Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1548.259ON1417141767260.0
Suva_10.1708.259ON1416141756560.0
Smik_12.1458.259ON1418141755630.0
YLR086W (SMC4)8.259ON1418141755190.0
KAFR0B027108.259ON1416144437310.0
ZYRO0C01716g8.259ON1413137837210.0
TDEL0F038608.259ON1399142436990.0
NCAS0B050008.259ON1409137036520.0
SAKL0H17094g8.259ON1422143236110.0
Kpol_392.88.259ON1427139135500.0
KNAG0G020208.259ON1444139435140.0
NDAI0B019708.259ON1415137434420.0
Kwal_56.238258.259ON1396140034190.0
KLTH0G13750g8.259ON1399139633910.0
TPHA0J007208.259ON1393136932390.0
AGR089C8.259ON1370139032380.0
Ecym_43118.259ON1376137232260.0
TBLA0E044108.259ON1422139132100.0
CAGL0L12188g8.259ON1398139630500.0
KLLA0F19085g8.259ON1372136930230.0
NDAI0G033208.68ON12317584522e-44
TDEL0C009608.68ON12227604281e-41
KLTH0A02706g8.68ON12281703691e-34
Kwal_23.50438.68ON12251743521e-32
NCAS0C040008.68ON12231613502e-32
Suva_6.528.68ON12641613484e-32
SAKL0B02288g8.68ON12281723476e-32
TPHA0P003408.68ON12191653451e-31
Skud_6.648.68ON12301613441e-31
KNAG0G009108.68ON12261603413e-31
YFL008W (SMC1)8.68ON12251613403e-31
KAFR0C032008.68ON12231613403e-31
Smik_6.718.68ON12281613385e-31
Kpol_1011.58.68ON12211623314e-30
KLLA0D07502g8.68ON12431803252e-29
TBLA0G035308.68ON12321633234e-29
CAGL0F02079g8.68ON12231923224e-29
Ecym_73038.68ON12222143191e-28
ZYRO0F03828g8.68ON12171613153e-28
AGL023W8.68ON12221613119e-28
AGR236W7.186ON11701792609e-22
ZYRO0D15642g7.186ON11701822545e-21
CAGL0D05258g7.186ON11701842502e-20
Ecym_43907.186ON11701812492e-20
TDEL0H026107.186ON11701822482e-20
KAFR0G029307.186ON11701842464e-20
Skud_6.1197.186ON11701842431e-19
NDAI0G020707.186ON11711842421e-19
Suva_6.1047.186ON11701842421e-19
SAKL0F07282g7.186ON11701802411e-19
KLTH0H09966g1.295ON12247732411e-19
YFR031C (SMC2)7.186ON11701842411e-19
KLTH0E04774g7.186ON11701822412e-19
Smik_7.3467.186ON11701842412e-19
Kpol_1063.207.186ON11711822402e-19
Kwal_55.204217.186ON11701832383e-19
NCAS0E019207.186ON11701842331e-18
KLLA0D16005g7.186ON11701802312e-18
TBLA0D046107.186ON11741812294e-18
KNAG0L011607.186ON11701822285e-18
TPHA0C044407.186ON11701822277e-18
ZYRO0G21296g1.295ON12272372081e-15
KAFR0A016101.295ON12271092034e-15
Kwal_14.24351.295ON1247982001e-14
KNAG0B052301.295ON12252431991e-14
Kpol_1018.21.295ON12111931982e-14
SAKL0D06116g1.295ON1229941963e-14
NCAS0A093301.295ON12271221946e-14
TDEL0D016201.295ON12232331946e-14
NDAI0G056301.295ON12291171911e-13
Smik_10.1671.295ON12291001874e-13
TBLA0C027401.295ON11191521856e-13
YJL074C (SMC3)1.295ON1230951821e-12
TPHA0I010901.295ON1216951821e-12
Suva_6.1491.295ON12302201821e-12
Ecym_63221.295ON12321151802e-12
CAGL0H02805g1.295ON12191091802e-12
AAL182W1.295ON12311141775e-12
Skud_10.1701.295ON1230951741e-11
KLLA0A00286g1.295ON1224891677e-11
ZYRO0G01584g7.101ON10881811222e-05
KNAG0L006307.101ON11081591167e-05
SAKL0B09526g7.101ON10991791141e-04
TDEL0E013404.237ON1106851104e-04
KLTH0D02816g7.101ON10941611095e-04
Kwal_26.72047.101ON11172031070.001
KLLA0F07997g7.101ON11191871040.002
ZYRO0B12122g4.237ON1109781030.003
KAFR0D013307.101ON10801891020.004
Kpol_1044.137.101ON11031391000.005
NCAS0I005707.101ON10952331000.006
NCAS0J013904.237ON109668970.014
TPHA0B008404.237ON111968960.016
CAGL0H05071g4.237ON111076960.018
NDAI0J021804.237ON1108107960.019
Skud_12.4684.237ON112068960.020
YLR383W (SMC6)4.237ON111468950.020
Suva_10.5004.237ON111568950.021
Smik_12.4704.237ON111468950.022
NDAI0A084507.101ON111962950.022
Skud_15.1217.101ON109362950.026
KNAG0B060104.237ON111768950.026
Suva_15.1337.101ON109262940.027
Smik_15.1317.101ON109362940.028
YOL034W (SMC5)7.101ON109362940.031
Ecym_26257.101ON1097131940.032
TPHA0L006007.101ON111762940.034
TDEL0H034907.101ON110364930.039
TBLA0E021907.101ON108969930.041
KLLA0E05303g4.237ON1098102920.051
AEL337C7.101ON1097179920.054
TBLA0A053001.67ON70763900.085
Ecym_53444.237ON110298900.093
Kpol_483.104.237ON111884880.17
TDEL0E013304.238ON1657261880.18
CAGL0F01155g7.101ON1105216870.22
TDEL0G028102.351ON109471860.24
SAKL0H03322g4.237ON111147850.31
Kwal_26.93804.237ON110285850.34
AER044W4.237ON110353840.47
TBLA0I028904.237ON109866830.52
NCAS0B087001.67ON71572830.57
KLTH0D14080g4.237ON110278830.67
KAFR0A060404.237ON110268820.84
ZYRO0B04290g3.479ON731106791.5
Skud_11.1792.590ON92077772.8
ZYRO0A07524g2.351ON109071773.2
KLLA0E04115g8.315ON18761734.6
KAFR0G032004.238ON186956746.6
KLLA0C06116g6.32ON785155738.2
AFR683C1.67ON67782738.5
Ecym_10521.46ON492110729.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.154
         (1417 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  2595   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  2183   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  2147   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  2130   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1441   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1437   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1429   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1411   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1395   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1372   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1358   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1330   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1321   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1310   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1252   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1251   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1247   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1241   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1179   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1169   0.0  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             178   2e-44
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   169   1e-41
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   146   1e-34
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   140   1e-32
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   139   2e-32
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   138   4e-32
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   138   6e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   137   1e-31
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   137   1e-31
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   135   3e-31
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   135   3e-31
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   135   3e-31
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   134   5e-31
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   132   4e-30
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   129   2e-29
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   129   4e-29
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   128   4e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   127   1e-28
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   125   3e-28
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   124   9e-28
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   104   9e-22
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   102   5e-21
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   100   2e-20
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   100   2e-20
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   100   2e-20
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    99   4e-20
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    98   1e-19
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    98   1e-19
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    98   1e-19
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    97   1e-19
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    97   1e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    97   1e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    97   2e-19
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    97   2e-19
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    97   2e-19
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    96   3e-19
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    94   1e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    94   2e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    93   4e-18
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    92   5e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    92   7e-18
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    85   1e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    83   4e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    82   1e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    81   1e-14
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    81   2e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    80   3e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    79   6e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    79   6e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    78   1e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   4e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    76   6e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    75   1e-12
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    75   1e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    75   1e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    74   2e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    74   2e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    73   5e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   1e-11
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    69   7e-11
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    52   2e-05
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    49   7e-05
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    49   1e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   4e-04
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    47   5e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    46   0.001
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    44   0.004
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    43   0.005
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    43   0.006
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.014
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.016
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.018
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.019
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.020
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.020
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.021
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.022
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.022
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    41   0.026
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.026
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    41   0.027
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.028
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.031
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    41   0.032
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.034
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.039
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.041
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.051
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    40   0.054
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    39   0.085
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    39   0.093
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    39   0.17 
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    39   0.18 
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    38   0.22 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    38   0.24 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    37   0.31 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.34 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    37   0.47 
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    37   0.52 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.57 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.67 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.84 
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    35   1.5  
Skud_11.179 Chr11 complement(322462..325224) [2763 bp, 920 aa] {...    34   2.8  
ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highl...    34   3.2  
KLLA0E04115g Chr5 complement(372858..373421) [564 bp, 187 aa] {O...    33   4.6  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    33   6.6  
KLLA0C06116g Chr3 complement(536524..538881) [2358 bp, 785 aa] {...    33   8.2  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   8.5  
Ecym_1052 Chr1 complement(93652..95130) [1479 bp, 492 aa] {ON} s...    32   9.9  

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 2595 bits (6726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1294/1417 (91%), Positives = 1294/1417 (91%)

Query: 1    MCDSPLSKKQKRKATEEPELSLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYARSHT 60
            MCDSPLSKKQKRKATEEPELSLNDTDA              KTPDPNSPSLESSYARSHT
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPAR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240

Query: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300
            DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360

Query: 361  FEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISSLNRX 420
            FEIVDREKNSLESGKETA                     MLQSNSKLASTLEKISSLNR 
Sbjct: 361  FEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNRE 420

Query: 421  XXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480
                       LREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL
Sbjct: 421  FESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480

Query: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540
            VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL
Sbjct: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540

Query: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXXI 600
            KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQ           TR             I
Sbjct: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKI 600

Query: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660
            ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR
Sbjct: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660

Query: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720
            SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780

Query: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840
            SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS
Sbjct: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840

Query: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900
            DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA
Sbjct: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900

Query: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960
            DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK
Sbjct: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960

Query: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFE 1020
            ILQDQIMKIGGTKLHTQNSKVGSLCQRIDI                 DVLKYQKQLKNFE
Sbjct: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFE 1020

Query: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080
            QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID
Sbjct: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140
            EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140

Query: 1141 IKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXXX 1200
            IKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIP            
Sbjct: 1141 IKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIPKLCEEELKDLDI 1200

Query: 1201 XXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKK 1260
                    GLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKK
Sbjct: 1201 ELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKK 1260

Query: 1261 NRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320
            NRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT
Sbjct: 1261 NRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320

Query: 1321 NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380
            NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1321 NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380

Query: 1381 SLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417
            SLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD
Sbjct: 1381 SLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 2183 bits (5656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1088/1417 (76%), Positives = 1197/1417 (84%), Gaps = 1/1417 (0%)

Query: 1    MCDSPLSKKQKRKATEEPELSLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYARSHT 60
            M DSPLSK+QKRK  EEPELS+N  +               KTPDP+S SLESSYA+SHT
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSAT+SLHVPNLQPP+  SRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSRIELQKLYDSH+ SG+QQGRLFI+KLVL+NFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+LQ+CSVAVHFEY++
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240

