E+FIYNRT AYDN++N+LSK ER
Sbjct: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184

Query: 162  DKFEKYLNEHSFPESFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFL 221
            +KFEK++ E+ F +  SDGSS DK++E  + SA  +  + +I NDR +Q      LP++L
Sbjct: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242

Query: 222  KFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFE 281
            + LPIE   N+GS+L+GNKFTP V+ILS+E+   + DV     +LDLYR K ++  KN E
Sbjct: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302

Query: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQ 341
            I +KQNI YD+     F+ D GK+S+LW  F R+ ++V                  +F Q
Sbjct: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQPHD---NFMQ 359

Query: 342  KWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGA 401
            KWKGLS+Y+      +  + DDIEFD ++HEYAKFTS+LK P++TI +D D+ G+VPHGA
Sbjct: 360  KWKGLSMYRNDMF-GEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418

Query: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPV 461
            HP     DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRT+KP+
Sbjct: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478

Query: 462  KKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521
            KKL PGS+RIYT+ ++ +  MED TWRIPTRE+SKD EFL HYKET+++YRPFGW+D++ 
Sbjct: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538

Query: 522  CKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWN 581
             +D+   F++ +CPT +GF+N   V  V+TEIRSSVNHDI LKSK F+ + DIGYPLGWN
Sbjct: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598

Query: 582  SKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSI 641
            ++A W I M S QLE FLLREH+TL+ADTL+DFS+GEP PYELFRPFVY + W M+GYS 
Sbjct: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658

Query: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMML 701
            YLNVNDHNIVNNPLDFNENCYLS+HGD L +++ VP+++I   +T+++Y+I TPMFR++L
Sbjct: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLL 718

Query: 702  NTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761
            NTPPWNTLNEFM++KEVGR++DF +KGSYL+YSELDIDNVDTL +EC+S  T LH YGFV
Sbjct: 719  NTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778

Query: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKN 821
            +RYL NVKMNYFGEFF+FVTSEEYTG     ++  II++    D  S+ +S    S + +
Sbjct: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYES---VSRISS 835

Query: 822  ESEDKDP-------VKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTEL 874
             S DK+P       +K+SDLKRT+NETDIWFTFSVW+GALILPETIY+ DPCIALHF EL
Sbjct: 836  NSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAEL 895

Query: 875  VVDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHR 934
            +VD RSCNYYMDI+A     ++KR+V K  +E+++++  NNG + + HGTLSD+ IHGHR
Sbjct: 896  IVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHR 955

Query: 935  MFGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVD 994
            M+GLPPTEPTYFCQWD++ G L IDS++ F++G F +FYKIGFGY DLENILLY+TE +D
Sbjct: 956  MYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIID 1015

Query: 995  DMTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLS 1054
            DMTSLT+    I I  ND    + + +  E   FTLIDFENERYS+R+D+KIP L    +
Sbjct: 1016 DMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSL--EFN 1073

Query: 1055 CVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQD 1114
                +  D S L F+  + FTNF Q +D +K R  QR YI  +D+PYHRC FLLP  YQ 
Sbjct: 1074 IFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQK 1133

Query: 1115 SDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAET--P 1172
            S  Y +L+G                     +++ED++ +Y  L E     K+   E    
Sbjct: 1134 SRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLEL 1193

Query: 1173 STVEPSRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTK 1232
            S +E +RA +        ++P+     A       +  NYV+ V  I++D++P L+   +
Sbjct: 1194 SAIEATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIVIDINPALYTTIE 1247

Query: 1233 SLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFEL 1292
             LLK  Y +D VQ++D IEIGIVK+LS++ +G+T+++N+ V I + NL W E   +   +
Sbjct: 1248 KLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSM 1307

Query: 1293 YLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEG 1352
            + D++D+ ++EK+LE+N    LLE+  LA+IK VR+TV Q+     +++RPPA+++G+EG
Sbjct: 1308 FFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEG 1367

Query: 1353 FEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISS 1412
            FE WS+  ++QVNS++++S+DIT+D++Q+EW F+Y   Q     + L S++ IQ+ RI S
Sbjct: 1368 FEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIES 1427

Query: 1413 KTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDD 1472
            + ELIS+LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP D
Sbjct: 1428 QKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKD 1487

Query: 1473 WQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNL 1532
            W  N+ + L++RK+  ++DA++IFMS+FS WR+WEFSDVARSYIYGKLF  D+AE K+  
Sbjct: 1488 WYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQS 1547

Query: 1533 MKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSL---SLNREETIEITG 1589
            ++KL K  +G+F++TVY   Y+V+H+ V+++A L+++LTP  T     SL REE I+I+G
Sbjct: 1548 LQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISG 1607

Query: 1590 RVGSVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKA---ELSKQFKMNTVLLVDKSEIQL 1646
             V  +KGK S +LLKLQ LIP++    G +K   K     + K FKMN   +V+  +IQL
Sbjct: 1608 TVDVIKGKLSTKLLKLQKLIPILTE--GSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQL 1665

Query: 1647 VMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFS 1706
            VMD TKL      GR+S+LWENL+DST+QAGS+V+FS+ +E+ LKH + +L E ++ +F 
Sbjct: 1666 VMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFY 1725

Query: 1707 ILATTEAWSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRIKFKPKSKK 1766
               TT+ W+ +PT LI+++ + +HFR M+            +  + +I ++++ + +  +
Sbjct: 1726 ATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQ 1785

Query: 1767 RSQFVGP-KINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTD 1825
                  P K N++ SC FSNVS +IMP+SPF +++ AKQ+D ++NKF S+  L+ + DTD
Sbjct: 1786 HPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTD 1845

Query: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885
            FF+TS QTKEQY+R S   ++I+  +S     L+++++S +++KLTFSEP+ IV SFL+D
Sbjct: 1846 FFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKD 1905

Query: 1886 EKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARM-INWTLDTSITYFGILVPVASTYFV 1944
            E++AS+ ++                        +    W+LD+SI YFGIL+P+ STY+V
Sbjct: 1906 ERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYV 1965

Query: 1945 FELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQ 2004
             E H  + S++N  NG       +TG  S+ENILFLIKE SLP GLSK++D ++ VSTLQ
Sbjct: 1966 MEFHSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQ 2024

Query: 2005 RTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIW------DIK 2058
            R  D  +S QVESSH R+CLSPDSLLRL+WG ++   L  +Y + H+ ++W      D K
Sbjct: 2025 RVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDK 2084

Query: 2059 MFTGKSDKPKEIPI--NFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFG 2116
                 S K  E     +  SIH LSY  C+GWLF+Y  G   GL+ GY+RLFSAYE   G
Sbjct: 2085 QQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMG 2144

Query: 2117 KFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGE 2176
            K TV+D++F+ A GN SSTF+ E N K+ +NR +LPNMQI +W+K    +KD + RF GE
Sbjct: 2145 KLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGE 2204

Query: 2177 ALDVNFVPSFMDVIDSTLQSVRAFQELKKNIL---DVSEDSHMEDDNPYATSSMESASNS 2233
             LDV ++  FM  I+STL S++ FQ+LKK ++      E  H+++D P          NS
Sbjct: 2205 TLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPV---------NS 2255

Query: 2234 LAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKP 2293
                L NI+SVN +FKYDGG + V+   D      P+ EIKSPV++++  YKH +   K 
Sbjct: 2256 SNNILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKH 2315

Query: 2294 HRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSS-QNVDYKRL 2352
            H IR L+ +DPT N LYA CAPL+  F E ++ +  ++ +++K S T P+S QN+DY++L
Sbjct: 2316 HSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKL 2375

Query: 2353 LDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQT 2412
            L+ +D+A+ +TSAKQQLSLSCEPKAKVQADVGFE+   SMTTN FD ++PL FS +++ T
Sbjct: 2376 LEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDT 2435

Query: 2413 KASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFL 2472
            KASI+H+FSRE STSF VG++DLTLLFTH + I+ YGTSL+SD+ ++FNVKQLQNLYLFL
Sbjct: 2436 KASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFL 2495

Query: 2473 DIWRFSSILHTRPVQGSISKEIDMSSLTSTNY-VDVGAEIPWCFTLIFTNVSGDVDLGPS 2531
            DIW+ S +L+  PV  S  + I      S +  +   +++PWCFTLIFTNV GD+DLGPS
Sbjct: 2496 DIWQLSELLN--PVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPS 2553

Query: 2532 LGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLE 2591
            LG+ISLR  RTWLATDH+S KRQ+LHAF D + L SEGRLSG+  +  ASW+SEV W  +
Sbjct: 2554 LGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQD 2613

Query: 2592 KSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFS 2651
              +++ PLV+ SLN D + +KAAFDYHMFLIGT+NNI FQLH+E+D  G+ PDLL+VSFS
Sbjct: 2614 SKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFS 2673

Query: 2652 SDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLK 2711
             +EI L STALVAANILDIYNTI+RMRQD KISY+ETL+DSN   +KQ + Y+DIL+SL+
Sbjct: 2674 CEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQ 2733

Query: 2712 LLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSA 2771
            LLRTDL+++I SL++QISPISLFDVEV+V+ + +VS RSETHS  KL T L ++V D + 
Sbjct: 2734 LLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATL 2793

Query: 2772 ALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFA 2831
            +LST+K+ELDE+  + I + DY+ YASKI GGTII+IP++ V MTT QEEK++ +EYL++
Sbjct: 2794 SLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYS 2853

Query: 2832 CSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXXXXXXXXXXXXX 2891
            C F DK++V+WNLGPVNF+KEMWTTHVKA+AVR+SQ+   SF                  
Sbjct: 2854 CKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENIT 2913

Query: 2892 XFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQY 2951
              NY+ +EEPQI +PQI+DLGDATPP+EWFGVNRKRFP FTHQTAV+PVQ LVYLA+KQY
Sbjct: 2914 KLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQY 2973

Query: 2952 VKIL 2955
             K L
Sbjct: 2974 AKTL 2977

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3096 bits (8026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1521/3019 (50%), Positives = 2087/3019 (69%), Gaps = 92/3019 (3%)

Query: 2    EAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRAN 61
            + +SQ   + L   KDFSWVFLVDWILT+++ +T++FY+GR  A+ ++FI EWLLWKR  
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   IKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------E 115
            +K+N+E+LRVSLLGGRI FK+L++I KDYTIS L G ++W+YWL   R  + +      +
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 116  NNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175
            ++  SL +N KL C+  LECEG+E+F+YNRTVAYDN I + SK+ER KFE++LNEH F +
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 176  ----------SFSDGSSADKLD-EDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFL 224
                      S  +  + D+++ +  +ES++  ++++ + NDR + + + GK   FL +L
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGK-NLFLNYL 241

Query: 225  PIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISI 284
            P+++K +  S ++GNKFTPS++I+S ++ EGV+D   PKE+LD+Y+ K  M+ KN  +S+
Sbjct: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301

Query: 285  KQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWK 344
            KQNIGY++ + LKFKL TGK+SKLW  FV+    V                  +F QKW+
Sbjct: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361

Query: 345  GLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPT 404
            GLSLYK    +   +DLDDIEFD   HEYAKFTSI+KCP+  + Y+ D+ GFVPHGAHPT
Sbjct: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421

Query: 405  IPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKL 464
            +  IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KPVK L
Sbjct: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481

Query: 465  PPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKD 524
             PG RR+YTLF++ +++ ED TWRIPTRE+SKDAEFL+HYK T+E+YRPFGW+DL+F KD
Sbjct: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541

Query: 525  TYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKA 584
            +YA+FN  LC T +G QN   +H  ++EIRSSVNHDI +KSK  + D ++G+PLGWN KA
Sbjct: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601

Query: 585  IWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLN 644
             W IN+ S QLE FLLREHITL+ADT+SDFS GEPTPYELFRPF+Y +NW+++GYSIYLN
Sbjct: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661

Query: 645  VNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTP 704
            VNDHNIVNNPLDFNENCYLS HGD L +DITVP++ I    TDISY I TPMFR+MLN P
Sbjct: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721

Query: 705  PWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRY 764
            PWNTLNEFMKHKEVGRAYDF   G+YL+Y+ELD+DNVD + I C+S STVLHCYGFV+RY
Sbjct: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781

Query: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESE 824
            L N+KMNYFG+FF+FVTSEEYT  + ++  GE        D AST  S +  +   NE +
Sbjct: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDKN---NEED 838

Query: 825  DKDPVKR--SDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCN 882
            DK  V R  +D++R TNETD+W TF++W GAL+LPETIY+ DPCIALHF EL +D RS N
Sbjct: 839  DKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRSTN 898

Query: 883  YYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTE 942
            YYMD++A L+   ++++ +   NE+F+ +R+ NG + + H  +S++ IHGHRM+GLPPTE
Sbjct: 899  YYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPTE 958

Query: 943  PTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVH 1002
            PTYFC+WD +LG + ++S+++F+KG   SF KIGFG++DLEN+LLY+ E VDDMT++TV+
Sbjct: 959  PTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTVN 1018

Query: 1003 AERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGV- 1061
             +  KI  ++P + S++ +   ++ F  IDFENE+YS R+D++IP L +SL     +   
Sbjct: 1019 VKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEASK 1078

Query: 1062 DTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKL 1121
            + SF  FETK+ FTNF  YK+  + R+ QR YIT +D+P+HRC F+LP  YQ+S  YQKL
Sbjct: 1079 ELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQKL 1138

Query: 1122 YGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYAT----------LLETTNPFKDIFAET 1171
            YG                     FII+D + EY T            ++TN   D F   
Sbjct: 1139 YGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNSY 1198

Query: 1172 PSTVEPSRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFT 1231
            P T     A  T  D   R  PL             +R NYVID  YI + +DP LF + 
Sbjct: 1199 PDT-----APHTLSDTIIRKSPLP----------EDERDNYVIDFRYISISIDPELFFYI 1243

Query: 1232 KSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFE 1291
            + LL  FY +D  QV+D IEIG+VK+LSN QEGI+SI+N  + I + ++ W +    G E
Sbjct: 1244 EKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIE 1303

Query: 1292 LYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLE 1351
            LYLD +D++M+EKS+EKNR   L EV TL ++ ++R +VN K +   +E +PPALSL +E
Sbjct: 1304 LYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVE 1363

Query: 1352 GFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRIS 1411
            G + WS+T  + +NS+ LTS D TIDE+Q+ WLF +  DQ  LI   + +F  +Q  R  
Sbjct: 1364 GVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQ 1423

Query: 1412 SKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPD 1471
            S+ ELIS+LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLPD
Sbjct: 1424 SRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPD 1483

Query: 1472 DWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQN 1531
            DW + + K LKERKY ++KDAK+IFMSVFS+WRNWEFSDVARSYIY K+F  + AE +Q 
Sbjct: 1484 DWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQK 1543

Query: 1532 LMKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRV 1591
             + K  K    S Y+TVY  G  V+H+F++  +NLV + TP  T    N+E+ I +TG +
Sbjct: 1544 TVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNL 1603

Query: 1592 GSVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQT 1651
            GS+KGK SD++ KL +L+ LV          + +  S+ FK+N  LL D S++  V  +T
Sbjct: 1604 GSIKGKISDKMFKLHNLMNLVQQ-QEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGET 1662

Query: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATT 1711
             L +    G+ S LWEN K  T +  SLV+++++ E  +KH + +L E Q+   ++ A  
Sbjct: 1663 SLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAA 1722

Query: 1712 EAWSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRIKF----KPKSKKR 1767
            ++    P+I+ N QC D++ R M                   +K+  +     KP     
Sbjct: 1723 DSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKESFETDDLPKPTPTND 1782

Query: 1768 SQFVGP-KINIVL------SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLS 1820
            S    P KIN  L      +C+FSNVS +IMP+ PF  R E K+++  F+   +     +
Sbjct: 1783 SPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFN 1842

Query: 1821 IWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVN 1880
            IWD+D ++ SH TK+QY R S G+I +     +   ++ N+D+S S++KLTFSEP R++ 
Sbjct: 1843 IWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLF 1902

Query: 1881 SFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVPVAS 1940
            SFLQDE+  S+ +               P      A A+ I+W L+  I Y GIL+PV++
Sbjct: 1903 SFLQDEREVSRSVK--KLQVLGNLFSSEPEINTIPAGAK-IDWRLNADIKYLGILIPVST 1959

Query: 1941 TYFVFELHMLLLSLTNTNNGMLPEEA-KVTGQFSIENILFLIKERSLPIGLSKLLDFSIK 1999
            T+FVFE+H LL SL + + G +  EA + +GQ S++NILFLIK+R++P  LS+++D S K
Sbjct: 1960 TFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFK 2019

Query: 2000 VSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKM 2059
            +S +Q+ +++  S+Q+ES H R C SP SL+R++WG H+LL L  +Y R H+ N+WD   
Sbjct: 2020 ISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLP 2079

Query: 2060 FTGKSDKPKEI-----PINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKD 2114
               K  +  +       + F S HILSY FC+GWLFQ    +D GL+LGYNRLFSAYEK 
Sbjct: 2080 KKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKG 2139

Query: 2115 FGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2174
             GK T+VDAFFSV+NG  S TF+S+GNE+DKYNRSFLPN+QI YW K   E+KD F R H
Sbjct: 2140 CGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLH 2199

Query: 2175 GEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILD--------------VSEDSHMEDDN 2220
            GE LDVNF+ SF+ +I++TLQS++ FQELKK +++               SE+ +  +  
Sbjct: 2200 GETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETV 2259

Query: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280
            P      ++    +APFL +IR VN  FKYDGG+F+VY+++DIE+  +PSFEI+SP VTI
Sbjct: 2260 PGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTI 2319

Query: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPS-- 2338
            +  YK+N  + KPH IR LI V+ T N L+A CAPLLM  S+ +Q M+KKHS+  KP   
Sbjct: 2320 DLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPK 2379

Query: 2339 --FTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNE 2396
               ++P SQN+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F++ TN+
Sbjct: 2380 QRVSRP-SQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTND 2438

Query: 2397 FDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDL 2456
             D+ +PL F+L ++ T+++IRHIFSRE S SF +  +D+T +FTHP++I+M+G  L+SD+
Sbjct: 2439 LDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDV 2498