Query: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300
            DEPSGTSRIDEEKPGLVITR+AF+NNSSKYYIN KES+YT+VTKLLK EGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360
            LQGEVENIAQMK KAEKESDDGLLEYLEDIIGTANYKPLIE+RLSQIE+LNEICLEK NR
Sbjct: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360

Query: 361  FEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISSLNRX 420
            FEIV+REKNSLESGKETA                     +LQSNSKLASTLEK SSLN+ 
Sbjct: 361  FEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKD 420

Query: 421  XXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480
                       L+EVDEV++Q K+IKDR+SS  S+EKTL+LEKRELE +RVSLEERTKNL
Sbjct: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480

Query: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540
            VNKMGKAEK LKST HSISE+EH+ +EL  +QTEHE E+KDLNQSLEEER ILDDIKLSL
Sbjct: 481  VNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSL 540

Query: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXXI 600
            KDKTKDISA+II+HEK+ EPWDLQLQEKKSQIQ           T+             I
Sbjct: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENI 600

Query: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660
             +KK RKQELQG +LDL + LKSLIDGRSQGE+DF +AHLKLKEMQ ILNAHRQRAMEAR
Sbjct: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660

Query: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720
            SSLSKA+NK+ VLTALS+LQKSGRINGFHGRLGDLGVID++FDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLR+FNLQP+ TPENVPRLFD+VKPKDPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840
            SVL+DTLVARDLKQAN VAYGKRRFRVVT+DGKLIDISGTMSGGGNHV+KGLMR+G NQS
Sbjct: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840

Query: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900
            D ++DYTPEEV KIE+EL+EREKNFRVANDTVHEME+ELKKVRDQEPD+ESQI RAEMEA
Sbjct: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEA 900

Query: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960
            DSL SEL LAE+Q KEAKMAYDK+VN+  Q+N++MK LEHLRGEY+DLQ+ET+TKKE+IK
Sbjct: 901  DSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960

Query: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFE 1020
             LQDQIMKIGGT L  QNSKV SL QRIDI                 DV K+QKQLKN E
Sbjct: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVE 1020

Query: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080
            +D ELSSNELKVIEEK +Q KL L +NDT++T I NLKS+L++Q EQLKE++ EME  ID
Sbjct: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140
            EFKSLE+EMKNKLEKLNSLL +IK++IKQQ+KELN+LSIRDVTHTL +LDNNQMD+++  
Sbjct: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140

Query: 1141 IKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXXX 1200
             +D Q+ +Q+  SG    E   E+ D D + H MNIDE S E+SRGIP            
Sbjct: 1141 GEDRQETNQEDISGEAKGETQGEEGDND-DRHCMNIDETSDEVSRGIPRLSEDELKELNI 1199

Query: 1201 XXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKK 1260
                     LTCYI+ T+VDIGVLEEY RRL EFKRRKLDLNQAVQKRDEVKEQLEILKK
Sbjct: 1200 ELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILKK 1259

Query: 1261 NRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320
             RFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT
Sbjct: 1260 KRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1319

Query: 1321 NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380
            NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1320 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1379

Query: 1381 SLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417
            SLRNNMFELAQQL+G+YKRDNRTKSTTVKNIDIL R+
Sbjct: 1380 SLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 2147 bits (5563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1076/1417 (75%), Positives = 1192/1417 (84%), Gaps = 1/1417 (0%)

Query: 1    MCDSPLSKKQKRKATEEPELSLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYARSHT 60
            MCDSPLSK+QKRKA EEPELSL+D+DA              KTPDPNSP+LE+SYA+SHT
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP  SSRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQKLY+SH+SS KQQGRLFIN+LVL+NFKSYAGRQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP+LQ+CSVAVHFEY+I
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGLVITR+AFKNNSSKYYIN KESSYTEVTKLLK EGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE+++QIE+LNE+CLEK NR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 361  FEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISSLNRX 420
            FEIVDREKNSLESGKETA                     +LQSNSKLASTLEKISSLN+ 
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 421  XXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480
                       L++V+EVK Q K+IKDRISS+ SREK L LE+RELEG+RVSLEERTKNL
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540
             NK+ K+E+  K TK SISE+EH  +EL  QQTEHE EIKDLNQ LEEER +LD+IKLSL
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXXI 600
            KDKTKDIS +II+HEKE EPWDLQLQEK+SQIQ           T+             I
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660
            +++K  KQELQ L+L+L ++L SL D RSQGE +F SAHLKL+EMQ++LN HRQRAMEAR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720
            SSLS+AQNK+ VLTALSKLQKSGRINGFHGRLGDLG+IDNSFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780
            VECAQ CIDYLRKNKLGYARFILLDRLR+FNLQPISTPENVPRLFD+VKPKDPKFSNAFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840
            SVL+DTLVAR LKQAN VAYG++RFRVVT+DGKLIDISGT+SGGGNHV KGLMRLGTNQS
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900
            ++I+DYTPEEV KIEHEL+ERE NFRVANDTVHEME ELK +RDQEP +ES+IS+ EMEA
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960
            DS+TSEL LAEQQ KEA++AY  A+++K QVN +MKNLE L+GE++DLQSET+TKKE+IK
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFE 1020
            +LQ +IMKIGGTKL  QNSKVGSLCQR+DI                 DVLK+QKQLKN E
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080
            +D ELSSNELK IEEKLK TKL L+END  MTE  NL+SELK++ EQLKE + E EENID
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENID 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140
            EFKSLEIEMKNKLEKLNSLL+HIK EI QQ+K L++LSIRDVTHTL++LDNN MD+V+  
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140

Query: 1141 IKDEQDADQDKPSGIPDDEK-IQEKDDADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXX 1199
             K EQ   ++K S    DEK IQE++   ++HHSM+IDE S+E+ RGIP           
Sbjct: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKELD 1200

Query: 1200 XXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILK 1259
                      L+ YI+ET+VDIGVLEEY RRL EFKRRKLDLNQAVQKRDEVK Q+E+LK
Sbjct: 1201 IELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260

Query: 1260 KNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1319
            K RFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1320 TNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379
            TNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1380 ISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416
            ISLRNNMFELAQQL+GIYKRDNRT+STTVKNIDIL R
Sbjct: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 2130 bits (5519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1071/1417 (75%), Positives = 1195/1417 (84%), Gaps = 1/1417 (0%)

Query: 1    MCDSPLSKKQKRKATEEPELSLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYARSHT 60
            M DSPLSK+QKRK+ +EPELSL+  DA               TP+P+ P+LE+SY++S+T
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNS TTSLHVPNLQPPK SSRGRD+K+Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQK+YD H+SS KQQ RLFIN+LVL+NFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP LQ+CSVAVHF+Y+I
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240

Query: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGL+ITR+AFKNNSSKYYINEKESSYTEVTKLLK EGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER+ QIE+LNE+CLEK NR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360

Query: 361  FEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISSLNRX 420
            FEIVDREKNSLESGKETA                     +LQSNSKLASTLEKISS N+ 
Sbjct: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420

Query: 421  XXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480
                       L++VDE+KAQ K+IKDRISS +S+EKTL LE+RELEG+RVSLEERTKNL
Sbjct: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480

Query: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540
            V+KM KAEK LKSTKHSISE+E+M +EL+ QQTEHE EIKDL Q LE+ER ILDDIKLSL
Sbjct: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540

Query: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXXI 600
            KDKTK+ISA+IIRHEKE EPWDLQLQEK+SQIQ           T+             I
Sbjct: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI 600

Query: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660
            ++KK  KQELQ L+LDL ++L SL D RSQGE++F SAHLKLKEMQ++LNAHRQRAMEAR
Sbjct: 601  LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660

Query: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720
            SSLSKAQNK+ VLTALS+LQKSGRINGFHGRLGDLGVID+SFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780
            VECAQHCIDYLRKNKLGYARFILLDRLR+FNLQPISTPENVPRLFD+VKPK+PKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780

Query: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840
            SVL+DTLVA++LKQAN VAYGK+RFRVVTVDGKLIDISGTMSGGGNHV KGLM+LGTNQS
Sbjct: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840

Query: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900
            D+++DYTPEEV KIE EL+ERE NFRVA+DTVHEMEEELKK+RD EPDLESQIS+AEMEA
Sbjct: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900

Query: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960
            DSL SEL LAEQQ KEA+MAY KAV++K Q+N VMKNLE LRGEY DLQSET+TKKE+IK
Sbjct: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960

Query: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFE 1020
             LQD+IMKIGG KL  QNSKV S+CQ++DI                 DV+K+QK L+N E
Sbjct: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSE 1020

Query: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080
            +D ELSS+ELKVIEE+LK TKLAL ENDTNM E  NLK ELK+Q EQLKE++ +MEE+I+
Sbjct: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESIN 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140
            EFKS+EIEMKNKLEKLNSLL +IK+EI QQ+K LN+LSIRDVTHTL MLD+N+MD V++ 
Sbjct: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140

Query: 1141 IKDEQDADQDKPSGIPDDE-KIQEKDDADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXX 1199
            +K+ Q+ DQ+  S    DE +I++ + + +N+H MNIDE S E+SRGIP           
Sbjct: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200

Query: 1200 XXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILK 1259
                      L+ Y+ ET+VDIGVLEEY RRL EFKRRKLDLN AVQKRDEVKEQL ILK
Sbjct: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260

Query: 1260 KNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1319
            K RFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1320 TNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379
            TNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1380 ISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416
            ISLRNNMFELAQQL+G+YKRDNRTKSTT+KNIDIL R
Sbjct: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1441 bits (3731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/1444 (53%), Positives = 995/1444 (68%), Gaps = 60/1444 (4%)

Query: 1    MCDSPLSKKQKRKATEE---PELSLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYAR 57
            M  +PLSKKQK  + EE   P  +  D D                 P+  +    SS+ +
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTH--------------PEVTA----SSFLK 42

Query: 58   SHTPRKLVLSSGENRYAFSQP----TNSATTSLHVPNLQPP-KVSSRGRDYKAYXXXXXX 112
            SHTPRKL+L S +N+Y  SQP    ++  ++SL VPNLQPP    SRGRD KAY      
Sbjct: 43   SHTPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPR 102

Query: 113  XXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQV 172
                     LEL+QLSP+KN+RIELQKLY+S     + + RL+I+KLVL +FKSYAG Q+
Sbjct: 103  SPGRSPVRKLELIQLSPIKNNRIELQKLYNS---KNQNKVRLYIDKLVLQDFKSYAGTQI 159

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSV 232
            VGPF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSEAFP++Q+CSV
Sbjct: 160  VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSV 219

Query: 233  AVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGID 292
             VHF+Y+IDE  GTS+I E++  LV+ R+AFKNNSSKYYIN KES+YTEVT+LLK+EGID
Sbjct: 220  EVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGID 279

Query: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNE 352
            LDHKRFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+ YK LIE+++ +IE+LNE
Sbjct: 280  LDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNE 339

Query: 353  ICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLE 412
            IC+EK  RFEIV+ EKNSLES K+ A                     + Q+N+KLA+TL+
Sbjct: 340  ICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLD 399

Query: 413  KISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVS 472
            KIS+                 E+D+   + ++  ++I++S ++E+ L  +KRE +G  VS
Sbjct: 400  KISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVS 459

Query: 473  LEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERII 532
            +EER KNL  K  KAEK L   +  I ++E + ++LQ  Q  ++ E  +L + L++ER  
Sbjct: 460  MEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSK 519

Query: 533  LDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXX 592
            LDDIKLSLKDKTKDIS++I  +EK+ EPW  ++QEK+ QIQ           ++      
Sbjct: 520  LDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEG 579

Query: 593  XXXXXXXIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAH 652
                   I   ++       ++ +L +   SL    S GE +   A  K KEM+ ILN+H
Sbjct: 580  LGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSH 639

Query: 653  RQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPR 712
            RQRA++ARS+L  A+NK+ VL+AL++LQKSGRINGFHGRLGDLGVI + +D+AISTAC R
Sbjct: 640  RQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSR 699

Query: 713  LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKD 772
            LDD+VVD+VEC Q CI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFD+V+P D
Sbjct: 700  LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPID 759

Query: 773  PKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGL 832
             KFSNAFYSVL+DTLVA D++QAN+VAYGKRR+RVVT+DGKLIDISGTM+GGG+HV KGL
Sbjct: 760  LKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGL 819

Query: 833  MRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQ 892
            M+L  +  + +E Y   +V KIE +LAERE NF++A+DT+ EM  ELK+++D+EP++E +
Sbjct: 820  MKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELE 879

Query: 893  ISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSET 952
            I++  M+ DSL  +L L EQQ KE +  Y   +N+K  ++     L+ LR E+  L+ ++
Sbjct: 880  IAKLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQS 939

Query: 953  RTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKY 1012
            ++KKE+I  L+++IMKIGG +L  QNSKV SL +RI I                 ++ K 
Sbjct: 940  QSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKV 999

Query: 1013 QKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERL 1072
            Q+  K  E D     N+L+ ++  +   +  L E +     I N K +L  Q E LKE++
Sbjct: 1000 QRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKI 1059

Query: 1073 TEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDN- 1131
             +MEE+++E+KS EIE+KNKLEKLNSLL + K +I+  ++EL    +RDVT +L+ + N 
Sbjct: 1060 KDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNE 1119

Query: 1132 ------------NQMDVVE------DGIKDE---QDADQDKPSGIPDDEKIQEKDDADNN 1170
                        N +DV        D   DE   +DAD D  + I + E+     DAD  
Sbjct: 1120 NANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQ-----DAD-- 1172

Query: 1171 HHSMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRR 1230
               M++D ++ E+S+GIP                     L  Y+  ++ DI +LEEY+RR
Sbjct: 1173 --IMDLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRR 1230

Query: 1231 LIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNA 1290
            L EFK+RKLDLN  V +RDEV+++LE LKK R DEFM GF+IIS+TLKEMYQMITMGGNA
Sbjct: 1231 LEEFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNA 1290

Query: 1291 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMD 1350
            ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMD
Sbjct: 1291 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1350

Query: 1351 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKN 1410
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKR N T+S T+KN
Sbjct: 1351 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKN 1410

Query: 1411 IDIL 1414
             DIL
Sbjct: 1411 KDIL 1414

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1437 bits (3721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/1378 (55%), Positives = 1001/1378 (72%), Gaps = 13/1378 (0%)

Query: 46   PNSPSLESSYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKA 105
            P + S ++++A + TPRKLV+ +G+NRYA S   + +++SL VP LQPP  SSRGR  K 
Sbjct: 37   PTTSSSQNTFAHAKTPRKLVVGNGDNRYAHSS-QSISSSSLQVPPLQPPATSSRGRGSKT 95

Query: 106  YXXXXXXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFK 165
            Y               LEL+Q+SP+KNSR+ELQK+YD+ ++  +   RL I++L+L +FK
Sbjct: 96   YSQSPPRSPGRSPTRKLELIQISPLKNSRLELQKIYDAQQNQARHT-RLCIDQLILQDFK 154

Query: 166  SYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP 225
            SYAGRQVVGPF+TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +P
Sbjct: 155  SYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYP 214

Query: 226  DLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKL 285
             L +CSV VHF+Y+IDEPSG +RIDEEKP LV+TR+AF+NN+SKYY+N++E++Y EVTKL
Sbjct: 215  SLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKL 274

Query: 286  LKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLS 345
            LKKEG+DLDHKRFLILQGEVENIAQMK KAE+E +DGLLEYLEDIIGTA YKPLIE+ L+
Sbjct: 275  LKKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLA 334

Query: 346  QIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNS 405
             +ESLN+IC+EK NRF+IVDREKNSLE+GKE A                     +L SN 
Sbjct: 335  DMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNM 394

Query: 406  KLASTLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRE 465
            KL +TL+KI++LN+             +E+D+++A   +++ ++ +  + EK L  +KRE
Sbjct: 395  KLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRE 454

Query: 466  LEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQS 525
            L+G  V  EE+ KN   K  KAEK L S   SIS SE    EL++ Q ++E  +K+LN+ 
Sbjct: 455  LDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQ 514

Query: 526  LEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXT 585
             E E++ L+ IK SLKDKT  IS +I + EKE EPW+ QLQEKK+QIQ            
Sbjct: 515  TEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEA 574

Query: 586  RXXXXXXXXXXXXXIISKKQRKQELQGLV-LD-LSQRLKSLIDGRSQGERDFRSAHLKLK 643
                          I ++KQ  Q LQG   LD L  + KS+ +  S GE++  +A ++LK
Sbjct: 575  EAKLAQEIDQFKQEIETRKQ--QILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLK 632

Query: 644  EMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFD 703
            EMQ ILN  RQ+A++ARS+LS A+NK+ VLTALS+LQKSGRI+GFHGRLGDLGVID  +D
Sbjct: 633  EMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYD 692

Query: 704  VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPR 763
            VAISTACPRL+D+VV+TVEC Q CI+YLRKNKLGYARFILLD+LRKFNL  I+TPE+VPR
Sbjct: 693  VAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPR 752

Query: 764  LFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSG 823
            LFD++ PKDPKFS+AF+SVL +TLVA DLKQAN+VAYGK+RFRVVT+DG LIDISGTMSG
Sbjct: 753  LFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSG 812

Query: 824  GGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVR 883
            GG+ V +GLM++  N++++IE Y+ EEV ++E  L EREKNF+VA+DT+++MEE+LK ++
Sbjct: 813  GGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLK 872

Query: 884  DQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRG 943
            ++EP +E+ IS+  ME +S  SE+ + E Q  E++ AY    +   ++ E +++++ L+ 
Sbjct: 873  EKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKD 932

Query: 944  EYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXX 1003
            E++ +Q++T++KK +I+ L+++IM+IGG +L  Q+SKV S+ QRIDI             
Sbjct: 933  EFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIK 992

Query: 1004 XXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKD 1063
                ++ K  K      +D E  + E++ ++  ++  + +L +   ++T + + K  L +
Sbjct: 993  KTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIE 1052

Query: 1064 QGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVT 1123
            +   L+++L ++ E+I  FKS E+EMKN+LEKLNSL  H+K EIK  +++L DL IRDVT
Sbjct: 1053 ESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVT 1112

Query: 1124 HTLQML---DNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKD---DAD-NNHHSMNI 1176
              L  L    NN  D  E+ + D ++++     G  +++ +  +D   DA+    + M++
Sbjct: 1113 QILHDLKDESNNASDPSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDV 1172

Query: 1177 DEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKR 1236
            ++      RG+                      L  +++ ++ DI VLEEY RRLIEFK 
Sbjct: 1173 EDGGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKS 1232

Query: 1237 RKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVD 1296
            R+LDLNQAV++R++VKE+L+ LKK RFDEFM GF IISMTLKEMYQMITMGGNAELELVD
Sbjct: 1233 RRLDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVD 1292

Query: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAAL 1356
            +LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAAL
Sbjct: 1293 TLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1352

Query: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414
            DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKRDN+TKS T+KNID +
Sbjct: 1353 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFV 1410

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1429 bits (3699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 763/1424 (53%), Positives = 985/1424 (69%), Gaps = 34/1424 (2%)

Query: 1    MCDSPLSKKQKRKATEEPEL-SLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYARSH 59
            M D+PL+K+Q+    E  E  ++N +                 T  P + +  S+   SH
Sbjct: 1    MPDTPLTKRQRVNDNESREFEAVNGS-----------------TKSPLTSNSNSTI--SH 41

Query: 60   TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXXXXXXXXXXX 119
            TP+KLV+ + ++  + SQP  S ++SL  P+LQ P  SSRGR+ + Y             
Sbjct: 42   TPKKLVIGTNDDTTSQSQPIVS-SSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPT 100

Query: 120  XXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTS 179
              LEL+++SPVK +R+ELQ+LYD+ +S  +   RL INKLVL +FKSYAGRQVVGPFH+S
Sbjct: 101  RKLELIKISPVKKNRLELQRLYDAEQSQ-RNAARLCINKLVLQDFKSYAGRQVVGPFHSS 159

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYI 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  P+L++CSV VHF+Y+
Sbjct: 160  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYV 219

Query: 240  IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFL 299
            +DEP GT+RIDEEKP LV+TR+AFKNNSSKYY+N+KES+YTEVT+LLKKEGIDLDHKRFL
Sbjct: 220  VDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFL 279

Query: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKAN 359
            ILQGEVENIAQM+PKAEKE +DGLLEYLEDI GTA YKP IE  L +IE LNE C+EK N
Sbjct: 280  ILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKEN 339

Query: 360  RFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISSLNR 419
            RF IVD+EK+SLE+GK+ A                     + Q++ KL STL+K S L  
Sbjct: 340  RFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKG 399

Query: 420  XXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKN 479
                        L+EVD +K + K +  RI +    EK L  +KR L+  RV++EE+ K+
Sbjct: 400  QLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKS 459

Query: 480  LVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLS 539
            +  K  KAEK LKS +HS++ +E   +EL++ Q ++EKE++DLNQ L  ER  L+D+K+S
Sbjct: 460  VNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKIS 519

Query: 540  LKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXX 599
            LK+KT +ISA I ++EK+ EPWD QLQ+K+++IQ           T              
Sbjct: 520  LKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNE 579

Query: 600  IISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEA 659
            I    + K   + ++ +L Q    +         +  SA  +LK+M  IL A RQR ++A
Sbjct: 580  IARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDA 639

Query: 660  RSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVD 719
            R++ S AQNK+ VLTAL+KLQKSGRI+GFHGRLGDLGVID  +DVAISTACPRL+D+VV+
Sbjct: 640  RAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE 699

Query: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAF 779
            +VEC Q CI+YLRKNKLGYARFILLD+LRKF+   I TPENVPRLFD+VKPKD KF  AF
Sbjct: 700  SVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAF 759

Query: 780  YSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQ 839
            YSVL+DTL A+ L QAN+VAYGK+RFRVV++DGKLIDISGTMSGGG+HV++GLMRL  N 
Sbjct: 760  YSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNN 819

Query: 840  SDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEME 899
            S   + ++PEEV ++E+EL E+EK+F++A+DT  EME++LKK++D+ P+++ ++S+  ME
Sbjct: 820  SYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVME 879