Query: 2457 SVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFT 2516
             V+FNVKQLQNLYLFLDIW+ S++L  +P++      + + +  S+  +DVG  IPWCFT
Sbjct: 2499 EVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPSSP-MDVGNIIPWCFT 2557

Query: 2517 LIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFE 2576
            LIF N++G VDLGPSLG++SL  ++ W A+DHY  KRQLLHA+ D + LT++GRLSG+ E
Sbjct: 2558 LIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVE 2617

Query: 2577 VANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEK 2636
            +  A W +EV W   K  + +PLV+ S  I ++++K AFDYHMFLIGT+ N  F LH+E+
Sbjct: 2618 LDGALWAAEVNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSER 2675

Query: 2637 DAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGE 2696
            D  G +PDLL+V  + ++I + STALVAAN+LD+YNTI+RMRQD  +SY+ETLR+SN  +
Sbjct: 2676 DTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTD 2735

Query: 2697 SKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGK 2756
            +K+ + YKDIL+ L L++TD+ ++I++L VQISPISLFDVEVLVV I NV    +TH+G+
Sbjct: 2736 TKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGE 2795

Query: 2757 KLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMT 2816
            KL+T L LQ+ +   +LS+SK E+DE++ + I+++DY+ YASKIVGGTI DIPKL + M 
Sbjct: 2796 KLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMH 2855

Query: 2817 TLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQX 2876
            T Q+  ++ +EY +  +F DKI+V+WNLGPVNFIKEMWTTH+KALAVR+SQ    + G  
Sbjct: 2856 TFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGDE 2915

Query: 2877 XXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTA 2936
                              YIA+EEPQI  PQI+DLGDATP +EWFG+NRK+FP FTHQT 
Sbjct: 2916 EGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTV 2975

Query: 2937 VIPVQKLVYLAEKQYVKIL 2955
            ++PVQKL++ AEK+Y  I+
Sbjct: 2976 IVPVQKLIHSAEKEYANIV 2994

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 3029 bits (7854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1503/2981 (50%), Positives = 2036/2981 (68%), Gaps = 71/2981 (2%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            ME  SQ   V L+++++FSWVFLVDW+L  V+ LT+IFY+GR++AY +T +LEW LWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIE--NNK 118
             +KI+VE+LR++ L G I F++L +I KD TIS+L+GSL W+Y LL  R+++  E  + K
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 119  DSLS---------KNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169
            D L          KN+ LPC+F L CEG EIFIYNRTVAY+N+I + S++ER +FEK+++
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 170  EHSFPESFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELK 229
            +    E F   S              ++ SD   INDR + E    K   F++FLP+EL+
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 230  FNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIG 289
             +RGS++LGNKFTPS++I S  +G GV+D+  PKE+LDLY+   Q++F + +ISI+QNI 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 290  YDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLY 349
            Y+     K     GK+S++W TFV+VL I                    F  KWKGL LY
Sbjct: 301  YNRK---KATFKNGKLSRMWATFVKVLHI----PFYNKSHNNKGTESEPFMTKWKGLGLY 353

Query: 350  KAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDID 409
            K    D    D D++ FDF NHEYAK ++I+K P+  + Y  D+ G VPHGAHPT+   +
Sbjct: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---E 410

Query: 410  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSR 469
            GP+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R+S P+K L PGSR
Sbjct: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470

Query: 470  RIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANF 529
            RIYT+F+    +++ ++WRIPTRE SKD EFL+ +K TSEEYRPFGW+DL+F  D+Y + 
Sbjct: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530

Query: 530  NVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIIN 589
              VLCP  EGF N  ++HF E E  SSVNHD++LK   F++ GD+GYPLGWNS A W IN
Sbjct: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590

Query: 590  MKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHN 649
            + S QLE FLLREH+TLVAD  +DFS+GEPTPYELFRPF+Y++NW ++GYSIYLNVNDHN
Sbjct: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650

Query: 650  IVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTL 709
            IVNNPLDFNENCYLSLHG+ L ID+T P +SI G Y D+ Y+ISTPMFR++LNTPPWNTL
Sbjct: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTL 710

Query: 710  NEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVK 769
            NEFMK+KEVGR+Y F V G Y +YSELDIDNVDTL +ECTS  T LHCYGFVMRYL NVK
Sbjct: 711  NEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770

Query: 770  MNYFGEFFNFVTSEEYTGVLGARE---VGEIITKSSVLDLASTL--DSGYQNSSLKNESE 824
            MNYFG+FF+F+TSEEYTGV+ A+E   VG+   + S+ D ++ L  DSG  +        
Sbjct: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGK-TEEESLRDNSTNLSTDSGGLSDPYVRLRA 829

Query: 825  DKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYY 884
            D  PV RSD+KRTTNETDIWFTFSVW GAL+LPETIY+ DPC+ALHF EL+VD RSCNYY
Sbjct: 830  DP-PVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYY 888

Query: 885  MDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPT 944
            MD++A ++ TSIKR+VS+  +E+F+ IRR+NG  E+EHG+L+ LTIHGHRM+GLPP EPT
Sbjct: 889  MDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPT 948

Query: 945  YFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAE 1004
            YFCQW I+L  LTI+SD EF KGFF  F  IGFGY +LEN LLYD ET DDMTS+TV   
Sbjct: 949  YFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVR 1008

Query: 1005 RIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTS 1064
             + +   +    S++VV   +L FT IDFENERYSQRID+K+P L I L     D     
Sbjct: 1009 DMNVVVEND--SSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIR 1066

Query: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGX 1124
             +   TK+  T+F Q +D  K RS+QR YIT +DSP++RC FLLP + Q+S  Y+ L G 
Sbjct: 1067 LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGS 1126

Query: 1125 XXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASST- 1183
                                FIIED++GE+A  L+     +    +  S  E    S   
Sbjct: 1127 ISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEH 1186

Query: 1184 EDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDM 1243
            E  +D R D     P   +     Q  N +IDV ++ +D+DPL+  +   LL EF+  + 
Sbjct: 1187 EGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNT 1246

Query: 1244 VQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSE 1303
            V ++D+IE+ IVK+L  L    T + N+ +++  +N  W +   +  +LY D++D+ + +
Sbjct: 1247 VDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQ 1305

Query: 1304 KSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQ 1363
            ++ + +  + + E  TL+++++VR TV  +   +  E+RPPALSL +EG+E +S   ++ 
Sbjct: 1306 RTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKI 1365

Query: 1364 VNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAA 1423
            V S++L S+DIT+DESQ+EWL  Y ++Q +LI+  L SF  +      ++ +L+  +T A
Sbjct: 1366 VGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTA 1425

Query: 1424 SEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKE 1483
            SE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W++N    ++ 
Sbjct: 1426 SEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN--SAIQV 1483

Query: 1484 RKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGS 1543
                 + DA     SV S WR WE SD+ RSYIY  +F  D ++ +   +KK+LK    S
Sbjct: 1484 SPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHS 1538

Query: 1544 FYLTVYGEGYEVEHNFVIADANLVVDLTPPV----TSLSLNREETIEITGRVGSVKGKFS 1599
            F+ T+Y EGY V HNFVI  AN+V +  P         +L+ +  + +T  +G++KG+ +
Sbjct: 1539 FFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGELN 1598

Query: 1600 DRLLKLQDLIPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVG 1659
            D+LLKL+++    A      +S     +SK +K+N +L  D+SE+Q V+ QT+L +R + 
Sbjct: 1599 DQLLKLRNIFS-KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILN 1657

Query: 1660 GRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPT 1719
            G+ +LL E LK+S + A S V F+++SE WLKHA ++L EA  R+ S+  T E WS+ P+
Sbjct: 1658 GKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPS 1717

Query: 1720 ILINNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRI---KFKPKSKKRSQFVG-PKI 1775
            + IN QC++ H RAM+             ES+ ++K      K  P  +  S  +  P  
Sbjct: 1718 LSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIPLQ 1777

Query: 1776 NIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKE 1835
            N  L+  FS+V++E+MPL+PF +RHE KQL +Y N+  SNE+L+SIWD +  + SHQT E
Sbjct: 1778 NTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTE 1837

Query: 1836 QYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINX 1895
            QY  F+ GD+++K  +  E  +++NV +S S++KLT SEPRRI++SFLQDEKL  + +  
Sbjct: 1838 QYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGY 1897

Query: 1896 XXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLT 1955
                                  +  + W+LD ++ YFGILVP+AST+FVFE+HMLL ++ 
Sbjct: 1898 IKGLLQLFS-----PLARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAMN 1952

Query: 1956 NTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQV 2015
            N ++G    +  VTGQ SIEN L LIKE SLP  LSKLLDFSI+V + Q+  ++ QS+Q+
Sbjct: 1953 NASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQI 2012

Query: 2016 ESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYS--RRHAPNIWDIKMFTGKSDKPKEIPIN 2073
            ESSHFRVCLSP SL++++WG H+L  L  Y+   R+    I    +F G +   ++  I+
Sbjct: 2013 ESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQ--ID 2070

Query: 2074 FRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKS 2133
            FRSIHILSY  CIGW+FQ G     GL++G++RLFSAYEK +GK T++D +FSVANG  +
Sbjct: 2071 FRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQST 2130

Query: 2134 STFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDST 2193
             TF+S+G+EK +YNRSFL N+QI+YW K    +KD F R +GEAL+V+ + +  D+I+ST
Sbjct: 2131 DTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIEST 2190

Query: 2194 LQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGG 2253
            L S++ FQ LKK      E  H  D  P    ++E+ SN+++PFL +IR+++  FKY GG
Sbjct: 2191 LASIQKFQTLKK------ERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGG 2244

Query: 2254 VFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGC 2313
            V ++Y+ DD+     PS EIKSP V I   Y HNE E +PHRIR L+++DPT N LY+ C
Sbjct: 2245 VLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQC 2304

Query: 2314 APLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSC 2373
             P+L +  E+ Q+M++KHS D+ P     SSQ++DYK LLD FD+A K+TS +QQLSLSC
Sbjct: 2305 VPILNDIVEASQRMVQKHSPDETP---LESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSC 2361

Query: 2374 EPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFM 2433
            EP+AKVQADVGF+SF F +TTN+     P   SL++++ ++S+RHIFSRE S SF V F+
Sbjct: 2362 EPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFV 2421

Query: 2434 DLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKE 2493
            D T +FTHPDV   +G +LVSD++VFFN+KQLQNL LFLDIW+ +  L+ +       ++
Sbjct: 2422 DFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDRK 2478

Query: 2494 IDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKR 2553
                S+T +        I W FTLIFTNV GDVDLGPSLGV+SLR  RTW ATDHY  +R
Sbjct: 2479 KQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQR 2538

Query: 2554 QLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKA 2613
            ++LHAF D +S+ SEGRLSG+F++ NA+WISEV +    S      +S SL++  VA+K 
Sbjct: 2539 RVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKT 2598

Query: 2614 AFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNT 2673
            AFDYHMFLIGTI+ ++F L +E D  GILPDLL V+ S  E+   +TAL AANILDIYNT
Sbjct: 2599 AFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNT 2658

Query: 2674 IVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISL 2733
            I RMRQDN+ISY+ETLR+SN  E++  +LY DIL+SL LLRTDLS +I++ K QISPISL
Sbjct: 2659 ITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISL 2718

Query: 2734 FDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDY 2793
            FDVEVLV+ I NVS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I+I+DY
Sbjct: 2719 FDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDY 2778

Query: 2794 IHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEM 2853
            + YASKI GGTI+ +P+L V MTT Q+ K++ IEYLF C F D+++VKWNLGP+NFIKEM
Sbjct: 2779 MLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEM 2838

Query: 2854 WTTHVKALAVRQSQIANVSFGQXXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGD 2913
            W+TH+K+LAVRQ+Q +N +  +                   Y+ L+EP I++PQI+DLGD
Sbjct: 2839 WSTHIKSLAVRQTQ-SNKTMSE-KDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGD 2896

Query: 2914 ATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2954
            ATPPMEWFGV+RKR P  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2897 ATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2751 bits (7131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1391/3047 (45%), Positives = 1994/3047 (65%), Gaps = 138/3047 (4%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M+  S  + V L   ++FSWVFLVDW+LT ++ LT+IFY+GRI+ +L+TFILEW++WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKA--------- 111
             +KIN+E+LR++ LGG I F++L +IH+DYTIS LEG++ W+YWL N RK+         
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 112  -ELIENNKDSLSKN-VKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169
             E +EN ++  S +  K PC+F L CEGLEIF+YN+T +Y+N+I++ SK+ER +FEK+++
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 170  EHSFPESFSDGSSADKLDEDLSESAYTTNSDAS--------------------------- 202
            + +  E F++    +K+  + + S+ T  +  S                           
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 203  IINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPP 262
            + ND  +++    +   +++FLPI++   R SL+LGN+FTPS++++S +N +G+ID+ PP
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 263  KERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXX 322
            KE+LDL++ K + E  + + S+KQNIG+DD I   FK   G++SKLW+ F R+  +    
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLL---- 356

Query: 323  XXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKC 382
                           +F + WKGLSLY+    + +  +L++++FDF NHEYA+  SILK 
Sbjct: 357  -PTLGPKHLQTQEDITFRENWKGLSLYRQ---NMEEDELENVDFDFANHEYARVISILKS 412

Query: 383  PKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQ 442
             K+   Y+ D+ G VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA+RQ
Sbjct: 413  AKIVFTYEYDIPGLVPKEPEETL---QGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469

Query: 443  VSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQ 502
            +S+L+ +LSPVVSRT KP+K L PGS+RIYT+F+ ++ IME++TWRIPTRE SKD EFL+
Sbjct: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529

Query: 503  HYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDIL 562
            HY ET EE+RPFGW+DL+F KD+Y   + V+CPT EG  NN + HF   EIR+SVNH++L
Sbjct: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589

Query: 563  LKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPY 622
            L++K F+ + D+GYPLGWN +A W IN+ S QLE F+LREHITL++D  +DFS+G+PTPY
Sbjct: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649

Query: 623  ELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESIL 682
            ELFRPF+Y++NW ++GYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  D+ +PR+++ 
Sbjct: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709

Query: 683  GTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVD 742
               T+I+Y ISTPMFR++LNTPPWNTLNEFMK+KEVGR+Y+F V G Y ++SELDIDNVD
Sbjct: 710  NRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769

Query: 743  TLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVG--EIITK 800
            T+ +EC+S  T LHCYGFV+RYL NVKMNYFG+F +FVT+EEYT      E     +  +
Sbjct: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829

Query: 801  SSVLDLASTLDSGYQNSSLKNESEDKD-PV-KRSDLKRTTNETDIWFTFSVWNGALILPE 858
             S  +++ST D     ++ +    +K  P+ KRS+LKRT NE DIWF FSVW GALILPE
Sbjct: 830  HSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPE 889

Query: 859  TIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGAN 918
            TIY+ DPCIALHF EL VD RS NYYMD++A +N T +KR+VS+  +++F+ +R++NG  
Sbjct: 890  TIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQ 949

Query: 919  EQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFG 978
            E+ HG LS LTIHGHRM+GLPPTEPTYFCQW +++  L I+SD+EF KGF   F KIGFG
Sbjct: 950  EKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFG 1009

Query: 979  YNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERY 1038
            + +LENILLY+T T+ DMTS+TV  + +K   ND    S+SV+ A+ + FT IDFENE Y
Sbjct: 1010 FKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENEAY 1069

Query: 1039 SQRIDVKIPK---LIISLSCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYIT 1095
            SQR+D K P    LI  L     +G     L  +T+L FT+F Q +     R  QR YIT
Sbjct: 1070 SQRVDFKFPDINFLIFELDENQKEG--RFLLHLKTQLNFTDFIQNQAFADHRYRQREYIT 1127

Query: 1096 AHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYA 1155
             HDS Y+RC FLLP F+Q+S  Y++L G                     +IIED +GEYA
Sbjct: 1128 LHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYA 1187

Query: 1156 TLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKP-IAFTEGRNHQR-GNYV 1213
              +      K   + +  T E  R   T +D   +A+   F P +      N  R  NYV
Sbjct: 1188 PTV------KPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYNNYV 1241

Query: 1214 IDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDV 1273
            +DV Y+ L+V P +     + LK+FY+ED   ++D  EI IVK+L NLQ G + ++   +
Sbjct: 1242 LDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSRL 1301

Query: 1274 HIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQK 1333
            H+  ++ ++      G EL L+  D+ +  K++E      +LE    + I T+R+++ + 
Sbjct: 1302 HVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEA 1361

Query: 1334 RNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGN 1393
                +S  +P AL L +E  E+WSST D  VNS+N+TS   T+DESQ+E +  Y   Q  
Sbjct: 1362 HPSSISM-KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIK 1420

Query: 1394 LIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVREN 1453
            ++++ + S   +++ R  ++ +LI  LT+ASEYYQISHDPYVITKPAFIMRLS+GHVREN
Sbjct: 1421 VLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVREN 1480

Query: 1454 RSWKIITRLRHILTYLPDDWQ--DNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDV 1511
            RSW+IITRLRHILTYLP+DW+  D++  V         +  ++IF+SVFS WRNW+ SD+
Sbjct: 1481 RSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDI 1540

Query: 1512 ARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLT 1571
             RSYIY K+F   N +  +  ++ +LK    SF+ TV   GYEV  + +    N++VD+ 
Sbjct: 1541 TRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDVL 1600

Query: 1572 PPVTSLS----LNREETIEITGRVGSVKGKFSDRLLKLQDL-----------------IP 1610
            PP  + S      +E+ I +T  +G++KG++ + + KL++L                 I 
Sbjct: 1601 PPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSIS 1660

Query: 1611 LVAAVGG---------GDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGR 1661
              A++ G           ++    +  +  K+   ++ ++ ++  V+  T+L +R + G+
Sbjct: 1661 RSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIINGK 1720

Query: 1662 VSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTIL 1721
             S+L EN K++T  A S V F+Q+ E+WLKH++ +L E  L+   + AT +     P + 
Sbjct: 1721 NSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPFVS 1779