Query: 900  ADSLTSELMLAEQQAKEAKMAYDKAV--NEKTQVNEVMKNLEHLRGEYEDLQSETRTKKE 957
             +S  SEL L E+   E   A  KA   NE+ Q+ E    ++ L+ E   L  +T T ++
Sbjct: 880  TESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEA--RVKTLKDEQRALSDQTTTTRQ 937

Query: 958  QIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLK 1017
            +I +L+D+IM+IGG++L  QNSKV S  QR++I                 ++ K  K + 
Sbjct: 938  KIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVG 997

Query: 1018 NFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEE 1077
            N ++D +L S E+  ++E     +  L   + ++ E  +L  E+ ++ +QLK+RL +ME 
Sbjct: 998  NTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEA 1057

Query: 1078 NIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLD-----NN 1132
               EFKSL+IE+ +KLEKLN+LL HI  E++Q + +LN+L IRDVT TLQ+LD     NN
Sbjct: 1058 GFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNN 1117

Query: 1133 QMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGIPXXXX 1192
                 E   K  + AD  +  G   D  ++E+    +N   M +DE   E+  G+P    
Sbjct: 1118 SKMPNELQEKRTEGADATRQEGEESDVSMEEE---KSNDEVMEVDEKPHELENGLPRVSE 1174

Query: 1193 XXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVK 1252
                             L  Y++  +VD+ +LEEY +RL E KRRK+DLN+AV +RD ++
Sbjct: 1175 AELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMR 1234

Query: 1253 EQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1312
            E+L  LKK RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP
Sbjct: 1235 EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1294

Query: 1313 KKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT 1372
            KKSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1295 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354

Query: 1373 KNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416
            KNAQFIVISLRNNMFELAQQL+GIYK  N TKS ++KN DIL R
Sbjct: 1355 KNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1411 bits (3652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 757/1370 (55%), Positives = 957/1370 (69%), Gaps = 23/1370 (1%)

Query: 56   ARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-KVSSRGR-DYKAYXXXXXXX 113
            ++SHTPRKL+L   +NRYA     + +++S  VP LQPP   SSRGR D K+Y       
Sbjct: 51   SKSHTPRKLILGQNDNRYA-FSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRS 109

Query: 114  XXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVV 173
                    LEL+QLSPVKN+RI+L++LYD+H S  K++ RLFINKL L+NFKSYAG+QVV
Sbjct: 110  PGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVV 168

Query: 174  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVA 233
            GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPDL +CSV 
Sbjct: 169  GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVD 228

Query: 234  VHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDL 293
            V F Y IDE  G ++I E KP LVI+R+AFKNNSSKYYIN KES+YT+VTKLLK+EGIDL
Sbjct: 229  VEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDL 288

Query: 294  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEI 353
            DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ L +IESLNEI
Sbjct: 289  DHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEI 348

Query: 354  CLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEK 413
            C+EK NRFEIVDREKNSLESGK  A                     + Q+NSKL +TL+K
Sbjct: 349  CIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQK 408

Query: 414  ISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSL 473
            IS+LN               E++  K    + + +I      EK     KR LEG  VSL
Sbjct: 409  ISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSL 468

Query: 474  EERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIIL 533
            +E+ KNL  K  K EK + +T+ +IS      QEL++ Q E+  E++ LNQ L+ ER  L
Sbjct: 469  DEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESL 528

Query: 534  DDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXX 593
            + +KL LK+KT  IS +I+ HE + EPW++++QEKK++IQ            +       
Sbjct: 529  EAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDI 588

Query: 594  XXXXXXIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHR 653
                  + ++   K + +  +++L ++  S+    S GE +      KLKEM+ +LN  R
Sbjct: 589  KVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQR 648

Query: 654  QRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRL 713
            QRA EAR +L+  QN+  VLTAL KLQKSGRI GFHGRLGDLG IDN++DVA+STACPRL
Sbjct: 649  QRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRL 708

Query: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDP 773
            DD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFD++KPKD 
Sbjct: 709  DDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDS 768

Query: 774  KFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLM 833
            KF  AFYSVL+DTLVA+DLKQAN+VAYG+RR+RVVT+DGKLID+SGTMSGGGNHV KGLM
Sbjct: 769  KFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLM 828

Query: 834  RLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQI 893
             L     +  +DY PE+V +IE +L+++EKNF +AN+  +EME EL+K+ +++P++E +I
Sbjct: 829  MLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEI 888

Query: 894  SRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETR 953
            S+  ME D+ ++E+   E+Q +E     +  + +  ++   ++NL+ L+ E+  LQ +T+
Sbjct: 889  SKIIMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTK 948

Query: 954  TKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQ 1013
             KK++I  L+++IMKIGG +L  QNSKV S+ QRIDI                 ++ K +
Sbjct: 949  AKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAK 1008

Query: 1014 KQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLT 1073
            K L   + D  L ++++K I E++ +   +L   D ++ E    K  LKD+ ++LK+++ 
Sbjct: 1009 KTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVV 1068

Query: 1074 EMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQ 1133
            ++EENI+EFKS EIE+ NKLEKLN LL HIKN+IK  +  L+ L++R +   L  L    
Sbjct: 1069 DLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMAL---- 1124

Query: 1134 MDVVEDGIKDEQDADQDKPSGIPDDEKIQEK------DDADNNHHSMNIDEMSSEISRGI 1187
                     DE+   +   +G   DE+I ++      + A  +  SM+ID  +  IS G+
Sbjct: 1125 ---------DEESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGL 1175

Query: 1188 PXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQK 1247
            P                     L  YI  T  +I VLEEYV+RL EFK RKLDLN AV K
Sbjct: 1176 PILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDK 1235

Query: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
            R+ V++QLE LKK R++EFM+GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF
Sbjct: 1236 RETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1295

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1367
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1296 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1355

Query: 1368 IKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417
            IKERTKNAQFIVISLRNNMFELAQQL+GIYK +NRT S T+KN +IL  D
Sbjct: 1356 IKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1395 bits (3611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 762/1432 (53%), Positives = 979/1432 (68%), Gaps = 31/1432 (2%)

Query: 1    MCDSPLSKKQKRKATEEPELSLNDTDAXXXXXXXXXXXXXXKTPDPNSPSLESSYARSHT 60
            M DSPL+KKQK +  +  ++  N T +               +P             S T
Sbjct: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSP------TRQDRLPSPT 54

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKV-SSRGRDY--KAYXXXXXXXXXXX 117
            PRKLVL S E +YA+S    S ++SL VPNLQPP V  SRGR +  ++            
Sbjct: 55   PRKLVLGSPEKKYAYS--QPSTSSSLSVPNLQPPNVDGSRGRRFYSQSPPRSPHRSPNRS 112

Query: 118  XXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQ-GRLFINKLVLDNFKSYAGRQVVGPF 176
                LEL+QLSPVKN+R ELQK+YD     G Q   RL I+KL L NFKSYAG Q++GPF
Sbjct: 113  PTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPF 172

Query: 177  HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHF 236
            HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSEA+P+L++CSV +HF
Sbjct: 173  HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHF 232

Query: 237  EYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHK 296
             Y++DE  GT+R D+EKP +VITR+AF+NNSSKYYI+ KES+YTEVT+LL+ +GIDLDHK
Sbjct: 233  RYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHK 292

Query: 297  RFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLE 356
            RFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGTA YK  IE  L +I++LN++C+E
Sbjct: 293  RFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVE 352

Query: 357  KANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISS 416
            K NRFE+V++EKNSLESGK+ A                     + Q   KL+ TL KIS 
Sbjct: 353  KENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISE 412

Query: 417  LNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEER 476
            LN              REV +++ +  D K ++       K L+ ++R ++  + S+EE+
Sbjct: 413  LNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEK 472

Query: 477  TKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDI 536
             +NL  K  KAEK LKST++S+++S+H  +EL   Q ++++++  LN+SL EER  LD+I
Sbjct: 473  QRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEI 532

Query: 537  KLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXX 596
            KLSL+DKT +ISA+I  HE++ EPW+ QLQEKKSQ++           ++          
Sbjct: 533  KLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQL 592

Query: 597  XXXI--ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQ 654
               I   ++K   QE+    L   Q   +++     GE++  SA  KL EM+ +L +HRQ
Sbjct: 593  KTEIEAFAEKNNVQEIAIHKLQCEQ--ANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650

Query: 655  RAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLD 714
            RAMEARS+LS  +NKN VL+AL +LQ+SGRI GFHGRLGDLG ID+ +DVAISTACPRLD
Sbjct: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710

Query: 715  DVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPK 774
            D+VVD VEC Q CI++LRKNKLGYARFI+LD+LRKFNL PI TPE VPRLFD+V+ K+ K
Sbjct: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770

Query: 775  FSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMR 834
            F  AFYSVL+DTLV  DLKQAN+VAYGKRRFRVVT+DGKLID SGT+SGGG HVMKGLM+
Sbjct: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK 830

Query: 835  LGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQIS 894
               ++      YTPEEV  IE EL EREKNF +A +T H+MEE LKK +D+EP++E +I+
Sbjct: 831  ---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIA 887

Query: 895  RAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRT 954
            +  ++ +S ++EL L ++Q KE +   D    E  ++ +    L+ L  EY+++++ET+ 
Sbjct: 888  KRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKN 947

Query: 955  KKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQK 1014
            K++ I  L+++IMKIGGTKL  QNSKV S+ ++I+I                 D+ + + 
Sbjct: 948  KQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLEN 1007

Query: 1015 QLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTE 1074
            Q +    D E  + E+  I     + +  + + DT++ E  +LK E++++ E++K  L E
Sbjct: 1008 QCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEE 1067

Query: 1075 MEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQM 1134
               N  +FKS+EIE+ N+LEKLN L  HIK EIK    ELN L IRD+T TLQ L+  ++
Sbjct: 1068 KTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKL 1127

Query: 1135 --------DVVEDGIKDEQDADQDKPSGIP-DDEKIQEK---DDADNNHHSMNIDEMSSE 1182
                    +V ++ ++ EQ      P+ +  D+E+  E+      D    SM+IDE  +E
Sbjct: 1128 PEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENE 1187

Query: 1183 ISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLN 1242
             S G+P                     L  Y++   VDI VLEEY RRL E+K+RKLDLN
Sbjct: 1188 TSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLN 1247

Query: 1243 QAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFS 1302
            QAV KRDEV++  E LKK R D+FM GF+IISMTLKEMYQMITMGGNAELELVDSLDPFS
Sbjct: 1248 QAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFS 1307

Query: 1303 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVS 1362
            EGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVS
Sbjct: 1308 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVS 1367

Query: 1363 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414
            IVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK +N T+STT++NIDIL
Sbjct: 1368 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDIL 1419

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1372 bits (3550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1391 (52%), Positives = 960/1391 (69%), Gaps = 23/1391 (1%)

Query: 48   SPSLESSYARSH------TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-KVSSRG 100
            SP+ + + A SH      TP+KL+L   ++           ++SL  P+L PP + SSRG
Sbjct: 39   SPTTQDAAAVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRG 98