Query: 1722 INNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRI-----KFKPKSKKRSQFV---GP 1773
            +N Q  +   RAM             R SV KIK ++     +FK    K S  V    P
Sbjct: 1780 LNCQATNSFIRAMP-------STVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSAVTKKTP 1832

Query: 1774 KINIVLSCY--FSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSH 1831
            +I I       F+++SSEIM LSPFY+  + KQL IY +   + E++L   + D ++ S 
Sbjct: 1833 RIPIKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQ 1892

Query: 1832 QTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQ 1891
             + EQ+ +FS  D++ K  ++ E   ++ V IS S++KLT  EPRR +++ LQDE+   +
Sbjct: 1893 LSSEQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVE 1952

Query: 1892 GINXXXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVPVASTYFVFELHMLL 1951
             ++                     +P+R   W LD ++ YFG+LVPV+S  ++FELH L 
Sbjct: 1953 SVDHIQKLWNFLRSA---SGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLF 2009

Query: 1952 LSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQ 2011
             SLTN N      +   +GQ  +E+   L+KE SLP  LSK+LDFSI+  T Q+  ++ Q
Sbjct: 2010 ASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQ 2069

Query: 2012 SFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEIP 2071
            S+Q+ESS+FR+CL P+ L+ ++W  H L  L +++ + H P  W +   + K+ K  E  
Sbjct: 2070 SYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGEST 2126

Query: 2072 INFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGN 2131
            ++FRSIHILSY FC+GWLF+ G  S+PGL+LGY+RLFSAYEK FGK T++D + SVANGN
Sbjct: 2127 LDFRSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGN 2186

Query: 2132 KSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVID 2191
             S TF+S+ +EKD Y R++L NMQI YW K    LKD F RFHGE +DV F+ +   +++
Sbjct: 2187 TSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVE 2246

Query: 2192 STLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYD 2251
             TL S++ F E+KK  +  +  S     N      ME+ASN+LAPFL +IR++NS   + 
Sbjct: 2247 KTLHSIKRFNEMKKAKIKQTGSSTKSKLN------MEAASNTLAPFLAHIRTINSQLNFA 2300

Query: 2252 GGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYA 2311
            GGVF+VY+  ++++K+EP  EIKSP V +   Y+ NE   K H IR    ++PT N L+A
Sbjct: 2301 GGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFA 2360

Query: 2312 GCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSL 2371
             CAPLL +F+ +++ MI+  S++DK   +KP + ++DYK LL+ +D+A ++ S KQ+LS 
Sbjct: 2361 KCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSF 2420

Query: 2372 SCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVG 2431
            SCEPKAKVQ D GF SFLF +TT++ DS +P   S ++ + ++S+RHIFSR+ S +F + 
Sbjct: 2421 SCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLD 2480

Query: 2432 FMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSIS 2491
            ++D+ ++FT+P+V   YG +LVSD++++ N+KQ QNL +FLDIWR S+   T+P +    
Sbjct: 2481 YIDIVMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAE 2537

Query: 2492 KEIDMSSLTSTNYVDVGAE----IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATD 2547
             + D     S  +     +     PW FT+IFTN+ G VDLGPSLGV++L  ++ W+ T 
Sbjct: 2538 DKSDAKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTK 2597

Query: 2548 HYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNID 2607
            H  ++++  H F  G+++ SEGRLSG+FE+  AS +SE+ W  E      PL+S S+ I+
Sbjct: 2598 HQGDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAIN 2657

Query: 2608 DVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANI 2667
             +++K+AFDYHMFLIG++ +++  LHNE D   ILPDLLQVS   + I L +TAL AAN 
Sbjct: 2658 RMSIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANA 2717

Query: 2668 LDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQ 2727
            LDIYNTI+RM+QDN+ISY+ETL++SN   S   + Y+++L SL LLRTD+S+ +  LKV 
Sbjct: 2718 LDIYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVH 2777

Query: 2728 ISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGAS 2787
            ISP+SLFD EVLVV +++V+ RSET SG+KLKT+LQLQ+ DV+A+LS+SKEELDEE  + 
Sbjct: 2778 ISPMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSK 2837

Query: 2788 IAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPV 2847
            IA+DDY+ YASK  GGTII +P+L V MTT Q++ +  +EYLF C F DKIS+KWNLGPV
Sbjct: 2838 IAVDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPV 2897

Query: 2848 NFIKEMWTTHVKALAVRQSQIANVSFGQXXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQ 2907
            NFIKEMW THV++LAVR++Q+ N S                    F Y+ L+EP I++PQ
Sbjct: 2898 NFIKEMWATHVRSLAVRRTQLGNSS--PELEVANESDKEDTVKSKFIYVPLDEPYIEMPQ 2955

Query: 2908 IRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2954
            I+DLGDATPP+EWFGV+RK  P  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2956 IKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2668 bits (6916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1367/3029 (45%), Positives = 1935/3029 (63%), Gaps = 111/3029 (3%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            ME  SQ   + L  +K FSWVFL  W+LT +  LT+IFY+ R++  + TFIL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------ 114
             +KIN+E++RVS LGG +  K++S+I++D+T+S LE  + W+YWLLN R+ E        
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 115  --------ENNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEK 166
                     +N  ++ KN KLPC   +EC+G E+F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 167  YLNEHSFPESFSDGSSADKLDEDLSESAYTTNS-DASIINDRDYQETDIGKLPKFLKFLP 225
            +LNEH   +  S+ ++ + +D+D  ES  T NS ++++INDR Y++    +      FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 226  IELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIK 285
            I+L+   G++ LGN+FTPS+++ SYEN  GV+DV    E++DLY++K  M+F++  IS+K
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 286  QNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIV---XXXXXXXXXXXXXXXXXXSFFQK 342
             N+ YD     +  +D GK+S++W TF+ ++ ++                      F  K
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 343  WKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAH 402
            W+GLSLYK    DA    LD+  +DF N EYAKF+SILKCP  T++Y +D  G VPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 403  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVK 462
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   P+K
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 463  KLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFC 522
            KL PGSRRI+T+F+M+V I+++++WRIPTRE SKD EF++ + +T++++RPFGW+D    
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 523  KDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNS 582
            K T A FN  L PT++G  NNF +HF++ E+ +SVNHDILLKSK F++  DIGYPLGWNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 583  KAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIY 642
            +A W  ++ ++QLE FLL+EHI+L +D  SDF++ +PTPYELFRPF Y +NW++EGYSIY
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 643  LNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLN 702
            LNVND NIVNNPLDFNENCYLSLHGD L+ID  +P   I   YT+I++ I TPMFR++LN
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 703  TPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVM 762
            TPPWNTL+EFMK KEVGRA+DF ++GSYL+YS+LDIDNVDT+ +ECTS ST L CYG V+
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 763  RYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSS---- 818
            RYL NV+ NYFG+F +F+TSEEY+ +L          + S      +  S  QNSS    
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGS---FTYSTTSSVQNSSSDDT 837

Query: 819  ---LKNESEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELV 875
                K +   K  V+R+D+ RT NE DIWFTF VW+GALILPE +Y+ + C +L F+EL+
Sbjct: 838  VLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELM 897

Query: 876  VDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRM 935
            + FR  NYYMD +  L    I R ++   +E+F ++R  +      HGTLSD+TIH HRM
Sbjct: 898  ISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRM 957

Query: 936  FGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDD 995
            FGLPP + TYFCQW I+ G L IDS+IEF+  FF  F K+GFGY++LEN L+Y  E+ DD
Sbjct: 958  FGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDD 1017

Query: 996  MTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSC 1055
            MT LT++ E++ I  +D V + Q+ +    L    IDF+NERYS+RI++KIP+  IS+  
Sbjct: 1018 MTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFD 1077

Query: 1056 VMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDS 1115
            V    +    L F+TK+ FTNF   +D     + QR YIT HDSPYHRC F+LP  YQ+S
Sbjct: 1078 VRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQES 1137

Query: 1116 DTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFA----ET 1171
              Y +LYG                     F++ED + EY+ LLE  NPF +I +    +T
Sbjct: 1138 FLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLDT 1195

Query: 1172 PSTVEPSRASS---------TEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLD 1222
             S     R  +          E+ N    DP             ++  NY+++V YI +D
Sbjct: 1196 SSLFNEYRVDTYISEKAIFKAEEKNTVNYDP------------KYEYDNYILNVEYIRVD 1243

Query: 1223 VDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIW 1282
            ++PL   F  S+  + YSE+MV ++D+IE+ IV++L + ++ +   +N+ + I+Y+++ W
Sbjct: 1244 INPLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFW 1303

Query: 1283 QETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDR 1342
                 EG E+YLD++D++M ++  +      L E   L+++K++R + ++ +  ++  +R
Sbjct: 1304 GSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYER 1363

Query: 1343 PPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSF 1402
            PPALSL +EG EVWS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q         S 
Sbjct: 1364 PPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSV 1423

Query: 1403 HSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRL 1462
              +Q   ++ +  LISKLT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRL
Sbjct: 1424 DLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRL 1483

Query: 1463 RHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFS 1522
            RHIL YLP+ W+ +    ++ R   S  D KN+F+SVFS WRNWE SDVARSYIY ++F 
Sbjct: 1484 RHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFL 1543

Query: 1523 VDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLT----PPVTSLS 1578
             D    ++NL+    K  M SFY T+Y + Y V+HN V+   N+++D       P  + +
Sbjct: 1544 PD---IEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATA 1600

Query: 1579 LNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKAELSKQFKMNTVLL 1638
               ++  +ITG VG+ KG+  D+L++L+ L     A    +KS     + K FK+N VL+
Sbjct: 1601 NKNDKIYDITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLI 1659

Query: 1639 VDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILC 1698
            V+K E+ L    TKL+SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH  +IL 
Sbjct: 1660 VEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILL 1719

Query: 1699 EAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRI 1758
            +A L D  I    E    KPTIL+N + + L F+A+                + KI  R+
Sbjct: 1720 DAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRL 1779

Query: 1759 KFKPKSKKRSQ----FVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGS 1814
              K   K+ +     F   KI+I       ++SSEI+ LSPF ++H  K+L I FN+ G 
Sbjct: 1780 TDKDNKKRHTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGD 1839

Query: 1815 NEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSE 1874
            N+ + SI D D ++TS+Q   QY R S+ DI ++  ++     LI ++I  S+IKLT ++
Sbjct: 1840 NDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLAD 1899

Query: 1875 PRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPAR-MINWTLDTSITYFG 1933
            P++I NS LQDEK   Q +                       P + M+N+ L    TYFG
Sbjct: 1900 PKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDL----TYFG 1955

Query: 1934 ILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKL 1993
            +L PV ++YF+ ELH LL + +N        + K+T   +++N LF+IK   +   +SK+
Sbjct: 1956 LLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKV 2015

Query: 1994 LDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPN 2053
            LDFS+ +ST  + +++++SF+VESSHFRVCL+P+SLL+++ G  +      YY       
Sbjct: 2016 LDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQ 2075

Query: 2054 IWDIKMFTG-KSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYE 2112
            I+  K      S+     P+   SIH LSY FCIGW+F+    S PGL++GY+RLFSAYE
Sbjct: 2076 IFKTKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYE 2135

Query: 2113 KDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFR 2172
              +GK TVVD FFS+ANG  S TF+S+GNEK+KYNRS+LPN+QI YW K    +K  F R
Sbjct: 2136 DSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVR 2195

Query: 2173 FHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNI---LDVSEDSHMEDDNPYATSSMES 2229
            F+GE +DV F+ +F  +I+ T++SV+ FQ +KK     ++V  +  + +D+         
Sbjct: 2196 FYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDD--------- 2246

Query: 2230 ASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNEN 2289
             S   + F   ++ +N    YDGGVF VY        +E + EI +P V I+  YK+  +
Sbjct: 2247 ISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRID 2306

Query: 2290 EAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDY 2349
              KPH IR  I ++PT NTL +  A  L EF ES+ +M+ K S  ++P   K  S  +DY
Sbjct: 2307 MKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDY 2366

Query: 2350 KRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTL 2409
            KR+L+ FDV+  +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D  +PL  SLT+
Sbjct: 2367 KRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTV 2426

Query: 2410 QQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLY 2469
               K SI H FS E + SF V F+D+T LFTHPD+   YGT+L+SD+S++FN+KQLQNL 
Sbjct: 2427 NDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLM 2483

Query: 2470 LFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLG 2529
            +FLDIW    ++  RP +    K+ +    +ST        IPW FT+I T+++GD+ LG
Sbjct: 2484 VFLDIWNLKRLIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLG 2543

Query: 2530 PSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWS 2589
            PSLG +SL+ ++ W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SWI  V++ 
Sbjct: 2544 PSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYV 2603

Query: 2590 LEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVS 2649
              +  +  PLV  +LN+++VAVKAAFDYHMFLIG ++NI F L +EKD  G LPDLL++ 
Sbjct: 2604 ENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLH 2663

Query: 2650 FSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRS 2709
               DEI + STALVA+NILDI NTI R RQD++ SY+ETL +SNP   K  I Y DIL+S
Sbjct: 2664 LVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKS 2723

Query: 2710 LKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDV 2769
            L LLRTD+ + I  ++VQISPISLFDVEV+V  ++NVS RS T SG+KL TDLQ+++   
Sbjct: 2724 LNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKA 2783

Query: 2770 SAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYL 2829
            + +LS S EELDEE  + I++DDY+ YA K+ GG I+ IPKL V MTT Q E +  IEYL
Sbjct: 2784 TLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYL 2843

Query: 2830 FACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQ-------------- 2875
            FAC F DKISV+WNLGPVNFIKE+W THVK+LAVR++Q+      Q              
Sbjct: 2844 FACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVS 2903

Query: 2876 ---------XXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRK 2926
                                      F Y+ L+EPQI++P+I+DL DATPP+EWFGVNRK
Sbjct: 2904 SEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRK 2963

Query: 2927 RFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            +FP+ THQTA+I +QK+V++A+K+Y K+L
Sbjct: 2964 KFPRVTHQTAIILIQKIVHVAQKEYAKVL 2992

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2360 bits (6117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1187/2579 (46%), Positives = 1679/2579 (65%), Gaps = 63/2579 (2%)

Query: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTL 474
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 475  FRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLC 534
             +++V IMED++WR+PTRE SKD +FL+ Y +T++  R FGW DL F +++ A F +   
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 535  PTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQ 594
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN +  W     S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 595  LEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654
            LE F LREH+ L+ADT SDFS+GEPTPYE FRP +YKV+W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 655  LDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMK 714
            LDFNENCY+S+HGD  +I + +PR  I  TYTDI ++ISTPMFR++LNTPPWNTLNEFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 715  HKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFG 774
            +KE+GR YDFT +GSY++YS+LDIDNVD+L IEC++    L  YGFV+ YL NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 775  EFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLD--SGYQNSSLKNESEDKD----- 827
            EF +F+T+EEYT ++   +  +I++  +   + S  +  S   NS    ++  K      
Sbjct: 950  EFSHFITAEEYTDIVRGND-NDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNIIDP 1008

Query: 828  ----PVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNY 883
                P+++ D+KR  NETDIWFTFSVW GAL+LPE +Y+ DPCIAL F EL++DFR+C+Y
Sbjct: 1009 LYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDY 1068

Query: 884  YMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEP 943
            Y+D++A LNGTS KR + K  N++F+ +  N   N +EHG++S+++IHGHRM+G PPT P
Sbjct: 1069 YLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSP 1128

Query: 944  TYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHA 1003
            +YF  W +++ +L+I+SDI FI+GF +   K+GF +++L+NILLYD   +D+MTS+TVH 
Sbjct: 1129 SYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHG 1188

Query: 1004 ERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVD- 1062
              I I   D    +Q ++  + + F  I+F N+RYS RID+++P L  +     G  +D 
Sbjct: 1189 TGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF-FDNGSSMDK 1247

Query: 1063 TSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLY 1122
            T   +F+TK+ FTNF Q KD +    +Q+ +I  +DS +HRC FLL    Q+S  Y +LY
Sbjct: 1248 TCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELY 1307

Query: 1123 GXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETP--STVEPSRA 1180
            G                     FII+D +G +   + +T     I   TP  S+ +P + 
Sbjct: 1308 GGITPSSSVPPLPIPVQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHSSNKPLKP 1365

Query: 1181 SSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYS 1240
             S+         P+E         ++   GNY+ID+SYI LD++PL F +  + L EFYS
Sbjct: 1366 PSS-----SVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASNFLDEFYS 1420

Query: 1241 EDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQ 1300
            E++++ +D IE+ IV +L    E + S++NI + I Y++  + +   EG ELY+D+ID +
Sbjct: 1421 ENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLE 1480

Query: 1301 MSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTE 1360
            +S+K+ +K  T  L E+A L+R  ++R ++N+K+  +  ++RPPALSL LEG+E WSST 
Sbjct: 1481 VSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTA 1540

Query: 1361 DRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKL 1420
              QVNSLN++S+DIT+DESQ+EWL +Y +     + E +NS  SIQ      + +L+S L
Sbjct: 1541 SSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDL 1600

Query: 1421 TAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKV 1480
            T ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++++ 
Sbjct: 1601 TLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEE 1660

Query: 1481 LKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCT 1540
            ++ +      D+ +IF++VFS WRNWE SDVARSYIY K+F  ++    +  ++  +K  
Sbjct: 1661 MRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLN 1720

Query: 1541 MGSFYLTVYGEGYEVEHNFVIADANLVVDLT------PPVTSLSLNREETIEITGRVGSV 1594
            + S + T+Y  GY ++HN ++  A ++++LT      PP+    LN      +TG +GS+
Sbjct: 1721 LNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILN------MTGSLGSI 1774

Query: 1595 KGKFSDRLLKLQDLIPLVAAVGG----GDKSDAKAELSKQFKMNTVLLVDKSEIQLVMDQ 1650
            KG+FSD+ L+L +LIP  +         + S   +E S  F ++  LL +   +QL M  
Sbjct: 1775 KGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGD 1834

Query: 1651 TKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILAT 1710
            T L +    G++S L E    S   + S   + +KSE+ LKH   I+ E QL    +++T
Sbjct: 1835 TTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLIST 1894

Query: 1711 TEAWSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRE---SVLKIKDRIKFKPKSKKR 1767
                   P ILIN + ADLHF++++             E    + K  D  K+  K  K 
Sbjct: 1895 GIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKV 1954

Query: 1768 SQFVGPKIN--IVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTD 1825
             Q    KIN  + ++C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  E+LLS+WDTD
Sbjct: 1955 DQ-KPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTD 2013

Query: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885
             F+TSH TKEQY RFS+ DI+I      E   ++ V +S S++KLTFSEPRRI  SFLQD
Sbjct: 2014 IFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQD 2073

Query: 1886 EKL---ASQGINXXXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVPVASTY 1942
            E++   + Q +                             W L+ +I YFGIL+P+AST+
Sbjct: 2074 ERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTF 2133

Query: 1943 FVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVST 2002
            FV ELHMLL SLTNT   +     +++GQ S+ENILFLI +RSLP+ LSKL+DFSI++ST
Sbjct: 2134 FVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRIST 2193

Query: 2003 LQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMF-T 2061
            LQ+T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L +   YY        W++    T
Sbjct: 2194 LQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKT 2253

Query: 2062 GKSDKPKEIPIN-FRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTV 2120
            G      E P+N FRSIHILSY FCIGW+        PG M GY+RLFSAYEK++GK T+
Sbjct: 2254 GTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTL 2313

Query: 2121 VDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDV 2180
            ++ + SV N N S+ FFS+G EK+++NRSFLP+MQI YW K     KD F R HG+ALDV
Sbjct: 2314 IEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDV 2373

Query: 2181 NFVPSFMDVIDSTLQSVRAFQELKKN--ILDVSEDSHMEDDNPYATSSMESASNSLAPFL 2238
            + + +F+++I+   +S + F++ +K+  + ++ +  H E          E+A+  +  FL
Sbjct: 2374 DILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEH------IKSENATEFVPTFL 2427

Query: 2239 DNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRI 2298
             +I S+N  FKY+GG  RV++ DD+E  S PS E+ +P V+I   YKH ++  KPH +R 
Sbjct: 2428 SDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLRC 2487

Query: 2299 LIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQFDV 2358
            +I +  + N LY+ CAP ++EF ES+Q++++    + K S +K ++ N  YKR+L  FD+
Sbjct: 2488 VIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFDI 2547

Query: 2359 AVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRH 2418
            A ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L + +   S++H
Sbjct: 2548 AFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQH 2607

Query: 2419 IFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFS 2478
            IFS+E S SF + F+DLT +FT P   ++Y   L+SD+ +FFN+KQ QNL LFLDIW  S
Sbjct: 2608 IFSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHLS 2664

Query: 2479 SILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLR 2538
              +  RP +     +              G  IPW F +IFTNV+ D+ LGP+LG++S +
Sbjct: 2665 ESIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAK 2724

Query: 2539 TQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHP 2598
             ++TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV ++  +   + P
Sbjct: 2725 LEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSP 2784

Query: 2599 LVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLS 2658
            +V+  ++I  VA+K AFDYHMF+I  +NNI F+LH+E+D +G LPDLL  +   +EI++ 
Sbjct: 2785 IVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISIC 2844

Query: 2659 STALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLS 2718
            ST LVA+NILDIYNTI+R RQD K SY ETL +SN  +++  I Y DIL+SL LLRTD+ 
Sbjct: 2845 STTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQ 2904

Query: 2719 LNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKE 2778
            +++S L++QISPISLFD EVLV+ I N+S RSET S  KLKT L+LQV + S ALST+KE
Sbjct: 2905 IDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKE 2964

Query: 2779 ELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKI 2838
            ELDEE    I++ DY+ YASKI GGTI+ IPKL V MTT Q+  +N IEY F C F  K+
Sbjct: 2965 ELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKV 3024

Query: 2839 SVKWNLGPVNFIKEMWTTHVKALAVRQSQIAN--VSFGQXXXXXXXXXXXXXXXXXFNYI 2896
            SV+WNLGPVNFIKEMW THVK+LAVRQ++I        +                 F Y+
Sbjct: 3025 SVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYV 3084

Query: 2897 ALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            AL EP I++PQI+DL DATPPMEWFG+NRK+FP FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 3085 ALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143

 Score =  188 bits (477), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 126/172 (73%), Gaps = 9/172 (5%)

Query: 9   GVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKINVET 68
            V L+ +K FSWVFLV WILT ++CL M FY+ R++AY +TFIL+WLLW+   +KI+ E+
Sbjct: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCES 68

Query: 69  LRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKA--ELIENNKD------- 119
           +R+SLL  RI FK+L +I ++ TIS+LEG + W+YWLLN R +  EL +  K+       
Sbjct: 69  IRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128

Query: 120 SLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEH 171
           S  KN++LPCKF  +CEG EIF+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 107/191 (56%), Gaps = 14/191 (7%)

Query: 221 LKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKE-RLDLYRNKTQMEFKN 279
           L F P  LK  +GS++ GNKFTPS++I+SY++ EG++DVLP    R+DLY+ K +++F+N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 280 FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXX--- 336
           FEI +K NI Y+D    K       +S+LW  F  +  I+                    
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 337 -------XSFFQKWKGLSLYK-AAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIA 388
                    F +KWKGLSLYK AA     P   + IEFDF NHEYA++ SI+K P+L   
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPE--EHIEFDFLNHEYARYCSIVKAPRLIFT 475

Query: 389 YDVDVSGFVPH 399
            + D+ G VP+
Sbjct: 476 NEYDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2290 bits (5935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/3063 (39%), Positives = 1820/3063 (59%), Gaps = 133/3063 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64
            ++   V L+ ++ FSWVFLV WIL VV   T +FY+ +++ + +TF  EWLLWK  NIK+
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCR--------KAELIEN 116
             +E++R+S L G I FK++ +I +D TIS+LE S+TW+YWLLN R        KA+  + 
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 117  NKDSL------------------------------------------------SKNVKLP 128
            N D +                                                +KN KL 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 129  CKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSD--------- 179
              F++ C G EIF+YNR  AY+ +I   SK+E+ +F  +L +H   + F +         
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 180  --------------GSSADKLDED-----LSESAYTTNSDASIINDRDYQETDIGKLPKF 220
                          GSS     E      +S  +   +SD S I++R+     I +    
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMR-KLH 304

Query: 221  LKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNF 280
            L  LP+++  N+G++ +GNKFT S++++++    G++D   P  +LD+++NK   E  + 
Sbjct: 305  LDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDI 364

Query: 281  EISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFF 340
            ++SIK+NIGY+  +  +F    G ++++W     VL ++                  +F 
Sbjct: 365  DMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFV 424

Query: 341  QKWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHG 400
            +KW GL LYK +   +     DD++FDF NHEYAK ++  K P++  + + D+ G VPHG
Sbjct: 425  KKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHG 484

Query: 401  AHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKP 460
            +HP +    GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV+S+  KP
Sbjct: 485  SHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKP 544

Query: 461  VKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLR 520
            + KL PG  R++++F  +V +++D++ R+PTRE SKD++FL+ Y ET +++R FGW+DL 
Sbjct: 545  LNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLS 604

Query: 521  FCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGW 580
            F K +    N+ + PT  GF+N     F E E+ +SVNH++L KS   N+  +IGYPLGW
Sbjct: 605  FKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGW 664

Query: 581  NSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYS 640
            N    WI N+ S+QL+ FLLREHITL++D + DFS  EPTPYELFR F Y +N ++ GYS
Sbjct: 665  NDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYS 724

Query: 641  IYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMM 700
             Y NVND NI+NNPLDFNENCYLS HGD    +IT+P  S+   Y  ISYEI TPMFR+ 
Sbjct: 725  FYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLF 784

Query: 701  LNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGF 760
            LNTP WNTL+EFM++KE+GR++DF V G+YL+YSELDIDNVD+L I+  SNSTVL+C+GF
Sbjct: 785  LNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGF 844

Query: 761  VMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLK 820
            V++Y+ N + NYFG F  F+T+EEY+ ++    V + +   +  DL S ++   +  S+ 
Sbjct: 845  VIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGLQKMDSIT 902

Query: 821  NESED--KDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDF 878
            N+ ED  +  +KRSDL RT NETDIW  F V +GALILPE +Y+ D C++L F EL ++ 
Sbjct: 903  NDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINM 962

Query: 879  RSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGL 938
            R+CNYYMD+   L   ++ R      +E+F++I+  N ++  E G +SD+TIHGHRM+GL
Sbjct: 963  RTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMYGL 1021

Query: 939  PPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTS 998
            PP E TYFCQW IN+G   IDSD+ F+  F  S  KIGF  ++ EN LLY+++TV+DMT 
Sbjct: 1022 PPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTL 1081

Query: 999  LTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMG 1058
            L+V  E +K+  +DP++++++ + A S++   IDFENE+Y++R+DV   +   SL  +  
Sbjct: 1082 LSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKI 1141

Query: 1059 DGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTY 1118
            D    + L   TKL  TNF +  +       QR++I  HDSPYHRC FLLP  +Q+S +Y
Sbjct: 1142 DSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSY 1201

Query: 1119 QKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPS 1178
            ++LYG                     FI+E I+ +Y+  L       D   +     E +
Sbjct: 1202 KELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFL-----LSDHHNQMSINAELN 1256

Query: 1179 RASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEF 1238
               +T   +        F+ I  TE   ++  N+V++V Y+ + V+P +    +    EF
Sbjct: 1257 SVDTTPLKDSFDMQITNFQNILTTEDP-YETDNFVVNVKYLTVTVNPDIVFTIEKFSTEF 1315

Query: 1239 YSE-DMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRI 1297
              +  M   +D IE+ IV +LS+L+E I+S  N+++++  ++  W          Y++ +
Sbjct: 1316 NKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINML 1375

Query: 1298 DYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWS 1357
             +++S++S   N      ++  L + ++VR+ +        S+DRPP LSL LEGFE WS
Sbjct: 1376 KFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWS 1435

Query: 1358 STEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELI 1417
            ST  +Q+ +LNLTS DIT+DE Q+ WL  Y   Q  L  +  +S   I   + S +   I
Sbjct: 1436 STTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFI 1495

Query: 1418 SKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNI 1477
            + L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTYLP+DW+D +
Sbjct: 1496 TSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRL 1555

Query: 1478 EKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLL 1537
            ++    ++    K+A + F++VFS WRNWE SD+ +SYIY  +F     E  + +++  +
Sbjct: 1556 DEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQNSI 1612

Query: 1538 KCTMGSFYLTVYGEGYEVEHNFVIADANLVV-DLTPPVTSLSLNR--EETIEITGRVGSV 1594
            K  + +FY T+Y   Y  + NF+I  AN+++ +    V  + L R  EE +++  ++GS+
Sbjct: 1613 KVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIGSI 1672

Query: 1595 KGKFSDRLLKLQDLIPLVAAVGGGDKSDA-KAELSKQFKMNTVLLVDKSEIQLVMDQTKL 1653
            K +F++ +LKL+  I  +       KS+  K  ++K FK+N   + D  +       + L
Sbjct: 1673 KFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNSSL 1732

Query: 1654 MSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEA 1713
             SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+R+     T E 
Sbjct: 1733 KSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTAEL 1792

Query: 1714 WSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRI--------------- 1758
             S   +++IN +C++LHF+++             +  V  +   I               
Sbjct: 1793 HSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTEHT 1852

Query: 1759 -KFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEV 1817
                 K+K +      K NI LS  F+NVSSEI  L P Y++HE   ++I +N    +E+
Sbjct: 1853 PSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDEL 1912

Query: 1818 LLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRR 1877
            L+ + DTD ++ S  TKEQY R S+  +E+   +   +  LI+++IS S++KLT S+PRR
Sbjct: 1913 LVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDPRR 1972

Query: 1878 IVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVP 1937
            ++ SFLQDEK     +                      +      W ++    Y G+L+P
Sbjct: 1973 MLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYE---WIVNFKSKYMGVLLP 2029

Query: 1938 VASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFS 1997
            + +TY+VFELH  L +++N          K  G  S ++I+FLIK++S+P   SK+LDFS
Sbjct: 2030 IQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDFS 2089

Query: 1998 IKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPN--IW 2055
            IK+ST +   + ++SF++ESS FRVCL+P SL++ MWG ++LL L + Y  +   N  ++
Sbjct: 2090 IKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNFFVF 2149

Query: 2056 DIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDF 2115
            +     G ++  KE   + RS HILSY F IGWL+Q    + PGL+LGYNRLFS YE + 
Sbjct: 2150 NDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDNH 2209

Query: 2116 GKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHG 2175
            GK T+VD FFS+ANG+   TF+S G+E  K+NRS+LPN+QI YW K   ++K  F +FHG
Sbjct: 2210 GKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFHG 2269

Query: 2176 EALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLA 2235
            E LDVNF  +F+++I+ST++S+  FQ LK+  ++    +  E D      S  + +N   
Sbjct: 2270 ETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDE----KSNSALTNIKG 2325

Query: 2236 PFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHR 2295
            P    ++ VN  F YDGG+FR+++   +  K EP+  IKSP V I  +Y + E E K H 
Sbjct: 2326 PIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHW 2385

Query: 2296 IRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRLLDQ 2355
            I  LI ++PT N L +GC P L +F   ++ +++    + + +        ++   LL+ 
Sbjct: 2386 INCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITSLLEN 2445

Query: 2356 FDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKAS 2415
            FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   PL+ SL +   K S
Sbjct: 2446 FDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTS 2505

Query: 2416 IRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIW 2475
            ++H FS E S SFEV  +D+ L+FTHP+V   +GT LV D+ + FN+KQ QN+ +FLDIW
Sbjct: 2506 VKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIFLDIW 2562

Query: 2476 RFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVI 2535
              S     +  +   +  +D  S      +   + +PW F  I TN++GD+++G +LG +
Sbjct: 2563 DVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNL 2622

Query: 2536 SLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKN 2595
            +L  QRTW++TDH+  KRQLLH FTD V ++SEGRL G  E+ + +W  +V +  +    
Sbjct: 2623 ALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFV 2682

Query: 2596 SHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEI 2655
              PLV    ++  V++K AFDYHMFLI T+ +++F + +EKD   ILPDLL V+ + DEI
Sbjct: 2683 VSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEI 2742

Query: 2656 TLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRT 2715
             + +TALVA+NILDIYNTI+R RQDNK SY+ETL +SN    K+  LY+DIL+SL LL+T
Sbjct: 2743 KVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQT 2802

Query: 2716 DLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALST 2775
             LS NI  L +QISP SL+D EV+++R+++V   +ET +G+K+KTDL+++V + + +L++
Sbjct: 2803 SLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTS 2862

Query: 2776 SKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFS 2835
              +EL EE  A ++ + YI YAS +  G I +IP+L ++MTT Q      ++Y ++CSF 
Sbjct: 2863 FGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFD 2922

Query: 2836 DKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXXXXXXXXXXXXXXFNY 2895
             K+ V WNLGP+NFIKE+W THV++L VR  Q    +                      Y
Sbjct: 2923 GKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMG-NHDISLENEGDTDESVKVLSNIEY 2981

Query: 2896 IALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            IALEEP I++PQI+DL DATPP+EWFG+NRK FP  THQ+ ++P+QKLV +A+K+Y K+L
Sbjct: 2982 IALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVL 3041

Query: 2956 DGT 2958
              +
Sbjct: 3042 GSS 3044

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2185 bits (5662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1217/3055 (39%), Positives = 1789/3055 (58%), Gaps = 161/3055 (5%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M+A SQ + +P++ + +FSWVFLVDW+L VV+ L+++FY GR  AY +T +++W+LW+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120
             +KIN+++L++S LGGR+ FK+L+VI KD TIS L+GS TW+YWLLN RK  L E  K  
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  LSKNVK---LPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESF 177
              K+ K   L C+F LE +G E+FIYNRTVAYD ++  ++KD+++ F+K+       E  
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFF------EGG 174

Query: 178  SDG--SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSL 235
             D   SS +KL ED + ++ ++ S+    NDR++QE D   +   L+FLPI LK NRG++
Sbjct: 175  EDSLHSSEEKL-EDETLASDSSVSNVDSTNDRNFQEQDSRSM--LLQFLPIHLKVNRGAV 231

Query: 236  LLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIG 295
            LLGN  TPSVMI+ YE+ EGV+DV    E+LDLY+ +  ++F N ++ IK NI + D   
Sbjct: 232  LLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENP 291

Query: 296  LKFKLDTGKVSKLWKTFVRVL-RIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKA--- 351
            +K  +   ++S++WK F ++    +                   FF+KW+GL+LY     
Sbjct: 292  IKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNV 351

Query: 352  -----APGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIP 406
                 + GD +  + +++  D  NHEYAK+T ILK  K+ + Y  D+ G VPHGA  T+ 
Sbjct: 352  TTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTME 411

Query: 407  DIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPP 466
              DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR + P+KKL P
Sbjct: 412  QRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTP 471

Query: 467  GSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTY 526
            GSRRIYT F ++VL+MED  WRIPTRE+SKD +FL+ Y+E+  + RPFGW+D++  K+T 
Sbjct: 472  GSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETD 531

Query: 527  ANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIW 586
                V +CPT+ GF+N    H V+ EIRSSVNHDI  K+    +  D+GYPLGWNS+A W
Sbjct: 532  LFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQW 591

Query: 587  IINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVN 646
            +    S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W ++ YSIYLNVN
Sbjct: 592  VFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVN 651

Query: 647  DHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPW 706
            D NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W
Sbjct: 652  DANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSW 711

Query: 707  NTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLT 766
            +TL+EFMK+KEVGR+YDF + GSY  +S++D+ N+DT++IEC S  T L C GFV+RYL 
Sbjct: 712  STLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLM 771

Query: 767  NVKMNYFGEFFNFVTSEEYTGVLGAR---EVGEIITKSSVLDLASTLDSGYQNSSLKNES 823
            N+ MNYFG+F +F T+EEYT  L  +      E+I   +V D +S + S    ++ K  +
Sbjct: 772  NINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIA-DNVSDESSQMSSTSFVTNDKETT 830