Query: 101  RDYKAYXXXX----XXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFI 156
            R  + Y                   LEL+QLSPVKNSRI LQK+Y+S     KQ  RL I
Sbjct: 99   RTARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQKIYESKNE--KQIERLCI 156

Query: 157  NKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSD 216
            +KLVL +FKSYAG QVVGPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSD
Sbjct: 157  DKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSD 216

Query: 217  LIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKE 276
            LIHKSE FPDL++CSV VHFEY+ID+P GT+ I+  K  LVITR+AFKNN+SKYYIN KE
Sbjct: 217  LIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKE 276

Query: 277  SSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANY 336
            S+YT VTKLLK EGIDLDH RFLILQGEVENIAQMKPKAE + DDGLLEYLEDIIGTA Y
Sbjct: 277  SNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKY 336

Query: 337  KPLIEERLSQIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXX 396
            KPLIE++  +IE+LNEIC+EK NRFEIVDREK SLESGK+ A                  
Sbjct: 337  KPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLY 396

Query: 397  XXXMLQSNSKLASTLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSRE 456
               + Q N KL++TLEK+S++                +++E+   + ++   I +S  +E
Sbjct: 397  QYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQE 456

Query: 457  KTLSLEKRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHE 516
            K L+++KR  +  RVSLEE+ KN++ K  K EK L+    +IS ++   ++L + ++E+E
Sbjct: 457  KKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYE 516

Query: 517  KEIKDLNQSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXX 576
             ++ +LN  L+ ER +L++IK+SLKDKT + S +I +HEKE EPW+LQLQ KKSQIQ   
Sbjct: 517  SQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKE 576

Query: 577  XXXXXXXXTRXXXXXXXXXXXXXIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFR 636
                     R             I  K + K   +  +  L   L  +    S G+ ++ 
Sbjct: 577  SEISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYT 636

Query: 637  SAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLG 696
            +A  KL+EM+ +LN HRQ+A++AR+SLS  +NKN VL +L +LQKSGRI+GF+GRLGDLG
Sbjct: 637  NAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLG 696

Query: 697  VIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPIS 756
             ID+ +D+AISTACPRL+D+VV+TVEC Q CI+YLRKNKLGYARFILL++LR F++  IS
Sbjct: 697  AIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKIS 756

Query: 757  TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLID 816
            TP NVPRLFD+V   DPKF  AFYSVL+DTLV  +LK AN+VAYG +RFRVVT+ G+LID
Sbjct: 757  TPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELID 816

Query: 817  ISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEME 876
            +SGTMSGGG    +GLM+L  + +   + YT E+V KIE ELA REKNF +AN+T  EME
Sbjct: 817  VSGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEME 876

Query: 877  EELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMK 936
             EL++++D++PD+E +IS+ E+E  S  +E  L +QQ  E + + D+ ++   +++ +  
Sbjct: 877  TELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEH 936

Query: 937  NLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXX 996
             L  L+ +Y+ LQ ET++KK++IK L+D+IMK+GG KL  Q+SKV S+ Q+ DI      
Sbjct: 937  ELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHK 996

Query: 997  XXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISN 1056
                       ++ +  K+      D   S+++L+  + +L +   +L+E +T + E+  
Sbjct: 997  KDKNDLKKAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEF 1056

Query: 1057 LKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELND 1116
             + E     E LK++L E EEN++ FK  ++E +NK EKLN+LL  IK +I+  D EL  
Sbjct: 1057 SREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQS 1116

Query: 1117 LSIRDVTHTLQMLDNNQMDVVEDGIKDEQDA-DQDKPSGIPDDEKIQ----EKDDAD--- 1168
            L IRD+THTLQ LDN  +D  E+ +  + +A      + + + E ++    E +++D   
Sbjct: 1117 LKIRDITHTLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSP 1176

Query: 1169 --NNHHSMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEE 1226
              NN   M IDE ++EIS+GIP                     L  YI+  +V+I VLEE
Sbjct: 1177 DANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEE 1236

Query: 1227 YVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITM 1286
            Y RR+ E+KRRKLDLN AV +R++V+E L+ LKK RF+EFM GF +IS+TLKEMYQMITM
Sbjct: 1237 YARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITM 1296

Query: 1287 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPL 1346
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PTPL
Sbjct: 1297 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1356

Query: 1347 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKST 1406
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYK +N+TKS 
Sbjct: 1357 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416

Query: 1407 TVKNIDILKRD 1417
            T++N DI+ RD
Sbjct: 1417 TLQNNDIINRD 1427

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1358 bits (3514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/1394 (51%), Positives = 960/1394 (68%), Gaps = 38/1394 (2%)

Query: 49   PSLESS-----YARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQ----PPKVSSR 99
            P L+SS     + ++ TPRKL++   EN+YA SQPT SA++SL VP LQ    P    SR
Sbjct: 51   PKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSR 110

Query: 100  GRDYKAYXXXX----XXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLF 155
            GR  K Y                   LEL+QLSP+KNSR+ELQKLYD+H +   +  RL+
Sbjct: 111  GRRIKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLY 170

Query: 156  INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 215
            I+KLVL NFKSYAG Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS
Sbjct: 171  IHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 230

Query: 216  DLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRID--EEKPGLVITRRAFKNNSSKYYIN 273
            DLIHKSE F +L  CSV VHF Y+ DE +  +  D  E +  LVITR+AFKNNSSKY+IN
Sbjct: 231  DLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFIN 290

Query: 274  EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
             KES++TEVTKLLK++GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT
Sbjct: 291  GKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGT 350

Query: 334  ANYKPLIEERLSQIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXX 393
             +YKPLIE++  +IE++NE+C+EK NRF IVD EKNSLE  K+ A               
Sbjct: 351  KHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKS 410

Query: 394  XXXXXXMLQSNSKLASTLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSST 453
                  +  +N K+ +TL +I SL              ++EV+ ++    + K+ ++S T
Sbjct: 411  KLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLT 470

Query: 454  SREKTLSLEKRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQT 513
            + EK+L   KRE+    VSLEE TKNL  K+ KA+  ++S+K  IS++EH  QE  + Q 
Sbjct: 471  TEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQE 530

Query: 514  EHEKEIKDLNQSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQ 573
            E+E E+ DL++  E E  IL DIKL LKDKT   S +I   EKE EP + ++QEKKSQI+
Sbjct: 531  EYEAEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIK 590

Query: 574  XXXXXXXXXXXTRXXXXXXXXXXXXXIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGER 633
                       ++             ++  ++  ++ +  V DL++  ++L+  + +G++
Sbjct: 591  LVEMEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDK 650

Query: 634  DFRSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLG 693
            + + A +KL EM+ ILN+HRQ+ MEARS++S AQNKN VLT+L ++Q+SGRINGFHGRLG
Sbjct: 651  ECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLG 710

Query: 694  DLGVIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQ 753
            DLG+I + +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ 
Sbjct: 711  DLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMS 770

Query: 754  PISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGK 813
            PI TPENVPRLFD+VKPK+ +F+ A YSVL+DTLVA+DLKQAN+VAYGKRRFRVVT+DG+
Sbjct: 771  PIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQ 830

Query: 814  LIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVH 873
            LIDISGTMSGGG+ V KGLM L T  S   E ++ E++ K+E ELA REK F VA++T H
Sbjct: 831  LIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFH 890

Query: 874  EMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNE 933
             ME+EL+K+ D+EP LE +IS+  ++ D+LT ++ L   Q  E    Y+K++ +   ++ 
Sbjct: 891  SMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDL 950

Query: 934  VMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXX 993
            ++ NLE L  E + LQ +++T  E++  L+D+IM+IGG++L  QNSKV SL QRIDI   
Sbjct: 951  LLGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQA 1010

Query: 994  XXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTE 1053
                          ++ K +K L    ++   S+ E+   + + +  K +L + + ++  
Sbjct: 1011 KLKKSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLES 1070

Query: 1054 ISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKE 1113
            I + K  L+ + E   ++L E  EN++EFK++++E++NK+E+ NS+L ++K E  Q  +E
Sbjct: 1071 IQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEE 1130

Query: 1114 LNDLSIRDVTHTLQMLDNNQMDVVEDGIKDEQD--ADQDKPSGIPDDEKIQEKDDADNNH 1171
            LN+  +RDVTHTL +L        E+G +  Q      D+ +   D+E +   D    N 
Sbjct: 1131 LNNFRLRDVTHTLDLLRE------EEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENM 1184

Query: 1172 H---------------SMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINE 1216
            +               SM++D+    +S+GIP                     L  +IN 
Sbjct: 1185 NTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINN 1244

Query: 1217 TSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMT 1276
             S++I +LEEY +RL+EFK+RK+DLN +V +R+++   +E LKK R++EFM GF+IISMT
Sbjct: 1245 VSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMT 1304

Query: 1277 LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1336
            LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVF
Sbjct: 1305 LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1364

Query: 1337 ALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            ALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GI
Sbjct: 1365 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGI 1424

Query: 1397 YKRDNRTKSTTVKN 1410
            YK +N TK+ T++N
Sbjct: 1425 YKHENMTKNATIRN 1438

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1330 bits (3442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1374 (52%), Positives = 937/1374 (68%), Gaps = 26/1374 (1%)

Query: 54   SYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSS---RGR-DYKAYXXX 109
            + ++SHTPRKL+L   +NRYAFSQPT SA+ SL VP+LQPP+ SS   RGR D K Y   
Sbjct: 51   AISKSHTPRKLILHQSDNRYAFSQPTVSAS-SLQVPSLQPPETSSSSSRGRRDIKVYSQS 109

Query: 110  XXXXXXXXXXXXLELLQLSPVKNSRI-ELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYA 168
                        LEL+QLSPVKN+RI +LQ+LY+S      ++ RLFINKLVL+NFKSYA
Sbjct: 110  PPRSPGRSPTRKLELIQLSPVKNNRIRKLQELYNSQI----KKERLFINKLVLNNFKSYA 165

Query: 169  GRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQ 228
            G QV+GPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FP+L 
Sbjct: 166  GEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLP 225

Query: 229  ACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKK 288
            +CSV V F+Y++D+ +G+S+ID+ KP L+ITR+AFKNNSSKY+IN KESSYTEVTKLLK+
Sbjct: 226  SCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKE 285

Query: 289  EGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIE 348
            EGIDLDHKRFLILQGEVENIAQMKPKAE+E DDGLLEYLEDIIGTA+YK  IE+   +++
Sbjct: 286  EGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVD 345

Query: 349  SLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLA 408
            +LNEIC+EK NRFEIV+REKNSLES K  A                     +L+ + KLA
Sbjct: 346  TLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLA 405

Query: 409  STLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEG 468
            STL+K+S L               RE ++++   K +  +I S     K  + +KREL+ 
Sbjct: 406  STLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQN 465

Query: 469  SRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEE 528
             + SLEE+ K+   K  KA K++  +K  +    +  + L   Q E E  ++ L   L++
Sbjct: 466  KKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKK 525

Query: 529  ERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXX 588
            E+ +L++IKLSLKDKT DIS +I +HE+E EPW  QLQEKK +IQ            +  
Sbjct: 526  EKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSK 585