Query: 824  E------DKDP-VKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVV 876
            E      ++DP VKR+DLKR  NE D+WFTF V +G L+ PE IY    CI LHF  L V
Sbjct: 831  EYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDV 890

Query: 877  DFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMF 936
            D R  NYYMD+ A L+ T IKRH       +FD +R   G  +   G LS+L IH HRMF
Sbjct: 891  DLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMF 950

Query: 937  GLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDM 996
            GLP  E TYFC+WD  +G L IDSDI+F KG   +F KIGFGY D EN+L+Y+     DM
Sbjct: 951  GLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDM 1010

Query: 997  TSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIP--KLIISLS 1054
            TSLT+  + I     D        +  + +  ++IDFENERYS ++  KIP  KL++S  
Sbjct: 1011 TSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEK 1070

Query: 1055 CVMGD--GVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFY 1112
                +  G+      FET L    F Q +D D  R+ QR +IT HDSPYHRC FLLP+ Y
Sbjct: 1071 SSKNEVQGL------FETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQY 1124

Query: 1113 QDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETP 1172
            Q +  Y KL+G                      I E ++G++    E  +   +   ET 
Sbjct: 1125 QKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSD-ANYSKETA 1183

Query: 1173 STVEPS---RASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFV 1229
             T E S   + S +     E +   +  P    E +  +  +++I++   ++ ++P    
Sbjct: 1184 ITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPK-FEYDSFIINLGKTIIAINPS--- 1239

Query: 1230 FTKSLLKEFYSEDMVQVLDDI----EIGIVKQLSNLQEGITSISNIDV------------ 1273
             ++  L   Y +  V  +DDI    EI IV++ S      ++++N+ V            
Sbjct: 1240 -SEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSP 1298

Query: 1274 ----HIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVT 1329
                 ++  + ++ E      +L   +I  Q +   LE        EV +  +  ++   
Sbjct: 1299 KGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKASSINFF 1353

Query: 1330 VNQKR-NPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYC 1388
            +NQ++  P       P  S+  E  E WS + +   NSLN  + D  ++ SQ+EWL +Y 
Sbjct: 1354 INQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYL 1413

Query: 1389 SDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKG 1448
                    +   SF   ++   + + ELI +   AS  Y I HD  VITKPA+I RLSK 
Sbjct: 1414 RAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKN 1473

Query: 1449 HVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEF 1508
            H+RENRSW+IITRLRHIL YLP  W    E+ LK+ ++    DA++ F+ +FS WR+WEF
Sbjct: 1474 HIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEF 1533

Query: 1509 SDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFVIAD----- 1563
            SDV + YIY ++F +  +  K  +     K  +     ++    +E E   V+ +     
Sbjct: 1534 SDVQKCYIYKRVF-LSRSMKKNRITGADFKVNLERISFSLSSSTHEDEDFMVVKNLKSVI 1592

Query: 1564 ANLVVDLTPPVTSLSLNREETIE---ITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGD- 1619
            +N +++ + P ++ +     + E   I+  + S++G   D ++KL  +   ++ +   + 
Sbjct: 1593 SNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSNLSDTNL 1652

Query: 1620 -----KSDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTS 1674
                 K D K +L     +  VLLVD+++  + +D  +L+ R+   R S   E +   + 
Sbjct: 1653 KTTSVKHDVKPKL-----IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMERVPSKSE 1707

Query: 1675 QAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAM 1734
               SL      SE W++H S +L E+ L+D ++  +   +       +  +   L   AM
Sbjct: 1708 TKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGGLSVSAM 1767

Query: 1735 SXXXXXXXXXXXXRESVLKIKDRIKFKPKSKKRSQF------VGPKINIV-LSCYFSNVS 1787
            +            + SV  I+  +      K  +           ++N V L    S  S
Sbjct: 1768 ASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFS 1827

Query: 1788 SEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIE- 1846
              I PL+PF I      ++++  K       ++I D D  + S ++K++YL+FS   +  
Sbjct: 1828 LNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNL 1887

Query: 1847 IKGGISKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXX 1906
            +     +++   +NV ++  + KLT S+PR  + S ++DE LA +               
Sbjct: 1888 VISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNF-----AQLKSLAE 1942

Query: 1907 XXPXXXXXXAPARM---INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLP 1963
              P      +  R    I W L  ++ Y GI+V + S  +V EL+ +L SL+N  +    
Sbjct: 1943 KFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKY 2002

Query: 1964 EEA---KVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHF 2020
             E     + G FSIEN+L LI    L   LSKL+D ++ +   Q   D  Q+ Q+ESSHF
Sbjct: 2003 LEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHF 2062

Query: 2021 RVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKP---KEIPINFRSI 2077
            RV L P SL +++W  ++   +   Y  R +       +   K   P    E+   FRSI
Sbjct: 2063 RVALCPMSLTKVLWAINEFTRVSEAYKTRSS-------LLQHKKTAPTDISELSNKFRSI 2115

Query: 2078 HILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFF 2137
             ILSY FCIGW+F  G+ +DPGL+ GY RLF+AY+K +GK T++DA+FS+A+G  S TFF
Sbjct: 2116 QILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFF 2175

Query: 2138 SEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSV 2197
            S G EKD++NRS+LP+MQI YWF + G+  + F R  GE LDVNF+ S + + +  ++S+
Sbjct: 2176 SNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSI 2235

Query: 2198 RAFQELKKNILDVSEDSHMEDDNPYATSS-----MESASNSLAPFLDNIRSVNSNFKYDG 2252
            + FQELKK ++D           P+AT+      + S +  L P L  IR+ N   KY G
Sbjct: 2236 QTFQELKKTMVD-----------PFATNKTTEKPVNSEAAPLDPILSKIRAFNCIVKYAG 2284

Query: 2253 GVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAG 2312
            GVF++++ +DI+  S+PSFE++SP V +   YKH  +  K H IR L+ VDP+ NTL+  
Sbjct: 2285 GVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPT 2344

Query: 2313 CAPLLMEFSESLQKMIKKHSTDDKPSFTKP-SSQNVDYKRLLDQFDVAVKLTSAKQQLSL 2371
            C P+L   ++ ++ M+K  ++  KP      SS  ++YK+LL  FD+A  +   KQ +SL
Sbjct: 2345 CVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISL 2404

Query: 2372 SCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVG 2431
            SCEPKAKVQADVGFE     M TN  D+ +PL  S+ ++  +A+ RHIFSREVSTSF++ 
Sbjct: 2405 SCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQID 2464

Query: 2432 FMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSIS 2491
             +D   + THP++I  YGT+LVSD+ ++FN+KQLQ+L LFLDIW+  S +   P  G+  
Sbjct: 2465 HIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTR 2524

Query: 2492 KEIDMSSLTSTNYVDVGA--------EIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTW 2543
                  SL+S + + V            PW +TLIF+N+ GD+DLGPSLGV+S+R  R+W
Sbjct: 2525 TR----SLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSW 2580

Query: 2544 LATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTS 2603
              +DH+ + RQ L  F + + L+S+GRL G   +    W SE+ W ++      PL+S S
Sbjct: 2581 AISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLS 2640

Query: 2604 LNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALV 2663
            L +  +A+K +FDYHMFLI  + ++  +L+NE+D  GIL DLL VS +  +I L  TAL 
Sbjct: 2641 LELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALA 2700

Query: 2664 AANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISS 2723
            +AN +DIYNTI+RMRQDNK SY+ETL+DSN   +K     +++L SL LLRTDLS+ I  
Sbjct: 2701 SANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDL 2760

Query: 2724 LKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEE 2783
              +Q+ P +LFD+EVLV++ +++S  ++T    K+KT L  Q+ +   +LS  K + +EE
Sbjct: 2761 FYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEE 2820

Query: 2784 IGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWN 2843
            I + I + +YI +A+K+ GGTI+  P + V MTT QE  +N IE L+  SF  K+ VKWN
Sbjct: 2821 IVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWN 2880

Query: 2844 LGPVNFIKEMWTTHVKALAVRQ---SQIANVSFGQXXXXXXXXXXXXXXXXXFNYIALEE 2900
            LGP+NFI+EMW THV+ALA+R+    +  N SF +                 + YI LEE
Sbjct: 2881 LGPINFIREMWATHVRALALRRVHDMRDKNKSFFE-DEHIEEKIKDVDLGNKYVYIPLEE 2939

Query: 2901 PQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            P+I++PQI+DLGDATPP+EWFGVNR+RFP  THQ+ V+P+QKL ++AE++Y ++L
Sbjct: 2940 PRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVL 2994

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1914 bits (4957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1079/3020 (35%), Positives = 1680/3020 (55%), Gaps = 128/3020 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64
            SQ + V L+  +DFSWVFLVDW+L + + L   FY GR++ Y +TF+LEWL WKR  +KI
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDSLSKN 124
            ++++L++S LGGRI FK+L+V+ ++ T S L+GS+TW+YWLLN RK    + +++     
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122

Query: 125  VKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDGSSAD 184
             KLPC+F +EC+GLE FIYN+T A+DN++N L +++ ++F+ +  ++S  +  +D  S D
Sbjct: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS--DKNTDECSVD 180

Query: 185  K----LDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240
            +        L  S  + +S +  +NDR +Q  D    P FLK LP+E    +G++++GNK
Sbjct: 181  EDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVVIGNK 238

Query: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
             + SVM+LSYE  +GV+D   P  ++DLY+ K + EF+ F IS+K N+  +    LK  +
Sbjct: 239  TSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFV 298

Query: 301  DTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSD 360
               K+SKLW    ++                      +  ++W+GL LY      A    
Sbjct: 299  KRSKLSKLWHRSYQLF-FKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWD-- 355

Query: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420
             D  +FD + HEYA++T ++KC  + + Y  D  G VPHGA PT   +DGPDVGN+G PP
Sbjct: 356  -DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPP 414

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480
            D+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR S+PV++L PGS+RIYT  R+++L
Sbjct: 415  DYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSIL 474

Query: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540
            I+ ++ WRIPTRE SKD EFL+ ++ET +E RPFGW+++   + +   FN+ +CPT  GF
Sbjct: 475  IVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGF 534

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600
             N   +HFV+ EIR+SVNHDILL ++  ++   +GYPLGWN KA W+ +  S Q + F+L
Sbjct: 535  DNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFIL 594

Query: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            ++HITL+ D +SDF +GEPTPYELFRPF Y  NW   GYSIYLNVND NIVNNP++FNEN
Sbjct: 595  KDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNEN 654

Query: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLS HGD L ++  VP+E+I G  T I+YE+ TP+FR+ +NTP WNTL+EFMK KEVGR
Sbjct: 655  CYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGR 714

Query: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            + +F++ GSYL +S+LD+DN+DT++IEC S ST L CYG+V+RY   VKMNYFG+F +F 
Sbjct: 715  SANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFK 774

Query: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPV--KRSDLKRTT 838
            T+EEY   L         T  S  ++        ++SS + E   KDP+  K++ LKR  
Sbjct: 775  TTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSS-QREQHIKDPLTAKKTSLKRMV 833

Query: 839  NETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKR 898
            NE D+WFTF V +G  ILPE +Y  D C AL F  L +D R  NYYMD+ A L+   I+R
Sbjct: 834  NEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRR 893

Query: 899  HVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTI 958
             +     EVF+   R     E   G LS L IH HRMFGLPP E TYFC+WD +LG L +
Sbjct: 894  LIDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDL 952

Query: 959  DSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQ 1018
             SD+ F  GF N++ K+GFG+ D ENI+ Y    + DMTS+T+  + I    +    ++ 
Sbjct: 953  SSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETA 1012

Query: 1019 SVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFE 1078
              + A+ +     D EN  YS R+D+ +  L  S+  +  +  + +   F T ++ +NF 
Sbjct: 1013 IQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKISNFC 1070

Query: 1079 QYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXX 1138
            Q +D+     +Q+ +I ++D+P+HRCPFL+PL  Q+S  Y+ L+G               
Sbjct: 1071 QLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPL 1130

Query: 1139 XXXXXXFIIEDIVGEYATLLETTNPFKDIFAE-TPSTVEPSRASSTEDDNDERADPLEFK 1197
                     E++   +   L+  N  KD      P     ++ SS+  D   +  P+   
Sbjct: 1131 QT-------ENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQPILDD 1183

Query: 1198 PIAFTEG---RNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGI 1254
              + +        +    V+++    L + P  +    + +++ + + + Q +D+IE+ +
Sbjct: 1184 NTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDV 1243

Query: 1255 VKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKL 1314
            V     +     +  NI V +  ++++++   +E       ++    ++ SL+ +    L
Sbjct: 1244 VLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGL 1303

Query: 1315 L---------EVATLARIKTVRVTVNQK--RNPDLSE-DRPPALSLGLEGFEVWSSTEDR 1362
                      +  +L +I+++ + V  K  +    +E D   A    ++  E WS     
Sbjct: 1304 KLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGI 1363

Query: 1363 QVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTA 1422
              +SL L S + ++   +  WL ++     N  ++ +N           ++ E   +++ 
Sbjct: 1364 ADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISK 1423

Query: 1423 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLK 1482
            AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP     +I   LK
Sbjct: 1424 ASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLK 1483

Query: 1483 ERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSV---DNAEHKQNLMKKLLKC 1539
              +Y     A+  F+ +FS W NW++SDV + Y+Y ++F+    D   H+ +      K 
Sbjct: 1484 NSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHESS-----TKI 1538

Query: 1540 TMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFS 1599
              G+F L  +        + ++   NL    T     L   ++E  E    + + +    
Sbjct: 1539 ETGTFMLNFFDSINTGSDSVIL--KNLKAQRT-----LEACKDEAAEKRSNMSNAEDDLE 1591

Query: 1600 DRL--------LKLQD--LIPLVA--------AVGGGDKSDAKAELSKQFKMNTVLLVDK 1641
            +RL        + L D  LI L++        A     K + K    +Q+      LVD+
Sbjct: 1592 ERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEKLPAFQQY----TALVDR 1647

Query: 1642 SEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQ 1701
             +IQL+    +   ++ G  ++++ EN K   + A S        E  ++H + IL +A 
Sbjct: 1648 CDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRNTILLDAF 1706

Query: 1702 LRDFSILATTEAWSHKPTIL-INNQCADLHFRAMSXXXXXXXXXXXXRES----VLKIKD 1756
             R  ++ A    +S K +   ++ +      +  S             ES     L +  
Sbjct: 1707 SRSSAVGA--HGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNNLRLALGP 1764

Query: 1757 RIKF--KPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGS 1814
               F  KP S   ++ V P+    L+   S+++++I  LS   I    K+L + + +  S
Sbjct: 1765 NTGFLEKPHSAA-TEKVAPQ--FALNIDISDLTTDISLLSSLAITKNFKKLTLAYEQSAS 1821

Query: 1815 NEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIK-GGISKEDYSLINVDISISMIKLTFS 1873
            + + L+    D  + S +T +QYL+ S  +I        K + S   V +  ++ KL   
Sbjct: 1822 SALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLY 1881

Query: 1874 EPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARMI--NWTLDTSITY 1931
            +PR I     +D   A   +                              +W     + Y
Sbjct: 1882 DPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNY 1941

Query: 1932 FGILVPVASTYFVFELHMLLLSLTN---TNNGMLPEEAKVTGQFSIENILFLIKERSLPI 1988
             G+L+P+ ST ++ EL+ +   +T    TN      +  + G  S  +I FLI +R LP 
Sbjct: 1942 VGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPE 2001

Query: 1989 GLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSR 2048
             LS+++DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++  ++L  L     R
Sbjct: 2002 ALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKR 2061

Query: 2049 RHAPNIWDIKMFTGKSDKPKEIPIN--------FRSIHILSYKFCIGWLFQYGAGSDPGL 2100
            +    +            P+ + +         FRS+ +LSY FC+GW+F      +PGL
Sbjct: 2062 QTVGKL------------PESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGL 2109

Query: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160
            + GY RLF+A+EK +GK T++DA+FS+A G+ S  F++  N  +  NRSFLP+MQI YW 
Sbjct: 2110 IWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWI 2169

Query: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220
            +  G   + F R +GE LDV F+   +DV    ++S+  F ELKK  +D  + S      
Sbjct: 2170 ESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFK-SVANPKR 2228

Query: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280
            P ATS+      S  P L  I+ V+   +Y GGVFR+Y+ DD++ ++ PSF+++SP V I
Sbjct: 2229 PSATSTF-----SKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEI 2283

Query: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340
               Y+   +    H +R  + V  + NT++  C P+L E +  +++++K  +   + +  
Sbjct: 2284 LFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNRSPQEASH 2343

Query: 2341 KPSSQ-NVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDS 2399
            K  SQ ++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE     + TN+ D 
Sbjct: 2344 KSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDM 2403

Query: 2400 EQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVF 2459
             +PL  S+ + +  A  RHIFSREVSTS ++  +    + THPD I  YG   + ++ V+
Sbjct: 2404 SEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVY 2463

Query: 2460 FNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSS----LTSTNYVDVGAEIPWCF 2515
            FN+KQLQ+L +F++IW+  S + T+P   S       S     +     V      PW F
Sbjct: 2464 FNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNF 2523

Query: 2516 TLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLF 2575
             LI + + GD+DLG SLGV+SL T R W  TDHYS+  Q L    + + L+S+GRL G  
Sbjct: 2524 ILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTL 2583

Query: 2576 EVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNE 2635
             + N SW+S ++W + +     PLV+  + +D+  +K +FDYH+ LI ++  ++ +L N+
Sbjct: 2584 LLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNK 2643

Query: 2636 KDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPG 2695
            +D +GI  +LL V+ SS+   L  TAL  ANILD+YNTI+RMR+DN+ SY ETL DSN  
Sbjct: 2644 RDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTK 2703

Query: 2696 ESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSG 2755
            +++     KDIL SL  LRT+L +++  + +QI P  LFD+EVL  + K+   +S+    
Sbjct: 2704 DTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGD 2763

Query: 2756 KKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHM 2815
            +KLKT L+ Q+  V  ALS  K +L E+  + I + +YI +A K  GGTI+ IP + + M
Sbjct: 2764 EKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGM 2823