Query: 589  XXXXXXXXXXXIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRI 648
                       +  + + K+  +  ++DL  +  ++     +GE +  +A  K+K+MQ +
Sbjct: 586  LKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHV 645

Query: 649  LNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIST 708
            L   RQ+ M+ARS L+  +NK+ VL+AL KLQKSGRI+GF+GRLGDLGVIDN +D+AIST
Sbjct: 646  LQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAIST 705

Query: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVV 768
            A  RLDD+VVD+VEC QHCI+YLRKNKLGYARFILL++LR   L+ I TPENV RLFD+V
Sbjct: 706  ASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLV 765

Query: 769  KPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHV 828
            KP    F  AFYSVL++TLVA+DLKQAN+VAYG  RFRVVT+DGKLIDISGT++GGG   
Sbjct: 766  KPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQT 825

Query: 829  MKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPD 888
             +GLM+L     + I+ Y+ +++ KIE EL ERE NF+ ANDT  EME+ L++++D++P+
Sbjct: 826  AQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPE 885

Query: 889  LESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDL 948
            LE +IS+  M+ D  + EL   + Q K+    Y++    K +V E+   L  L+ EY+ L
Sbjct: 886  LELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLL 945

Query: 949  QSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXD 1008
               T+   E+I  L+ +IM+IGG  L  QNSKV S+ Q IDI                 +
Sbjct: 946  LDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENE 1005

Query: 1009 VLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQL 1068
            + + +K L   E D +  S E+    ++++  + +L   D    ++ N  SEL+ +   L
Sbjct: 1006 IRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNL 1065

Query: 1069 KERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTL-Q 1127
            KE++ E E    +FKS EI++K++LEKLN+LL HIK  IK+ D++L  L +R+ T     
Sbjct: 1066 KEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGD 1125

Query: 1128 MLDNNQMDVVEDGIKDEQDADQDKPSGIP--DDEKIQEKDDADNNHHS----MNIDEMSS 1181
              DNN ++ V+               G+P  D  K+  +++  N  +S    M ID+++ 
Sbjct: 1126 EGDNNSINGVDRT---------SHGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVAD 1176

Query: 1182 EISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDL 1241
            E S GIP                     L  Y+  T+V+I VLEEY RRL ++  RKLDL
Sbjct: 1177 EFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDL 1236

Query: 1242 NQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1301
            NQAV++R+ +K+ L+ LKK R+DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPF
Sbjct: 1237 NQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPF 1296

Query: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361
            SEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNV
Sbjct: 1297 SEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1356

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILK 1415
            SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDN+TKS  ++N D LK
Sbjct: 1357 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFLK 1410

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1321 bits (3419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/1400 (52%), Positives = 935/1400 (66%), Gaps = 75/1400 (5%)

Query: 56   ARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPK---VSSRGRDYKAYXXXXXX 112
            +RS TPRKLVL S + R+AFSQP +S+++  +VP+LQP K    SSRGR    Y      
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQPVSSSSS--NVPHLQPLKNELSSSRGR---VYSQSPPR 86

Query: 113  XXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQV 172
                     LEL+QLSP+K SR+E QK  +S    G  Q RL I++LVL NFKSYAG QV
Sbjct: 87   SPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQ-RLCIDRLVLHNFKSYAGTQV 145

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSV 232
            VGPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  PDL +C V
Sbjct: 146  VGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHV 205

Query: 233  AVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGID 292
             + F+Y+ DEP GT+ I ++KP +VI R+AF+NN+SKYY+N KESSYT +T+LL+ EGID
Sbjct: 206  DIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGID 265

Query: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNE 352
            LDHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGTA YKPLIE  LS+I  LN+
Sbjct: 266  LDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLND 325

Query: 353  ICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLE 412
            IC EK NRFEIV+REK+SLE GK  A                     + ++  KL ST E
Sbjct: 326  ICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKE 385

Query: 413  KISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVS 472
            KI+                  E+  +KA  + +K  +      EK L+LEKR  +  RVS
Sbjct: 386  KIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVS 445

Query: 473  LEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERII 532
            LEE+ KNL  K  K+ ++L+S   SIS ++   +EL   Q +HEK++ +LN +++EE+  
Sbjct: 446  LEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEK 505

Query: 533  LDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXX 592
            LD+IK SLKDK   IS +I   EKE EPW+++LQEKK+Q++           +       
Sbjct: 506  LDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQD 565

Query: 593  XXXXXXXIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAH 652
                   I   + +  E +G V  L +    +    + G+ +  +A  K+KEM+ IL AH
Sbjct: 566  IILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAH 625

Query: 653  RQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPR 712
            RQR+++ARSSLS  +NKN VL AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAISTACPR
Sbjct: 626  RQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR 685

Query: 713  LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKD 772
            LDD+VV+TVEC Q CI+YLRKNKLGYARFILLD+LR FNL PI TPENVPRL+D+V+P +
Sbjct: 686  LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNN 745

Query: 773  PKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGL 832
            PKF NAFYSVL+DTLVA+DLK+ANKVAYGK+R+RVVT+DGKLID+SGTMSGGGN   +G+
Sbjct: 746  PKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGM 805

Query: 833  MRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQ 892
            M+    QS+    +T EEV +I+ EL+ERE NF++A DT+HEMEE L+K++D+EP++E  
Sbjct: 806  MK-SEQQSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELD 862

Query: 893  ISRAEMEADSLTSELMLAEQQAKEAKMAY-------DKAVNEKTQVNEVMKNLEHLRGEY 945
            IS+ +++ DSL+SE+     +A E ++ Y        ++ NE+    EV   L+ L+ EY
Sbjct: 863  ISKRKLDIDSLSSEM-----KASEGRLEYLLQEKAQKESSNEELSTAEV--KLKSLKSEY 915

Query: 946  EDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXX 1005
             +L++E ++KK+++K+LQ+QIMK+GGTKL  Q+S V S+ QRI I               
Sbjct: 916  RELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKA 975

Query: 1006 XXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQG 1065
              D+ +YQKQ +   ++ +  S E  +IE  L  +          + E+S   ++LKD+ 
Sbjct: 976  QNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSS-------SKKVDELSESINKLKDEL 1028

Query: 1066 EQLKERLTEMEENIDE-------FKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLS 1118
            E  +ER+ + EE+IDE       F++LEI+   +L+KL  L   +  E  +    LN L 
Sbjct: 1029 ELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLK 1088

Query: 1119 IRDVTHTLQMLDNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDE 1178
            IRDVT TLQ LD +    +E+  K+E  A+       P +E   + + + + H  M++DE
Sbjct: 1089 IRDVTATLQALDES----LENESKNEVAAE------TPGEE---DGEHSSSLHDPMDVDE 1135

Query: 1179 MSSE----------------------ISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINE 1216
               E                      +  G+P                     L  Y+  
Sbjct: 1136 NQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVEN 1195

Query: 1217 TSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMT 1276
               DI +LEEY RRLIE+K RK+DLN AVQ+RD+V++  E LKK R DEFM GFN I M 
Sbjct: 1196 AYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMI 1255

Query: 1277 LKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1336
            LKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVF
Sbjct: 1256 LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVF 1315

Query: 1337 ALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            ALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+G+
Sbjct: 1316 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV 1375

Query: 1397 YKRDNRTKSTTVKNIDILKR 1416
            YK  N TKS  ++N D++ R
Sbjct: 1376 YKNKNMTKSVALQNTDLIDR 1395

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1310 bits (3391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 722/1396 (51%), Positives = 939/1396 (67%), Gaps = 64/1396 (4%)

Query: 56   ARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKV---SSRGRDYKAYXXXXXX 112
            +RS TPRKLVL S + R+AFSQP  S+++  +VP LQP K    SSRGR    Y      
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQPVTSSSS--NVPYLQPLKSELSSSRGR---VYSQSPPR 86

Query: 113  XXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQG--RLFINKLVLDNFKSYAGR 170
                     LEL+QLSP K +R+E QK   + +  G  Q   RL IN+L L NFKSYAG 
Sbjct: 87   SPTRSPTRKLELIQLSPTKKTRLESQK---TEQVRGLAQPIERLCINRLSLHNFKSYAGT 143

Query: 171  QVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQAC 230
            QVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSEA P+L +C
Sbjct: 144  QVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSC 203

Query: 231  SVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEG 290
             V V F+Y+ DE  G + + +++PGLV+TR+AFKNN+SKYY+N KESSYT+VT+LL+KEG
Sbjct: 204  HVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEG 263

Query: 291  IDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESL 350
            IDLDHKRFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGTA YKPLIE+ L QI+ L
Sbjct: 264  IDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQL 323

Query: 351  NEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLAST 410
            N++C EK NR+EIV+REK+SLESGK+ A                     + +++ K  +T
Sbjct: 324  NDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNT 383

Query: 411  LEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSR 470
             EKI +L               RE+ +++++ K +   I      E +L+ EKR  +  R
Sbjct: 384  QEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDR 443

Query: 471  VSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEER 530
            VSLEE+ KN+  K  KAEK   +T +SI+ ++   +EL + Q ++EKE+ +LN+SL  E+
Sbjct: 444  VSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEK 503

Query: 531  IILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXX 590
              LD+IK+SLK KT  IS +I   E+E EPW+++LQEK+SQI+           +     
Sbjct: 504  TKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIA 563

Query: 591  XXXXXXXXXIISKKQR----KQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQ 646
                     I + +++     Q ++GL  + +   + +I G+++ +    +A  K+KEM+
Sbjct: 564  EEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECD----NASNKMKEMK 619

Query: 647  RILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAI 706
             +L  HRQR+++A+SSLS  +NKN VL+AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAI
Sbjct: 620  AVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAI 679

Query: 707  STACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFD 766
            STACPRLDDVVV+TVEC Q CI++LRKNKLGYARFILLD+LR FN+  I TP NV RLFD
Sbjct: 680  STACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFD 739

Query: 767  VVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGN 826
            +V P D KF NAFYSVL+DTLVA+DLK+AN+VAYGK+RFRVVT+DGKLID+SGTMSGGGN
Sbjct: 740  LVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGN 799

Query: 827  HVMKGLM---RLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVR 883
            H   G+M   RL T  S     +T EEV +I+ EL ERE+NF++A DT+HEME+ L+ ++
Sbjct: 800  HRASGMMKSERLNTGAS-----FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLK 854

Query: 884  DQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKT--QVNEVMKNLEHL 941
            D+EP++E+ IS+  ME DSL SE+ L E +A  A +  ++ +NE +   + E    L+ L
Sbjct: 855  DREPEIETDISKRRMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSL 912

Query: 942  RGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXX 1001
            + E + L+ E ++KK +IK LQ+QIMKIGGTKL  Q S V S+ QRI I           
Sbjct: 913  KAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTA 972

Query: 1002 XXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSEL 1061
                  D+ +Y+KQ      D +  +NEL+ I+E        ++ +D  + E+     +L
Sbjct: 973  VKKAENDLKRYEKQAGQLSVDIDQCTNELESIKE-------LISSSDNKILELEASIDKL 1025