Query: 2816 TTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQ 2875
            TT  +  TN +E L++ SF  KI ++WNLG +NF++EMW THV+A+A+R+S         
Sbjct: 2824 TTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFF 2883

Query: 2876 XXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQT 2935
                             + Y+ LEEP I++PQ +DLG+ATPP+EWFGVNRK+FP  THQ 
Sbjct: 2884 EDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQA 2943

Query: 2936 AVIPVQKLVYLAEKQYVKIL 2955
             ++P+QKL ++AE ++ +IL
Sbjct: 2944 MIVPLQKLAHIAETEWARIL 2963

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1899 bits (4918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1097/3011 (36%), Positives = 1664/3011 (55%), Gaps = 135/3011 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64
            S+ R VP++  +DFSWVFL DW+L + + L   FY GR+  Y +T ILE+L WKR  +K+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDSLSKN 124
                       GR+ FK+L+VI +D T S+L GS+TW+YWLL+ RK  L   ++    K 
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSE----KA 107

Query: 125  VKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE-----SFSD 179
             KLPC+F +EC+GLE FIYNRT A+DN+++ L +++++  +K+ ++ S P      S  +
Sbjct: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPS-PRATEETSTEN 166

Query: 180  GSSADK--LDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLL 237
             S+A K  L+  +S  + +T S    +NDR YQ  +   +P FL+ LP+E    +G+L++
Sbjct: 167  DSAAQKSHLETSMSSPSASTES----LNDRTYQLPN--SMPSFLRLLPLEYSVQKGALII 220

Query: 238  GNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297
            GNK T SVM+ S+E  +G +D   P  ++DLY+ K Q +   F++S++ N+ YD+   LK
Sbjct: 221  GNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLK 280

Query: 298  FKLDTGKVSKLW-KTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDA 356
                  ++ KL  K +   LR+                   +  ++W+GL LY     + 
Sbjct: 281  NLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWK---EN 337

Query: 357  KPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNN 416
             P+  D   F+   HEYA+++ ++KC  + I Y  D  G VPHGA PT+  +DGPDVGN 
Sbjct: 338  DPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNG 397

Query: 417  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFR 476
            GAPPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR S P ++L  GS R++T  R
Sbjct: 398  GAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLR 457

Query: 477  MNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPT 536
            ++++IM D+ WRIPTRE SKD +FL+ YKET ++ RPFGW++L   + +    N+ +CPT
Sbjct: 458  ISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPT 517

Query: 537  VEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLE 596
              GF N   +HF++ EIR+SVNHDILL ++  +++  IGYPLGWN+KA W  ++KS Q  
Sbjct: 518  STGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQAR 577

Query: 597  AFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLD 656
             F+L++HITL+ D LSDF  G+PTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+D
Sbjct: 578  MFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVD 637

Query: 657  FNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHK 716
            FNENCYLS HGD L I   VP++SI G  T I Y + TP+FR+ +NTP WNTL+EFMK K
Sbjct: 638  FNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDK 697

Query: 717  EVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEF 776
            EVGRA DF++ GSYL +S+LD++N+DT++IEC S  T L CYG+V+R+L  VKMNYFG+F
Sbjct: 698  EVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDF 757

Query: 777  FNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGY---QNSSLKNESEDKDPVKRSD 833
             +F T+EEY   L    V          +   T  +G    + ++ KN + D    K+  
Sbjct: 758  VHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLS 817

Query: 834  LKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNG 893
            LKR  NE D+WFTF V +G LILP+ +Y  + C A  F  L +D R  NYYMD+ A L+ 
Sbjct: 818  LKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSP 877

Query: 894  TSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINL 953
              ++         +F         +    G++SDL IH HRMFGLPP E TYFC+WD ++
Sbjct: 878  VIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSM 936

Query: 954  GDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDP 1013
            G L I SD+  I  F +++ K+ F + D ENI+ Y    + DMTS+  HA  I++  ND 
Sbjct: 937  GVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDV 996

Query: 1014 VMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFL-KFETKL 1072
             +    +V  E++    +DFENERYS R DV I  + +    V   G D S +  F + L
Sbjct: 997  AVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSLIGDFSSSL 1053

Query: 1073 RFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXX 1132
            + T F Q K+      +Q+ +I  +D+P+HRC FLLPL  Q SD Y+KL G         
Sbjct: 1054 KITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIP 1113

Query: 1133 XXXXXXXXXXXXFIIEDIV-GEYATLLETTNPFKDIFAETPSTVEPSRA--SSTEDDNDE 1189
                         I+++ + GE  +L      F     E       +    SSTE+D++ 
Sbjct: 1114 GMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNV 1173

Query: 1190 RADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDD 1249
             ++ L  K I                 S     + P      +S   + YS  + Q++D 
Sbjct: 1174 ESESLVVKLIK-------------PQASISACCIKPF-----RSFSDQAYSNFVEQLIDS 1215

Query: 1250 IEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLE-- 1307
             EI +V              N+ V      +     G +      D +D  + E S++  
Sbjct: 1216 NEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDIS 1275

Query: 1308 --------KNRTSKLLEVATLARIKTVRVTV-NQKRNPDLSEDRPPAL-SLGLEGFEVWS 1357
                     +  S + ++  L +++++ + V N  RN  L       L S  ++  E W 
Sbjct: 1276 MREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWM 1335

Query: 1358 STEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRIS-SKTEL 1416
            ++ED + +S N TS D  +   + E    +  +    I + +    S+   R+  ++ + 
Sbjct: 1336 TSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANI-DTITEVVSVHKERLQKAQRDF 1394

Query: 1417 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDN 1476
              +++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP      
Sbjct: 1395 FYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAE 1454

Query: 1477 IEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF--SVDNAEHKQNLMK 1534
            I   LK   + +  +A  IF+++FS WR+WE SDV + Y+Y K F    +      NL  
Sbjct: 1455 IYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRV 1514

Query: 1535 KLLKCTMGSFYLTVYGEG--YEVEHNFVIADANLVVDLTPPVTSL-SLNREETIEITGRV 1591
            ++  C+  +   + + EG    V+   ++    L  ++   + ++      +   ++  +
Sbjct: 1515 EVDSCS-ATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSL 1573

Query: 1592 GSVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKAEL--SKQFK-MNTVLLVDKSEIQLVM 1648
             +VK   S+  +KL     L  +    D       L   K  K M   LL+D+ EI++ +
Sbjct: 1574 KAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISL 1633

Query: 1649 DQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFSIL 1708
            D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A  R  S+ 
Sbjct: 1634 DSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLG 1693

Query: 1709 ATTEAWSHKPTILINNQCADLHFRAMSXXXXXXXXXXXXRESVLKIKDRIKFKPKSKKRS 1768
            +            ++     L  +  S             ES   +  ++KF  +SK  S
Sbjct: 1694 SFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLS 1753

Query: 1769 QFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFM 1828
              +     +    +  + +SEI  LSP  I    K L + F K  ++ + L + + D  +
Sbjct: 1754 PEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDL 1813

Query: 1829 TSHQTKEQYLRFSFGDIEIKGGI-SKEDYSLINVDISISMIKLTFSEPRRIVNSFLQDEK 1887
             S  T +QYL+ S   +E+   I  K +     + +  ++ K    +PR I+ +  QD  
Sbjct: 1814 LSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLV 1873

Query: 1888 LASQGINXXXXXXXXXXXXXXPXXXXXXAPARMI---NWTLDTSITYFGILVPVASTYFV 1944
             A Q +                        A  +    W     + Y G+LVP+ +T ++
Sbjct: 1874 NAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYI 1933

Query: 1945 FELHMLLLSLTNTNNGMLPEEAK-----VTGQFSIENILFLIKERSLPIGLSKLLDFSIK 1999
             E++ L  SL+        E A+     V G+ S+  I FLI ++ LP  LSK+L+F+ +
Sbjct: 1934 SEINELSSSLS------CDEAAEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFR 1987

Query: 2000 VSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKM 2059
            +   +   ++ +S Q+ES+HFR+ L P SL+R++  A         Y   H   +  +K 
Sbjct: 1988 IKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLA---------YEATHLSGLQALKD 2038

Query: 2060 FTG--KSDKPKE---IPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKD 2114
              G   SD  K+   I   F SI ILSY FC+GW+F     S+ GL  GY RLF+A+EK 
Sbjct: 2039 NAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKP 2098

Query: 2115 FGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2174
            +GK T++DA+F +A G+ S+ F+ + +E D+ NRS LP+MQI YWF+  G   + F R +
Sbjct: 2099 YGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRIN 2158

Query: 2175 GEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSL 2234
            GE LDV+F+   + +     +S+  FQELK+  LD       + + P       SA + L
Sbjct: 2159 GERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLD-----PFKPEEPVKRVPAGSAFSKL 2213

Query: 2235 APFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPH 2294
             P L +I  VN   +Y GGVF++Y+ DDI+ K+ PSF+++SP V +   Y       + H
Sbjct: 2214 -PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKH 2272

Query: 2295 RIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQN----VDYK 2350
             +R L++VD + NTL+  C P++ E +  +++++K     +K S   P + N    ++Y+
Sbjct: 2273 LLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDL---NKSSVETPRTSNMQEGINYR 2329

Query: 2351 RLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQ 2410
             LL   D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD  +PL  SL + 
Sbjct: 2330 SLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIH 2389

Query: 2411 QTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYL 2470
               A+ RHIFSREVSTS  +  +    + THPD I  YG + +  + V+FN+KQLQ+L +
Sbjct: 2390 NITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNV 2449

Query: 2471 FLDIWRFSSILHTRP------VQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSG 2524
            F++IW+  S + ++P      V G  + E  ++S      V   +  PW F +I + + G
Sbjct: 2450 FINIWKLDSKILSQPELDNKFVIGPTNLEKPLTS--KYKKVISNSSFPWNFVVILSRIRG 2507

Query: 2525 DVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWIS 2584
            ++DLG SLGV+SL T++ W  TDHYS+  Q L    D +SL+S+GRL G F + N  W+S
Sbjct: 2508 EIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMS 2567

Query: 2585 EVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPD 2644
            ++KW L +     PLV  ++ +D+ AVK  FDYH+ LI ++  +   L N++D +G++ +
Sbjct: 2568 QIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRN 2627

Query: 2645 LLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYK 2704
            LL VS SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  ++K      
Sbjct: 2628 LLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSH 2687

Query: 2705 DILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQL 2764
            +IL SL  LRT+LS+ +  + +Q+ P +LFD+EV+  + ++ S  S+T   KKLKT L+L
Sbjct: 2688 EILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKL 2747

Query: 2765 QVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTN 2824
            +V +V  ALST K +L E + + I + +YI +ASK+ GGTI+  P + + MTT  +  TN
Sbjct: 2748 KVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATN 2807

Query: 2825 NIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXXXXXXXXX 2884
             +E L++ SF  KI V+WNLG +NF++EMW TH +A+A+R+S                  
Sbjct: 2808 KVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKL 2867

Query: 2885 XXXXXXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLV 2944
                    + YI LEEP I++PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL 
Sbjct: 2868 KDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLA 2927

Query: 2945 YLAEKQYVKIL 2955
            +LAE ++ +IL
Sbjct: 2928 HLAESEWARIL 2938

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1745 bits (4520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1014/2805 (36%), Positives = 1537/2805 (54%), Gaps = 108/2805 (3%)

Query: 204  INDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPK 263
            +NDR YQ  +   +P FL+ LP+E    +G+L++GNK T SVM+ S+E  +G +D   P 
Sbjct: 11   LNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPD 68

Query: 264  ERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLW-KTFVRVLRIVXXX 322
             ++DLY+ K Q +   F++S++ N+ YD+   LK      ++ KL  K +   LR+    
Sbjct: 69   TKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRY 128

Query: 323  XXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKC 382
                           +  ++W+GL LY     +  P+  D   F+   HEYA+++ ++KC
Sbjct: 129  LSRGSKTESTRKDLRNPLERWRGLGLYWK---ENDPAWDDVFHFELPKHEYARYSKVMKC 185

Query: 383  PKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQ 442
              + I Y  D  G VPHGA PT+  +DGPDVGN GAPPDF+LD+Q+ G +I YGPWA  +
Sbjct: 186  EHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHE 245

Query: 443  VSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQ 502
            +  +Q+V SPVVSR S P ++L  GS R++T  R++++IM D+ WRIPTRE SKD +FL+
Sbjct: 246  IMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLK 305

Query: 503  HYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDIL 562
             YKET ++ RPFGW++L   + +    N+ +CPT  GF N   +HF++ EIR+SVNHDIL
Sbjct: 306  RYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDIL 365

Query: 563  LKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPY 622
            L ++  +++  IGYPLGWN+KA W  ++KS Q   F+L++HITL+ D LSDF  G+PTPY
Sbjct: 366  LSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPY 425

Query: 623  ELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESIL 682
            +LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+DFNENCYLS HGD L I   VP++SI 
Sbjct: 426  DLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIA 485

Query: 683  GTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVD 742
            G  T I Y + TP+FR+ +NTP WNTL+EFMK KEVGRA DF++ GSYL +S+LD++N+D
Sbjct: 486  GNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENID 545

Query: 743  TLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSS 802
            T++IEC S  T L CYG+V+R+L  VKMNYFG+F +F T+EEY   L    V        
Sbjct: 546  TIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQ 605

Query: 803  VLDLASTLDSGY---QNSSLKNESEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPET 859
              +   T  +G    + ++ KN + D    K+  LKR  NE D+WFTF V +G LILP+ 
Sbjct: 606  SANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKN 665

Query: 860  IYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANE 919
            +Y  + C A  F  L +D R  NYYMD+ A L+   ++         +F         + 
Sbjct: 666  LYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG-SEGRCPSR 724

Query: 920  QEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGY 979
               G++SDL IH HRMFGLPP E TYFC+WD ++G L I SD+  I  F +++ K+ F +
Sbjct: 725  ANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSF 784

Query: 980  NDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYS 1039
             D ENI+ Y    + DMTS+  HA  I++  ND  +    +V  E++    +DFENERYS
Sbjct: 785  KDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYS 844

Query: 1040 QRIDVKIPKLIISLSCVMGDGVDTSFL-KFETKLRFTNFEQYKDIDKKRSEQRRYITAHD 1098
             R DV I  + +    V   G D S +  F + L+ T F Q K+      +Q+ +I  +D
Sbjct: 845  SRADVDIHSITVQ---VKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATND 901

Query: 1099 SPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIV-GEYATL 1157
            +P+HRC FLLPL  Q SD Y+KL G                      I+++ + GE  +L
Sbjct: 902  APFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSL 961

Query: 1158 LETTNPFKDIFAETPSTVEPSRA--SSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVID 1215
                  F     E       +    SSTE+D++  ++ L  K I                
Sbjct: 962  QMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIK-------------PQ 1008

Query: 1216 VSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHI 1275
             S     + P      +S   + YS  + Q++D  EI +V              N+ V  
Sbjct: 1009 ASISACCIKPF-----RSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFS 1063

Query: 1276 AYMNLIWQETGEEGFELYLDRIDYQMSEKSLE----------KNRTSKLLEVATLARIKT 1325
                +     G +      D +D  + E S++           +  S + ++  L ++++
Sbjct: 1064 PTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVES 1123

Query: 1326 VRVTV-NQKRNPDLSEDRPPAL-SLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEW 1383
            + + V N  RN  L       L S  ++  E W ++ED + +S N TS D  +   + E 
Sbjct: 1124 LALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTEL 1183

Query: 1384 LFEYCSDQGNLIQEALNSFHSIQSTRIS-SKTELISKLTAASEYYQISHDPYVITKPAFI 1442
               +  +    I + +    S+   R+  ++ +   +++ AS+ YQI HDP VITKPA+I
Sbjct: 1184 CCIFLKNTAANI-DTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYI 1242

Query: 1443 MRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFST 1502
             RL   HVREN+SWKIITRLRHIL YLP      I   LK   + +  +A  IF+++FS 
Sbjct: 1243 TRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSK 1302

Query: 1503 WRNWEFSDVARSYIYGKLF--SVDNAEHKQNLMKKLLKCTMGSFYLTVYGEG--YEVEHN 1558
            WR+WE SDV + Y+Y K F    +      NL  ++  C+  +   + + EG    V+  
Sbjct: 1303 WRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDSCS-ATVSDSTHKEGDMIAVKGL 1361

Query: 1559 FVIADANLVVDLTPPVTSLS-LNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGG 1617
             ++    L  ++   + ++      +   ++  + +VK   S+  +KL     L  +   
Sbjct: 1362 KLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQNS 1421

Query: 1618 GDKSDAKAEL--SKQFK-MNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTS 1674
             D       L   K  K M   LL+D+ EI++ +D      ++ G  +S    + + +  
Sbjct: 1422 QDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARD 1481

Query: 1675 QAGSLVIFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAM 1734
               S+ +     E  ++H + I+ +A  R  S+ +            ++     L  +  
Sbjct: 1482 TGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVP 1541

Query: 1735 SXXXXXXXXXXXXRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLS 1794
            S             ES   +  ++KF  +SK  S  +     +    +  + +SEI  LS
Sbjct: 1542 SSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEISALS 1601

Query: 1795 PFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGI-SK 1853
            P  I    K L + F K  ++ + L + + D  + S  T +QYL+ S   +E+   I  K
Sbjct: 1602 PLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDK 1661

Query: 1854 EDYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXX 1913
             +     + +  ++ K    +PR I+ +  QD   A Q +                    
Sbjct: 1662 IEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTD 1721

Query: 1914 XXAPARMI---NWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAK--- 1967
                A  +    W     + Y G+LVP+ +T ++ E++ L  SL+        E A+   
Sbjct: 1722 EEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLS------CDEAAEFSF 1775

Query: 1968 --VTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLS 2025
              V G+ S+  I FLI ++ LP  LSK+L+F+ ++   +   ++ +S Q+ES+HFR+ L 
Sbjct: 1776 PLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALC 1835

Query: 2026 PDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTG--KSDKPKE---IPINFRSIHIL 2080
            P SL+R++  A         Y   H   +  +K   G   SD  K+   I   F SI IL
Sbjct: 1836 PFSLIRILSLA---------YEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQIL 1886

Query: 2081 SYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEG 2140
            SY FC+GW+F     S+ GL  GY RLF+A+EK +GK T++DA+F +A G+ S+ F+ + 
Sbjct: 1887 SYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQP 1946

Query: 2141 NEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAF 2200
            +E D+ NRS LP+MQI YWF+  G   + F R +GE LDV+F+   + +     +S+  F
Sbjct: 1947 DEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLF 2006

Query: 2201 QELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTY 2260
            QELK+  LD       + + P       SA + L P L +I  VN   +Y GGVF++Y+ 
Sbjct: 2007 QELKRQYLDP-----FKPEEPVKRVPAGSAFSKL-PILSSISHVNCKVRYAGGVFKLYSL 2060

Query: 2261 DDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEF 2320
            DDI+ K+ PSF+++SP V +   Y       + H +R L++VD + NTL+  C P++ E 
Sbjct: 2061 DDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEM 2120

Query: 2321 SESLQKMIKKHSTDDKPSFTKPSSQN----VDYKRLLDQFDVAVKLTSAKQQLSLSCEPK 2376
            +  +++++K     +K S   P + N    ++Y+ LL   D++  +   KQQ+SLSCEPK
Sbjct: 2121 ALDIRQLLKDL---NKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPK 2177

Query: 2377 AKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLT 2436
            AKVQADVGFE F   + TN+FD  +PL  SL +    A+ RHIFSREVSTS  +  +   
Sbjct: 2178 AKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFV 2237

Query: 2437 LLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRP------VQGSI 2490
             + THPD I  YG + +  + V+FN+KQLQ+L +F++IW+  S + ++P      V G  
Sbjct: 2238 FMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGPT 2297

Query: 2491 SKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYS 2550
            + E  ++S      V   +  PW F +I + + G++DLG SLGV+SL T++ W  TDHYS
Sbjct: 2298 NLEKPLTS--KYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYS 2355

Query: 2551 EKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVA 2610
            +  Q L    D +SL+S+GRL G F + N  W+S++KW L +     PLV  ++ +D+ A
Sbjct: 2356 DWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETA 2415

Query: 2611 VKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDI 2670
            VK  FDYH+ LI ++  +   L N++D +G++ +LL VS SSD   +  TAL  ANI D+
Sbjct: 2416 VKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDV 2475

Query: 2671 YNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISP 2730
            YNTI+RMR+DN+ SY+ETL DSN  ++K      +IL SL  LRT+LS+ +  + +Q+ P
Sbjct: 2476 YNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYP 2535

Query: 2731 ISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAI 2790
             +LFD+EV+  + ++ S  S+T   KKLKT L+L+V +V  ALST K +L E + + I +
Sbjct: 2536 STLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGV 2595

Query: 2791 DDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFI 2850
             +YI +ASK+ GGTI+  P + + MTT  +  TN +E L++ SF  KI V+WNLG +NF+
Sbjct: 2596 KEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFL 2655

Query: 2851 KEMWTTHVKALAVRQSQIANVSFGQXXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRD 2910
            +EMW TH +A+A+R+S                          + YI LEEP I++PQ +D
Sbjct: 2656 REMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKD 2715

Query: 2911 LGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            LG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL +LAE ++ +IL
Sbjct: 2716 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARIL 2760

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  914 bits (2362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1563 (34%), Positives = 823/1563 (52%), Gaps = 93/1563 (5%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M+  ++   + + +++ F WVFLV+W   ++I +   FY+ R   Y+VT IL W++WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENN-KD 119
             + IN+++L  S++GG+++FK++S+  +D TIS+L+G+ TW+YWLLN R  +L  +N  D
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120

Query: 120  SLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYL--NEHSFPESF 177
              SK     C+F LEC+G+E+FIYN+   Y++++N L+K ++D   K+   +E  F    
Sbjct: 121  ENSK-----CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVK 175

Query: 178  SDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLL 237
            +D S    + + L ES+  +    +I+N    Q      +P +L FLP E+  + G++++
Sbjct: 176  TDSSV---MFDPLDESSEQSKVGQTILNSVSNQSA----VPLYLDFLPAEVILSSGAVVV 228

Query: 238  GNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297
            GNK TPSV I+ Y   EG+IDV  P   LD Y+ +++ E  +  +S+K NI + +    K
Sbjct: 229  GNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSK 288

Query: 298  FKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAK 357
                 GK   LW+     L                      F   WKGL++Y  A  D  
Sbjct: 289  KHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTF 348

Query: 358  PSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNG 417
                D+I FD  NHEYAK+T+IL   ++ + Y  D  G +          I G + G+  
Sbjct: 349  S---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETL------IKGYENGDIP 399

Query: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRM 477
              P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR 
Sbjct: 400  PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRC 459

Query: 478  NVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTV 537
             ++IMED+ WRIPT+E SKDA FL  YK T++E R FGW+D++  KDT  +  + L  + 
Sbjct: 460  EIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASE 519

Query: 538  EGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEA 597
             GF+N FH + V   I +SVNHD+L  +K   +     YP  WNS   W ++  S  LE 
Sbjct: 520  CGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLEL 579

Query: 598  FLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657
            F+LR+H  L+ D  +DF++G+  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDF
Sbjct: 580  FILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDF 639

Query: 658  NENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKE 717
            NENCY+S+HG+   I + +P E+I      ISYEI TP F + L TPPW+TL+EFM  + 
Sbjct: 640  NENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRF 699

Query: 718  VGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFF 777
            VGR+++F+  GSYL Y+++DIDNVDT+ +EC +N      YGF++RY+ N+K+NYFGEF 
Sbjct: 700  VGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFA 759

Query: 778  NFVTSEEYTGVLGAR-EVGEIITKSSVLDLASTL--DSGYQNSSLKNESEDKDPVKRSDL 834
             F T+EEY+  L  R +V   I  ++  D  + L   + Y  S        K  + ++ L
Sbjct: 760  QFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKK--IDKASL 817

Query: 835  KRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGT 894
            KRT NE DIW TF   +G  +LPE+ Y    C  LHF  +  D R  +YY D+   +N T
Sbjct: 818  KRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNST 877

Query: 895  SIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLG 954
             IKR+     N VFD    N        G LS+  IH HRMFGLPP E TY  + D++LG
Sbjct: 878  YIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLG 937

Query: 955  DLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPV 1014
             L+ +SDIE +KGF     K  FG+++ E++L Y+     D++ L+  A+ I I  N+  
Sbjct: 938  YLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNID 997

Query: 1015 MKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRF 1074
                  ++  ++   L+DF   +YS R ++ IP     +S +  D  +       T + F
Sbjct: 998  TNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGTISTSISF 1055

Query: 1075 TNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXX 1134
              F +  D     + Q ++I   D+P+ RC FL P  YQ SD Y+ LY            
Sbjct: 1056 AIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSSIPLL 1115

Query: 1135 XXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPL 1194
                       I E+++G+          ++D  +E   T + S  +  + + D      
Sbjct: 1116 PEPIGPNNFDTIFENLLGDI---------YQDYISE--GTFDISNDTKLQLNID------ 1158

Query: 1195 EFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLF---------------VFTKSLLKEFY 1239
            EFK  +      H+  N  ID+   L +V   +F               VF   L ++  
Sbjct: 1159 EFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFA-DLYRQLT 1217

Query: 1240 SEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDV---HIAYMNLIWQETGEEGFELY--- 1293
            +  +   +D + + IV   S    G +S++   V    I +   +++    E  + Y   
Sbjct: 1218 TFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVS 1277

Query: 1294 ----LD-----RIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPP 1344
                LD     R +Y     + E N  +KL      A I    ++      P  SE    
Sbjct: 1278 DINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYP--SESSEF 1335

Query: 1345 ALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHS 1404
            +     E  E ++  +D  V   NL    + I++   + + E+       +    N+F  
Sbjct: 1336 SYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKT----LYLKFNTF-- 1389

Query: 1405 IQSTRISS------KTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKI 1458
            I+S  IS       K EL+ ++  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I
Sbjct: 1390 IKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRI 1449

Query: 1459 ITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYG 1518
            +TRLRH+L YLP  W +     L++ K+ S +DAK  F+ +F+ WR+WEF+DV R ++Y 
Sbjct: 1450 VTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYK 1509

Query: 1519 KLF 1521
            K +
Sbjct: 1510 KTY 1512

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1220 (35%), Positives = 664/1220 (54%), Gaps = 64/1220 (5%)

Query: 1762 PKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSI 1821
            P S+        K+NI      + ++ ++  L PF +R+  K+ +I  +     +  LS+
Sbjct: 1759 PDSQVLKPIAMVKMNI------AAINIQLQLLLPFILRYSCKEFEINVDFGRILQSSLSL 1812

Query: 1822 WDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVNS 1881
             DT   + S + +E Y+++S   +++ G       +L  + +  S  KL+  EP++ +  
Sbjct: 1813 QDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRL 1872

Query: 1882 FLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVPVAST 1941
            FL D     Q +                        +R+I   L+ ++ Y G+L+   +T
Sbjct: 1873 FLSD---IEQAVKNIEILRSTMLETKSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTT 1929

Query: 1942 YFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVS 2001
             +V E + L  S +       P     +  +S E+I FLIK+R +   LSK+LDFS+++ 
Sbjct: 1930 LYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIK 1989

Query: 2002 TLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFT 2061
             ++ ++   QS Q+ESS+    LSP SL+RL+   ++   +   Y         DIK  +
Sbjct: 1990 VIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYH--------DIKPRS 2041

Query: 2062 GKSDKPKEI-PINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTV 2120
              S+    I PI+ +S HILSY  CIGWLF  G  ++ GL+ GY RLF+ Y+K +GK T+
Sbjct: 2042 TSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTL 2101

Query: 2121 VDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDV 2180
            +DA+FSVA+G  SST++ +GNEK   NRS+LP+MQI+YW +     KD F R +GE LDV
Sbjct: 2102 LDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDV 2161

Query: 2181 NFVPSFMDVIDSTLQSVRAFQELKKNILD----VSEDSHMED----DNPYATSSMESASN 2232
            + +  +  ++D   QS+  F++LK+ ILD     S D  + +    DNP A+S       
Sbjct: 2162 SLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDNPLASS------- 2214

Query: 2233 SLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAK 2292
                    +RS+N    Y G   ++Y+ DDI+  +  SFEI+SP  T+   YK+  ++ K
Sbjct: 2215 --------VRSINCIINYAGSSMKLYSRDDIQHGT-CSFEIRSPAHTVTIDYKYYPSKKK 2265

Query: 2293 PHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHS---TDDKPSFTKPSSQNVDY 2349
             H IR L  V+ T NTL+  C PLL E   +   M+K      ++  P+     ++ ++Y
Sbjct: 2266 SHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAE-INY 2324

Query: 2350 KRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTL 2409
            + LL+ FD+AV +   KQ++SL+CEP AK+QA +GFE F   + TN    ++PL  S+ L
Sbjct: 2325 RDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDL 2384

Query: 2410 QQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLY 2469
                AS RH+FSRE+S+S  +  + +    TH + I  YG++L+S    +FNVKQ+++L 
Sbjct: 2385 HNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLN 2444

Query: 2470 LFLDIWRFSSILHTRPVQGSISKEIDMSSLTST------NYVDVGAEIPWCFTLIFTNVS 2523
            LFL+IW   SI   + V   I   +  SS  S         V + A   W + LI + + 
Sbjct: 2445 LFLEIW---SIEKQKSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIG 2501

Query: 2524 GDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWI 2583
             ++DLGPSLG++ +++   W  + H  +  Q L      + ++S GRL G   + +  W 
Sbjct: 2502 AEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWK 2561

Query: 2584 SEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILP 2643
            S++ W +  + +  PLV  SL +     K +FDYHMF I TI N   +L N++D +G L 
Sbjct: 2562 SKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLA 2621

Query: 2644 DLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILY 2703
            DLL VS S D I +  T+L  AN+ DIY+TI RMR D+  + ++ L +SN  +       
Sbjct: 2622 DLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKISSFDN 2680

Query: 2704 KDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNV------SIRSETHSGKK 2757
              +L SL  LRT+LS+N   L + I   +L   EV+V+R + V         S+T S  K
Sbjct: 2681 SKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAK 2740

Query: 2758 LKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTT 2817
            ++T+L  Q+ D+S +LS+ K +LDE     I + DY+  AS I GG I++ P + V M T
Sbjct: 2741 VQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNT 2800

Query: 2818 LQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQXX 2877
             Q + +N IE L++ SF + +S+ WNL P+NFIK+MW+ H+ A+ +R  Q  N S     
Sbjct: 2801 WQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIP 2860

Query: 2878 XXXXXXXXXXXXXXXFNYI--ALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQT 2935
                             YI   LEEP I++P+I+DLGDATPP+EWFG+NR RFP  THQ 
Sbjct: 2861 KDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQI 2920

Query: 2936 AVIPVQKLVYLAEKQYVKIL 2955
             V+P+QKL  +AEK+YV+IL
Sbjct: 2921 VVVPLQKLSAVAEKEYVRIL 2940

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1515 (32%), Positives = 774/1515 (51%), Gaps = 104/1515 (6%)

Query: 37   IFYMGRIYAYLVTFILEWLLWKRANIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLE 96
            IFY+GR+  Y+V+     +LWK+  + +++++L  S L G++HFK++SV  +D  ISVL+
Sbjct: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65

Query: 97   GSLTWKYWLLNCRKAELIENNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLL 156
            G++TW+YWL        I   + S + +    C+F+L+ EG E F+YNR   YD +    
Sbjct: 66   GTITWRYWL--------IGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRI---- 113

Query: 157  SKDERDKFEKYLNEHSFPESFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGK 216
                                      A +LD +   SA  T S  S+       E  I +
Sbjct: 114  --------------------------ARELDGE-DTSAEPTVSVPSV-------EEVIAE 139

Query: 217  L---PKFLKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKT 273
            L   P   +FLP+E   N+G+++LGNK T SV I++YE   G + +  P +       +T
Sbjct: 140  LQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRT 199

Query: 274  QMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXX 333
            + +  N  ++IK NI Y+    +K  ++  + ++LWK +  +L  V              
Sbjct: 200  EAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQH 259

Query: 334  XXXXSFFQKWKGLSLYKAAPGDAKPSDLDD-IEFDFTNHEYAKFTSILKCPKLTIAYDVD 392
                 ++  W+GLS+Y     +    +LD+ ++FD  +HEYAK T++LK  ++ + Y   
Sbjct: 260  QTP-KWYDNWRGLSMYDVNLDE----ELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYG 314

Query: 393  VSGF--VPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVL 450
            + G   V    +   P ++ P++       D ++D+ ++  +  YGPWA RQV    RV 
Sbjct: 315  MPGTARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVF 367

Query: 451  SPVVSRTSKPVKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEE 510
            SP V R  K         +     F+++V IMED+  R+P +E+SKDA FL+ YK+T +E
Sbjct: 368  SPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDE 427

Query: 511  YRPFGWMDLRFCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNL 570
             RPFGW+D+R  K++     +   PT  GF+N  H + V+T I +SVNHD LLK+K  ++
Sbjct: 428  TRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDI 487

Query: 571  DGDIGYPLGWNSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVY 630
              D  YP GW  KA W  N+ S Q E F+LR+H+ L++D ++DFS GE   YE FRPF Y
Sbjct: 488  TVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDY 547

Query: 631  KVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISY 690
            +  W++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + +
Sbjct: 548  RFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDF 607

Query: 691  EISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTS 750
             I TP F + LN PPW+T +E + +KE+GR+ +F +KGSY  YSE+D+DNVD L I C +
Sbjct: 608  NIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACET 667

Query: 751  NSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTL 810
            +  V+ CYG +++ + NVK+NYFGE  +F T+EEY   L  R      T        +  
Sbjct: 668  DYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVH 727

Query: 811  DS---GYQNSSLKNESEDK----DPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSL 863
            DS     +++ + + S D       +K+S LKR+ NE D+WFTF    G    PE IY  
Sbjct: 728  DSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKF 787

Query: 864  DPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHG 923
            D C+  +F  L    R  NYY+D    L+    KRH       +F  I       +    
Sbjct: 788  DACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDA 847

Query: 924  TLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLE 983
             LS  +   H+M G+ P+E +Y C++D+ +  L +  D+  +K F N+   + FG+ D+E
Sbjct: 848  YLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVE 907

Query: 984  NILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLI---DFENERYSQ 1040
            N L Y+ E V D+  ++   E + +   + V K + +  + +L  T +   D  NERYS+
Sbjct: 908  NSLQYEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSR 966

Query: 1041 RIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSP 1100
            R D+ IP+L+  +    GD   T    F T +  T FE+++   + R  QR++I  +D+P
Sbjct: 967  RSDLSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAP 1024

Query: 1101 YHRCPFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLET 1160
            +HRC F+LP  Y+    Y+ LYG                      I E ++GE       
Sbjct: 1025 FHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEI------ 1078

Query: 1161 TNPFKDIFAETPSTVEPSRASSTEDD--NDERADPLEFKPIAFTEGRNHQR--GNYVIDV 1216
               +++  +++   +     SSTE D  N      +      F   +NHQ+   +++++ 
Sbjct: 1079 ---YQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEF 1135

Query: 1217 SYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIA 1276
              I   +D     F   + K      + + +D +EIGI+ Q          IS  +V + 
Sbjct: 1136 DPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGIS--EVRVL 1193

Query: 1277 YMNLIWQETGEEG-FELY-----LDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTV 1330
              N+    T ++  F ++     +  +D     KS + N      +     +I  +R  +
Sbjct: 1194 CPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANI 1253

Query: 1331 NQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCS- 1389
             Q       +      S  +E  E + S +   +   N+ S  +T+     + LFE+ + 
Sbjct: 1254 VQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNP 1313

Query: 1390 --DQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSK 1447
                 +L+Q  L+SF   + T ++SK E +  +      Y+I HDP VITKPA I R S 
Sbjct: 1314 FISTFDLLQRELSSF---EDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSN 1370