Query: 1062 KDQGEQLKERLTEMEENIDE-------FKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKEL 1114
            + +GE+++E++ E+E  I+E       F   E+++ N+LEKLN LL HI  +     K+L
Sbjct: 1026 QKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQL 1085

Query: 1115 NDLSIRDVTHTLQMLDNNQMDVVEDGIKDE-QDADQDKPSGIPDDEKIQEKD-------- 1165
              L IRDVT TLQ L  N++ + E    DE      +  S  P +  + E D        
Sbjct: 1086 ESLKIRDVTATLQTL--NKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGN 1143

Query: 1166 --DADNNHHSMNID---EMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVD 1220
               A      M++D   EM +  S  +P                     L  ++     D
Sbjct: 1144 EPTASQPEDQMDVDEPEEMETSPS-DLPKLTEAQLKELNVEEVELEIGQLNDFVENAYAD 1202

Query: 1221 IGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEM 1280
            I VLEEY +RL++F+ RKL+LN+AV++RD V++  + L+K R DEFMNGFN ISMTLKEM
Sbjct: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262

Query: 1281 YQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1340
            YQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHK
Sbjct: 1263 YQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1322

Query: 1341 YRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRD 1400
            Y+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  
Sbjct: 1323 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNR 1382

Query: 1401 NRTKSTTVKNIDILKR 1416
            N TKS  ++N D++ R
Sbjct: 1383 NMTKSVALENKDLINR 1398

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1252 bits (3239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1369 (51%), Positives = 915/1369 (66%), Gaps = 30/1369 (2%)

Query: 57   RSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXX----XX 112
            +S+TP K+++S+  +      P+   ++S   P+LQ P  SSRGR  KAY          
Sbjct: 45   KSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDR 104

Query: 113  XXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQV 172
                     LEL+QLSP+KNSR ELQK+Y S +    +  R+ +NKLVL NFKSYAG Q 
Sbjct: 105  SPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIE--RICLNKLVLHNFKSYAGTQT 162

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSV 232
            +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +PDL +C+V
Sbjct: 163  IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAV 222

Query: 233  AVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGID 292
             VHFEY+ID P  T++I+  K  L+ITRRAFKN++SKYY+N KES+Y  +T LLK+EGID
Sbjct: 223  DVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGID 282

Query: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNE 352
            LDH RFLILQGEVENIAQMKPKAEKE DDGLLEYLEDIIGT  YK LI+++  +IE+LN+
Sbjct: 283  LDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALND 342

Query: 353  ICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLE 412
            IC+E+ NRF+I+DREK SLES KE+A                     + Q+N KL++TLE
Sbjct: 343  ICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLE 402

Query: 413  KISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVS 472
            KI+ L                ++DE++  +   +D + +    EK L   KR L+   VS
Sbjct: 403  KITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVS 462

Query: 473  LEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERII 532
              E+ KN+  K+ K  K ++    +IS S    +     +   E ++ +L+ +L  E  +
Sbjct: 463  NTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL 522

Query: 533  LDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXX 592
            L++IKL LKDKT  +S +I++ EK+ EPW+++L E KS+IQ           ++      
Sbjct: 523  LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKAN 582

Query: 593  XXXXXXXIISKKQ----RKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRI 648
                   +  K +    R++E++ L+  L    K +I G ++     + A+ KL EMQ+I
Sbjct: 583  IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNE----LKKANEKLCEMQKI 638

Query: 649  LNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIST 708
            L   RQ+A +AR+SLS  +N++ VL AL KLQKSGRINGFHGRLG+LGVID  +DVAIST
Sbjct: 639  LIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAIST 698

Query: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVV 768
            ACPRL+D+VVD+VEC Q CI+YLRKN LG+ARFILLD+L KF+++ ISTP NVPRLFD++
Sbjct: 699  ACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLI 758

Query: 769  KPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHV 828
            K  D KF  AFYSVL++TLVA DLK+AN VAYGK R+RVVT+ G LIDISGTMSGGGN  
Sbjct: 759  KVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQA 818

Query: 829  MKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPD 888
             KG M+L  + S E   Y+ EEV++IE EL+ REKN++ A +TV EME EL+ +++ EP 
Sbjct: 819  SKGAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPK 878

Query: 889  LESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDL 948
            +E +IS+   E DSL +E  L  +Q  E   ++    N    + E+   L  L  + + +
Sbjct: 879  IELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLI 938

Query: 949  QSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXD 1008
            +S+ ++KK++IK LQD+IMKIGG KL  QNSKV SL ++  I                 D
Sbjct: 939  ESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESD 998

Query: 1009 VLKYQKQLKNFEQDEELSSNELKV-IEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQ 1067
            V K  K+LK  E D     NE K+ +E +LK  +  L +N+ NM  I + K  L+++ E 
Sbjct: 999  VRKLSKKLKESESD-NTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEI 1057

Query: 1068 LKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQ 1127
                LTEME  + EFK+LE+E K K EKL SLL  IK  +K  +++ + LSIR+V + L 
Sbjct: 1058 TMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLD 1117

Query: 1128 MLDNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGI 1187
            +L+  + +  +   +   D +Q++ + + +DE I E    DNN+          EI++GI
Sbjct: 1118 LLNIKEQEAQKIKTELYADFEQNQSNDVINDEMIIE----DNNN----------EIAKGI 1163

Query: 1188 PXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQK 1247
            P                     L  Y     VD+ +LEEY RR+IE+++RK DLNQ+V++
Sbjct: 1164 PSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQ 1223

Query: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
            RD+V+++LE LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGVTF
Sbjct: 1224 RDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTF 1283

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1367
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1284 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1343

Query: 1368 IKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416
            IKERTKNAQFIVISLRNNMFELA+QL+GIYK  N+TKS T+KN DIL R
Sbjct: 1344 IKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1251 bits (3238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/1390 (48%), Positives = 911/1390 (65%), Gaps = 45/1390 (3%)

Query: 44   PDPNSPSLESSYARSHTPRKLVLSSGENRYAFSQPTNSATT-SLHVPNLQPPKVSSRGRD 102
            P P  P +        TP KL+ +S + +   S+ ++ +TT  L  P+LQPP      R 
Sbjct: 4    PTPKKPRI------LDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRG 57

Query: 103  YKAYXXXXXXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLD 162
               Y               +EL+QLSP+KNSR+ELQ+LYD+ +   K+  RL I  LVL+
Sbjct: 58   RSQYSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQ---KKVERLCIRTLVLE 114

Query: 163  NFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 222
            NFKSYAGRQVVGPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE
Sbjct: 115  NFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSE 174

Query: 223  AFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEV 282
             +PDL  CSV + F+Y++DEP GT+R+   KP L + R+AFKNN+SKYY+N KES+YTEV
Sbjct: 175  KYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEV 234

Query: 283  TKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE 342
            T+LL+ EGIDLDHKRFLILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT  YK  IE+
Sbjct: 235  TRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQ 294

Query: 343  RLSQIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQ 402
             L +++SLN+IC+EK NRF++V++EK SLE GK+ A                     +  
Sbjct: 295  ALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFH 354

Query: 403  SNSKLASTLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLE 462
            + SKLA TL  +S+                +E+ E+    + + +R+ S  +  K    +
Sbjct: 355  NGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAK 414

Query: 463  KRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDL 522
             R+LE   VS EE+ K+L+ K  KAEK L + + SI + E+  +E   Q  E+E  +  L
Sbjct: 415  MRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTL 474

Query: 523  NQSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXX 582
            N ++ + +  L+ +KL+L DKT DI+ ++   EKE EPW  +++EKKS+I+         
Sbjct: 475  NHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISII 534

Query: 583  XXTRXXXXXXXXXXXXXIISKKQRKQELQGLVLDLSQRLKSL-IDGRS------QGERDF 635
                             I +  Q  ++L+G +    + +++L ++  S       GER+ 
Sbjct: 535  KEA-------DLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGEREC 587

Query: 636  RSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDL 695
             SA  KL+EM+++L  HRQR  +ARS++S A+NKN VLTALS+LQKSGRI+G+HGRLGDL
Sbjct: 588  TSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDL 647

Query: 696  GVIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPI 755
            G ID+ +D+AISTACPRLDD+VVDTVEC Q CI++LRKNKLGYARFILLD+LRKFNLQP 
Sbjct: 648  GTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPA 707

Query: 756  STPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLI 815
             TPENVPRLFD+VKPK+PKF+ AFYSVL+DTLV  DL QAN+VAYGK+R+RVVT+DGKLI
Sbjct: 708  HTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLI 767

Query: 816  DISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEM 875
            DISGTM+GGG+    GLM+  T QS     YTPEEV ++E EL EREKNF+VA +T  EM
Sbjct: 768  DISGTMTGGGDRAASGLMK-STQQSSL---YTPEEVQRMEEELNEREKNFKVAFETFQEM 823

Query: 876  EEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVM 935
            E  L+   D++P++E ++S+ +M+ +++++EL    ++  E + +   ++ + +++    
Sbjct: 824  ESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAE 883

Query: 936  KNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXX 995
            + L  L  +     S + +K ++IK L+ +IM+IGG +L T NSKV SL Q+I I     
Sbjct: 884  EKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQ 943

Query: 996  XXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEIS 1055
                        ++ + +KQ    + D E    E++ ++         + E    ++++ 
Sbjct: 944  KKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQ 1003

Query: 1056 NLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELN 1115
                 L D+    K  L +  E ID + S+EIE+  +L+KL +L  ++K E+ + D +L+
Sbjct: 1004 EEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLS 1063

Query: 1116 DLSIRDVTHTLQMLDNNQM----------DVVEDGIKDEQ-DADQDKPSGIPDDEKIQEK 1164
             L +RD+   +  L+ N+           D   + I+    +     PS  P++ KI   
Sbjct: 1064 HLKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPS--PNERKI--- 1118

Query: 1165 DDADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVL 1224
              A+NN  SM +DE +S +  G+P                     L  YI+ ++VDI +L
Sbjct: 1119 SIAENN-LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEIL 1177

Query: 1225 EEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMI 1284
            +EY +RL E++RR++DLN+A+ KRDE +   E+LKK R DEFM GF IIS+TLKEMYQMI
Sbjct: 1178 DEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMI 1237

Query: 1285 TMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPT 1344
            TMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PT
Sbjct: 1238 TMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT 1297

Query: 1345 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTK 1404
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+L+GIYK  N T+
Sbjct: 1298 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTR 1357

Query: 1405 STTVKNIDIL 1414
            STT++N DI+
Sbjct: 1358 STTLQNRDII 1367

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1247 bits (3226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1372 (49%), Positives = 899/1372 (65%), Gaps = 30/1372 (2%)

Query: 60   TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXXXXXXXXXXXXX 119
            TP KL+  S   ++  SQ ++++TT+L  P+LQPP  S   R    Y             
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQSPPRSPNRSPA 74

Query: 120  XXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTS 179
              +EL+QLSP+KNSR+ELQK+YD  +++ K   RL I  L+L+NFKSYAG QVVGPFH+S
Sbjct: 75   RRIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYAGVQVVGPFHSS 131

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYI 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L  CSV + F+Y+
Sbjct: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191

Query: 240  IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFL 299
            +D+  G +++  +   L + R+ FKNN+SKYYIN KESSYTEVT+ L+ EGIDLDHKRFL
Sbjct: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251