Query: 1448 GHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWE 1507
             H+R   SW+II RLRHIL YLP +W  +  + L  + +TS ++A   F+S+FS WR+WE
Sbjct: 1371 RHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWE 1430

Query: 1508 FSDVARSYIYGKLFS 1522
             +DV  S+++ K+F+
Sbjct: 1431 PTDVQGSFVHEKVFT 1445

 Score =  601 bits (1549), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 401/1239 (32%), Positives = 639/1239 (51%), Gaps = 53/1239 (4%)

Query: 1749 ESVLKIKDRIKF-----------KPKSKKRSQFVGPKINIVL-SCYFSNVSSEIMPLSPF 1796
            ES+  ++D IK+           +P  ++ S   G KI+ VL     +N++ ++  LSPF
Sbjct: 1666 ESLPYVRDEIKYLVEALVPELFAEPPIERESS--GNKIHAVLFQGQVANITLKLQILSPF 1723

Query: 1797 YIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKED- 1855
             I + A+  ++      S    L+  ++   ++S + K  Y +++   +++ G  S    
Sbjct: 1724 IILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARL 1783

Query: 1856 YSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXXXPXXXXXX 1915
            +  I+ DI I  +KL+  + +  +   LQD K A    +              P      
Sbjct: 1784 FEHISCDIGI--LKLSVFDLKTRITDLLQDIKAAL--FSMKSLSDILNISQSSPTASAFG 1839

Query: 1916 APARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQF--- 1972
            +   ++   L    TY G+L+    T ++ E +       +T +G LP+       F   
Sbjct: 1840 SWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNF--EAKHTRDG-LPDAITPRPCFKVD 1896

Query: 1973 -SIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLR 2031
             SIE+  FLIK+R +   L+K++DF++  + +  T    QS Q+ES+H ++ L+P +++R
Sbjct: 1897 HSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVR 1956

Query: 2032 LMWGAHKLLDLGHYYSRR--HAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWL 2089
            L+   ++   +   ++    + P+         +  +P    +  +S HILS+ F I WL
Sbjct: 1957 LLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWL 2016

Query: 2090 FQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKS-STFFSEGNEKDKYNR 2148
            F     S  GL+ GY+RLFS YEK +GK T+++A+FS A    S + F+S    K + N 
Sbjct: 2017 FDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINT 2076

Query: 2149 SFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNIL 2208
            S+L +MQ+ YWF    E  D F R HG  L V+     + +++ T+QS++ F  LKK ++
Sbjct: 2077 SYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALV 2136

Query: 2209 DVSEDSHMEDD---NPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEA 2265
            D       + D    PY      + +N LA     +RS+N    Y G   +++++D    
Sbjct: 2137 DPFRTKKQDSDISKEPY------NWNNQLAT---GVRSLNCIINYAGVTLKLHSHDG-RG 2186

Query: 2266 KSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQ 2325
             + P  E+ SP   +   YK+  N  K HR R LI   PT NT Y+  A L+ +      
Sbjct: 2187 DASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFS 2245

Query: 2326 KMIKKHSTDDKPSFTKPSS----QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQA 2381
            K++K  ST++K S    SS    +  D   LL   D+ + L   KQ+++ SCEPKAKVQA
Sbjct: 2246 KLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQA 2305

Query: 2382 DVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTH 2441
             VGFE F   +  N  + E+ L  ++ ++    + RHI+SREV  S ++  + +      
Sbjct: 2306 TVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMG 2365

Query: 2442 PDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIW--RFSSILHTRPVQGSISKEIDMSSL 2499
              V  +YG++L+S    +FN+KQLQ+L LF+D W  + + +      +G +  +I  S  
Sbjct: 2366 SQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRSIG 2425

Query: 2500 TSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAF 2559
            +        +   W +++I      +++LGPSLGV+++ ++  W  +    +  Q L   
Sbjct: 2426 SKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLN 2485

Query: 2560 TDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHM 2619
               + +TS GRL G F V NA    E+KW   K     PLV   L  D V  K +FDYH 
Sbjct: 2486 MGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHT 2545

Query: 2620 FLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQ 2679
            F I ++      L NE+D  G L DLL V+ S + + +  TAL AANI DI N+I R+++
Sbjct: 2546 FFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKK 2605

Query: 2680 DNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVL 2739
            DN++SY+ +   S+   S +P     I  +L LLRT LSLN+   ++QISP SLFD +VL
Sbjct: 2606 DNELSYLSSFLASDQ-PSDEPEEDGGIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVL 2664

Query: 2740 VVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASK 2799
            ++    +   +   +  K+KTDL  Q+ DVS AL      LDE   A++ +  YI  +S 
Sbjct: 2665 ILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSST 2724

Query: 2800 IVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVK 2859
            I GG I   P + V+MTT QE ++N IE L++ SF   + ++WNLGP++FIK+MW  H+ 
Sbjct: 2725 IQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMN 2784

Query: 2860 ALAVRQS---QIANVSFGQXXXXXXXXXXXXXXXXXFNYIALEEPQIQVPQIRDLGDATP 2916
            A+ +R+     +A                       + Y+ L+EP I++P+I+DLGDATP
Sbjct: 2785 AMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATP 2844

Query: 2917 PMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955
            P+EWFGVNR +FP FTHQ  ++P+QKL   AEK+Y KIL
Sbjct: 2845 PIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKIL 2883

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1586 (30%), Positives = 804/1586 (50%), Gaps = 110/1586 (6%)

Query: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60
            M++ S  R + ++ +KD S  FLVDWIL V++C+   FY+GRI A+++T  L++ +W++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-IENNKD 119
             IKIN+++++VS LGGRI FK+L+V+  D+TIS LEGS TW+YWLL+ R   +  E+   
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 120  SLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSD 179
              S+N KLPC+F L+C+GLE+F+YN+   Y++V+       RD F     +    ES  D
Sbjct: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTKDGQETESNDD 173

Query: 180  GSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGN 239
             +    ++ + + +    ++ +        + TD  KL    K  PI+L+ NR +++LGN
Sbjct: 174  IT----INTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLFPIQLEANRAAIVLGN 229

Query: 240  KFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299
            + T  V +  +E  +GV D+      LD YR K  ++  +    ++ N+GY +   +K  
Sbjct: 230  RNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTF 289

Query: 300  LDTGKVSKLWKTFVRVLRIVXXXXXXXXXXXXXXXXXXSFFQKWKGLSLYKAAPGDAKPS 359
            +    + K+W+T  +  + +                  ++   WKGL LY       +  
Sbjct: 290  VVEKTMDKIWQTVKK--QCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHTKA-VQEE 346

Query: 360  DLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGN---N 416
            ++D         EYA+++ ++K  ++++ Y  D+ G VP  +       D  +  N   +
Sbjct: 347  NVDTTVLH--EQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQD 404

Query: 417  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFR 476
               P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  PGS RIY  F+
Sbjct: 405  DDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFK 464

Query: 477  MNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPT 536
            ++V   + +   IPTRE+SKD EF++ YK T + +R FGW+++   +     FN+ LC  
Sbjct: 465  LSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQ 524

Query: 537  VEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLE 596
             +   N  +V  +  EI+SSVNH++L +     +  +IGYP GWN +A W+  + S+  E
Sbjct: 525  ADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAE 584

Query: 597  AFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLD 656
             FLLR+HI+L++D  +DFSA +   YELFRPF Y++ W    Y ++LNVND NI+NN LD
Sbjct: 585  LFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLD 644

Query: 657  FNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHK 716
             NENC+LSL GD L   I +P  SI+    + ++ + +P+ ++ ++ P WNTL+EF+   
Sbjct: 645  LNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSET 704

Query: 717  EVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEF 776
              G   DF++ G+Y+ +  +D+DN DT++I+  S+ST    +GFV+RYL N+K+NYFG+F
Sbjct: 705  TFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDF 764

Query: 777  FNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLD--------SGYQNSSLKNESEDKDP 828
             +F T+EEY+  L   E  +  TK+      + ++          YQ +   NE    + 
Sbjct: 765  NHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINE----NT 820

Query: 829  VKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIM 888
            + +S L RT NETD+W TF V +G +I+PE +Y       L F  L  D R  NY+MD+ 
Sbjct: 821  IHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLT 880

Query: 889  AVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEH----GTLSDLTIHGHRMFGLPPTEPT 944
            A  +   +        N V         A E+ H    G L DL +HGHRMFG+PP E T
Sbjct: 881  AFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHGHRMFGVPPVEET 932

Query: 945  YFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAE 1004
            Y C+WDI++G L+ DSD +F+  F  +  K+GF Y D ENIL+Y     +D+TSLT+   
Sbjct: 933  YLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIG 992

Query: 1005 RIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTS 1064
            R+  S         + ++   +     D  N RYS+R+D+    L+ ++S    D   T 
Sbjct: 993  RVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDL----LVAAISVCAIDEKKTV 1047

Query: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDT-YQKLYG 1123
                +T +  T F    ++   R  Q+  +  +DSP+HRC FLL     +  T Y  L G
Sbjct: 1048 LFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLG 1107

Query: 1124 XXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASST 1183
                                  I E ++G Y  L+       D                T
Sbjct: 1108 SITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIID----------------T 1151

Query: 1184 EDDNDERADPLEFKPIAFTEGRN--------HQRGNYVIDVSYILLDVDPLLFVFTKSLL 1235
            ++  D+R D     P++ T   +         +  N  +++S + + V P  F F ++  
Sbjct: 1152 KNLTDDRPDDKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAA 1211

Query: 1236 KEFYSEDMVQVLDDIEIGIVKQLS--NLQEGITSISNIDVHIAYMNLIWQETGEEGFEL- 1292
                +     ++D  E+ IV   S  ++  G    S++ +    +N I  ET  +  +L 
Sbjct: 1212 HFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDETALDKTQLE 1270

Query: 1293 YLDRIDYQMSEKSL------------EKNRTSKLLEVATLA-RIKTVRVTVNQKRNPDLS 1339
             LDR++  +S  S+            + N ++ + + +T++    +++  + +     L+
Sbjct: 1271 ALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLT 1330

Query: 1340 EDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEAL 1399
            +  P A    +  F     ++  +V+ L   S    I ++ +EW  EY         +  
Sbjct: 1331 KVLPIAW-FEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEG 1389

Query: 1400 NSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKII 1459
             S   +   R     E I ++    +   I   PY+ITKPA+I RLSK HVR+  SWKII
Sbjct: 1390 KSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKII 1449

Query: 1460 TRLRHI---------LTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSD 1510
            TRLRH+          T   DD  + +  + K+         K+ F+ +F  W+NW+  +
Sbjct: 1450 TRLRHVSKHTSHVSETTSQCDDIPEEVRNICKD---------KSQFLDIFVDWKNWDVYE 1500

Query: 1511 VARSYIYGKLFSVDNAEHKQNLMKKL 1536
            V +S ++  LFS ++  H+++L  +L
Sbjct: 1501 VEQSSLFTLLFSGESTVHEEDLFNEL 1526

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/1207 (31%), Positives = 644/1207 (53%), Gaps = 81/1207 (6%)

Query: 1778 VLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQY 1837
            VLS    ++  +     PF IR     LD  F       ++++   T+  +  +  + + 
Sbjct: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819

Query: 1838 LRFSFGDIEIKGGISKEDYS----LINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893
            LR       I   ++K DY     L ++ +   ++KLT S+ R  +          +  +
Sbjct: 1820 LR-------ISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEELTDS---LNGTV 1869

Query: 1894 NXXXXXXXXXXXXXXPXXXXXXAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLS 1953
            +              P      A  +    +   +  Y G+L  + +T +V E +    S
Sbjct: 1870 SELIKIFKNKNADNEP------AAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFS 1923

Query: 1954 LTNTNNGMLPEEAKVTGQFS-----IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVD 2008
              +    +  EE             I+N+  L+    +   LSK+ D    +  ++   D
Sbjct: 1924 CASRAEAL--EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--D 1979

Query: 2009 TEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGK---SD 2065
             +++ Q+E+ H RV L+P +L+ ++           ++ +    ++  +K   GK   S 
Sbjct: 1980 IKKTLQIETPHSRVMLAPSTLIAVI-----------FFIQEAKVSLQKVKQ-KGKFNSSS 2027

Query: 2066 KPKEIPINFR--SIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDA 2123
               EIP  F   S++ILS K C+GW+F+     + G+++GY  LF+AYEK +GK T+VD 
Sbjct: 2028 NAIEIPPYFETLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDG 2086

Query: 2124 FFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFV 2183
            + + A G +S+ FF   N   + NRS L +MQI++WF      KD F R + + LDV  +
Sbjct: 2087 YVATAQGKESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRIL 2145

Query: 2184 PSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRS 2243
             + +++++    S+ +FQ+       +++ S+++  +    +  E+ S+ ++    +IRS
Sbjct: 2146 TTSVEIVNVMRSSIESFQK------KLAKISNIKKSSISTHNVAENLSDKVSIL--SIRS 2197

Query: 2244 VNSNFKYDGGVFRVYTYDDIEAKS-EPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAV 2302
            +N   KY GG+  +YT DDI   S + S E+ SP + ++  Y HN    K H IR L+ V
Sbjct: 2198 INCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNV 2257

Query: 2303 DPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNV-------DYKRLLDQ 2355
            + T N L++ C P+L+  +  +QK +++ +++ K    K   Q         DYK L  +
Sbjct: 2258 ESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKK 2317

Query: 2356 FDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKAS 2415
             D A+ +    Q ++L+CEP+AK+QAD+GF +F  SM T+  D  +PL  SL   + + S
Sbjct: 2318 IDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEIS 2377

Query: 2416 IRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIW 2475
             RHIFSRE+S+S  +  + L  + TH + I  YG +L+SD+  + N+KQLQ + LFLDIW
Sbjct: 2378 TRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIW 2437

Query: 2476 ----RFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPS 2531
                + +  L + P  G   +   ++  T+        +IPW + +IF N S  +D+ PS
Sbjct: 2438 SPKTKKAQKLGSGPHSGQKCQPQALTEFTT-------PKIPWIYQIIFKNTSAVIDMDPS 2490

Query: 2532 LGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLE 2591
            LG I+ +    W+++ H  +    +  + D ++  S+GRL GLFE+ N  + S + W ++
Sbjct: 2491 LGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVK 2550

Query: 2592 KSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFS 2651
             +K   PL++ +  +  ++ K  FDYH FLI  ++++Q  + NE+D  G+L DLL VS S
Sbjct: 2551 DNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMS 2610

Query: 2652 SDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLK 2711
               + +  TAL +AN+ DIY T  RMR +NK SY++TL++SNP  S +     + L +  
Sbjct: 2611 FGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPL 2670

Query: 2712 LLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSA 2771
             LRT+L+  I S ++ + P +LFD EVLV++   +++ + T + +K KTDL  Q+ D++ 
Sbjct: 2671 RLRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINI 2730

Query: 2772 ALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFA 2831
            +L+  K EL EE  A +++++Y   A+ + G  I+  P + V +TT Q+    +IE+L++
Sbjct: 2731 SLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYS 2790

Query: 2832 CSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQI---ANVSFGQXXXXXXXXXXXXX 2888
             SF DK+ +KWNL P+NFI+EMW THV+AL+VR+       +  F +             
Sbjct: 2791 SSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFE-DENIAEKIKIVN 2849

Query: 2889 XXXXFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAE 2948
                + YI LEEP I++P +RDLG+ATPP+EWFGVNRKRFP   HQ  V+P+QKL+Y+AE
Sbjct: 2850 LGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAE 2909

Query: 2949 KQYVKIL 2955
             QY + L
Sbjct: 2910 DQYNRTL 2916

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 67.0 bits (162), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%)

Query: 5  SQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRANIKI 64
          S+ R VP++  +DFSWVFL DW+L + + L   FY GR+  Y +T ILE+L WKR  +K+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
            similar to uniprot|Q02776 Saccharomyces cerevisiae
            YPL063w
          Length = 485

 Score = 36.6 bits (83), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 1567 VVDLTPPVTSLSLNREETIEITGRVGSVKGKF---------SDRLLKLQDLIPLVAAVGG 1617
            V D+ P + S    RE   E   RV  +K KF         S+ LLKL  L P++  +GG
Sbjct: 341  VEDVRPILKSYHNKRELPAEFEQRVQKLKNKFEQDQKKKNDSNWLLKLLGLAPVINGIGG 400

Query: 1618 GDK 1620
            G+K
Sbjct: 401  GNK 403

>TBLA0C03330 Chr3 complement(806178..808154) [1977 bp, 658 aa] {ON}
            Anc_5.312 YHR035W
          Length = 658

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 11/55 (20%)

Query: 2583 ISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKD 2637
            I+E+KW   K     PLV   LN  +  +   F+ H    GT+  IQFQLH  KD
Sbjct: 383  INEMKWKFNK-----PLV---LNPKNFVIPCEFEVHS---GTLQTIQFQLHYYKD 426

>CAGL0K11132g Chr11 complement(1085316..1086749) [1434 bp, 477 aa]
           {ON} similar to uniprot|Q03782 Saccharomyces cerevisiae
           YDR240c SNU56 U1 snRNA protein
          Length = 477

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 33/123 (26%)

Query: 746 IECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLD 805
           + C +N+T++ C   ++RY+   +++     F  V+ + YT V+       I+   SVLD
Sbjct: 64  LSCETNNTIVQCIQHLLRYVDQERLH-----FKTVSGQLYTHVV-------ILRNFSVLD 111

Query: 806 LASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNETDIWFTFS---VWNGALILPE-TIY 861
               +                 PV  S +KR  ++T  +F F      NG   +P+ T+ 
Sbjct: 112 FCLVV-----------------PVLLSAVKRLNSKTSDYFKFDSHIFCNGTFFVPDNTVI 154

Query: 862 SLD 864
           S+D
Sbjct: 155 SID 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 313,191,630
Number of extensions: 14240046
Number of successful extensions: 43473
Number of sequences better than 10.0: 43
Number of HSP's gapped: 43961
Number of HSP's successfully gapped: 60
Length of query: 2959
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2831
Effective length of database: 38,804,151
Effective search space: 109854551481
Effective search space used: 109854551481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)