Query: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKAN 359
            ILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGTA YK  I + L ++++LN+IC+EK  
Sbjct: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311

Query: 360  RFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLASTLEKISSLNR 419
            RFE+V++EK SLE+GKE A                     + +   KLA TL+KIS+   
Sbjct: 312  RFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFTE 371

Query: 420  XXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKN 479
                         +E+ +++    +++++I+   + +  L  +K +L+   VS EE+ K+
Sbjct: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431

Query: 480  LVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLS 539
            L  K  KAEK L+  + +I   E+  + L   QTE E  + +LN+SL  ER  LD IK+S
Sbjct: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKMS 491

Query: 540  LKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXX 599
            L+DKT  IS ++   EKE EPW  +L+ K SQI+           ++             
Sbjct: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551

Query: 600  IISKKQRKQELQGLVLDL---SQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRA 656
            I S K R +  +  +  L   S  + S I   +QGE D  SA  KL +M+++L  HRQR 
Sbjct: 552  IESYKDRIENHKKKINKLEKESAAITSFI-STAQGECD--SAKKKLVDMKQVLTNHRQRM 608

Query: 657  MEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDV 716
             +AR +LS  +NKN VL AL +LQKSGRI+GFHGRLGDLG ID+ +D+AIS ACPRLDD+
Sbjct: 609  TDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDI 668

Query: 717  VVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFS 776
            VV+TVECAQ CI++LRKNKLGYARFILLD+L+KFN+  ++TPENVPRLFD+  PK+  F+
Sbjct: 669  VVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFA 728

Query: 777  NAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLG 836
             A YSVL+DTLVA+DL QAN+VAYG RRFRVVT+DGKLIDISGTMSGGG+ V+KGLM+  
Sbjct: 729  PALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSK 788

Query: 837  TNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRA 896
               +D    YT EEV ++E EL +RE NF++A DT  EME  L+K +D++P+++ +IS+ 
Sbjct: 789  QRSNDM---YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKH 845

Query: 897  EMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKK 956
            +++ D+L+SEL   +    E +   +    +   + ++   L  L  E   L+ E++ K 
Sbjct: 846  KIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKN 905

Query: 957  EQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQL 1016
            EQI  L+ QIMKIGG KL +QNSKV SL Q++ I                 ++ +  KQ 
Sbjct: 906  EQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQK 965

Query: 1017 KNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEME 1076
               E D      EL       +  +  L E +  +  I + K +L  + E  K+ L +  
Sbjct: 966  LGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKA 1025

Query: 1077 ENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDV 1136
              +++FKS EIEM   LEKL +L  HIK EI + D+ELN L +RDV   LQ LD + + +
Sbjct: 1026 AYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPL 1085

Query: 1137 VEDGIKDE--------------QDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSE 1182
              + + D               +D D D   G  + + I E  ++ N+  SM++D+ +S 
Sbjct: 1086 --ESLTDRAVTPSNQCIPEMTVEDHDADMNDG--EAKLISEDPNSFNDQESMDVDQDASY 1141

Query: 1183 ISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLN 1242
            I  G+P                     L  Y++    DI +LEEY  RL E+KRRKLDLN
Sbjct: 1142 IGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLN 1201

Query: 1243 QAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFS 1302
            ++V+KR+E++ + E+LKK+R +EFM+GF IISMT+KE+YQMITMGGNAELELVDSLDPFS
Sbjct: 1202 ESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFS 1261

Query: 1303 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVS 1362
            EGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVS
Sbjct: 1262 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1321

Query: 1363 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414
            IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYK  N TKSTT++NIDIL
Sbjct: 1322 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1241 bits (3210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1391 (49%), Positives = 929/1391 (66%), Gaps = 50/1391 (3%)

Query: 49   PSLESSYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYXX 108
            P  +  + RS TPRKL++SS ++R+  SQP N  +     P+LQ P VS+ GR++K Y  
Sbjct: 59   PQSQDRHGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPSVST-GREHKFYSQ 116

Query: 109  XX----XXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNF 164
                             LEL+QLSP+KN+R ELQK+Y+  ++  K+  RL I +LVL NF
Sbjct: 117  SPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNF 175

Query: 165  KSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAF 224
            KSYAGRQVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +
Sbjct: 176  KSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKY 235

Query: 225  PDLQACSVAVHFEYIIDEPSG-TSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVT 283
            P+L +CSV +HF+Y+ID+P+G  S+IDE K  LV+ R+AFKNNSSKYYIN+KESS+T+VT
Sbjct: 236  PELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVT 295

Query: 284  KLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER 343
             LLK EGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGT++YK  IE  
Sbjct: 296  TLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHN 355

Query: 344  LSQIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQS 403
            LS++E+LNEIC+EK NRF IV++EK+SL  GK  A                     +   
Sbjct: 356  LSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYID 415

Query: 404  NSKLASTLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEK 463
            N KL STL KI+                 +E+  ++ +   +  R++ +   E+ L   +
Sbjct: 416  NKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQ 475

Query: 464  RELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLN 523
            R+     +S +E  KN+  K   AEK + +T+ SI+++ +  + L  QQ ++ K+I++LN
Sbjct: 476  RKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELN 535

Query: 524  QSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXX 583
            + L+ E+  L++IK+SLK KT+  S +I+++EKE EP+ +QLQEK SQIQ          
Sbjct: 536  EKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLN 595

Query: 584  XTRXXXXXXXXXXXXXIISKKQRKQELQGLVLDLSQRL----KSLIDGRSQ---GERDFR 636
              +             IIS K+  +E +  V+ +S+++    + L++ R +   G+ +F 
Sbjct: 596  ENKDNLSNE-------IISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFN 648

Query: 637  SAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLG 696
                K++EM+  L++HRQ+A ++R+SLS  QNKN VLTAL KLQKSGRI+GF+GRLGDLG
Sbjct: 649  KFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLG 708

Query: 697  VIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPIS 756
            VID  +DVAISTACPRL+D+VVD+V+C Q CIDYLRKN+LGYARFILLD+LRKFNL  I 
Sbjct: 709  VIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIE 768

Query: 757  TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLID 816
            TP+N PRLFD+++ ++ KF  AFYSVL+DTLVA +L  ANKVAYGKRRFRVVT+DGKLID
Sbjct: 769  TPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLID 828

Query: 817  ISGTMSGGGNHVMKGLMRLGTN-QSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEM 875
            ISGTMSGGGN+V++GLM+LG +   ++ E  +PEEV K+E EL   EKNF+VA +++ EM
Sbjct: 829  ISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEM 888

Query: 876  EEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVM 935
             +E+  +++Q P  E  IS+  +E +   +E+     Q KE +  +D+  N   ++    
Sbjct: 889  NQEILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVAD 948

Query: 936  KNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXX 995
              L+ L+ EY  L  +T+  K++I+ L+ QIM  GG +L  QNSKV SL  ++ I     
Sbjct: 949  DKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQ 1008

Query: 996  XXXXXXXXXXXXDVLKYQKQLKN-------FEQDEELSSNELKVIEEKLKQTKLALTEND 1048
                         + K Q +L         F+ + E S  ++ ++ E+L     A  E+D
Sbjct: 1009 KNDKSAIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEEL-----AKLESD 1063

Query: 1049 TNMTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIK 1108
             N T+  N K E+    +  KE+  E+EE+   FKS E+E+KNKL+KL  L  H++ +I 
Sbjct: 1064 INDTQ--NAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIG 1121

Query: 1109 QQDKELNDLSIRDVTHTLQMLDNN--QMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDD 1166
            + D ELN L+IR+++  L+  D    + D+ ++G  ++    Q   S +     I     
Sbjct: 1122 KLDTELNALTIREISQNLESFDERLEKYDISKNGATEDT---QHTSSALNSVSNI----- 1173

Query: 1167 ADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEE 1226
               N  +M+ID   +EI+ GI                      L   +  ++ +I +LEE
Sbjct: 1174 ---NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEE 1230

Query: 1227 YVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITM 1286
            YVRRL E+K+RK DL++++ +++  KE+ E+LKK R +EF  GF+IIS+TLKEMYQMITM
Sbjct: 1231 YVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITM 1290

Query: 1287 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPL 1346
            GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPL
Sbjct: 1291 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1350

Query: 1347 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKST 1406
            YVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QL+GIYK +N T+S 
Sbjct: 1351 YVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSA 1410

Query: 1407 TVKNIDILKRD 1417
            T+ N D+L RD
Sbjct: 1411 TLVNNDMLNRD 1421

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1179 bits (3050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1396 (47%), Positives = 913/1396 (65%), Gaps = 48/1396 (3%)

Query: 46   PNSPSLESSYARSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKV--SSRGRDY 103
            P + + E S  R+ TPR L+ S  ENR     PT   + +L +P+L PP+   S+RGRD+
Sbjct: 25   PKAVTFEQS-PRAITPRNLLGS--ENRNVL--PT-GGSQNLQIPSLLPPESLGSARGRDF 78

Query: 104  KAYXXXXXXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDN 163
            K+Y               L+L++LSP+KNSR ELQKLY+S K   K++ RLFI++LVL++
Sbjct: 79   KSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLND 137

Query: 164  FKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223
            FKSYAGRQV+GPFHTSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 138  FKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSET 197

Query: 224  FPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVT 283
            FPDL++CSV VHF+Y+ID+  G++ IDE K  LV+TR+AFKNN+SKY++N KES+YTEVT
Sbjct: 198  FPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVT 257

Query: 284  KLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEER 343
             LLKKEGIDLDHKRFLILQGEVENIAQMK KAEKE+DDGLLEYLEDIIGT+ YK  IE+ 
Sbjct: 258  TLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKL 317

Query: 344  LSQIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQS 403
              +IESLNEIC+EK NRF IV+REKNSLESGKE A                     ++Q 
Sbjct: 318  SMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQD 377

Query: 404  NSKLASTLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEK 463
            N KL   L K +++ +               + ++ A    +K  +    + E  LS  K
Sbjct: 378  NKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTK 437

Query: 464  RELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLN 523
            R LE  +V  E+   NL +K  + E+  K  +  I+ ++   Q +  +Q+   +    L+
Sbjct: 438  RTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLS 497

Query: 524  QSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXX 583
             +L+ E+  L++IKL L++KT+ ++ +I  +EKE  PW+ Q Q+ K +I+          
Sbjct: 498  TNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIE 557

Query: 584  XTRXXXXXXXXXXXXXIISKKQ----RKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAH 639
              R             I+S+K+    ++QE++ L   L Q+ K +I  R  GER+ ++A 
Sbjct: 558  ENRKGLENDIAGLENAILSQKRDLEVQEQEIKSL---LEQKTK-VIQERELGERECKNAQ 613

Query: 640  LKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVID 699
              L  ++  + A RQ+A+E RS+ S  +N N VL+AL +LQKSGR+NGFHGRLGDL VID
Sbjct: 614  ATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVID 673

Query: 700  NSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPE 759
              +DVAISTACPRL+D+VVDTVE  Q CI+YLRKNKLGYARFILLD+L  FN   I TP+
Sbjct: 674  PKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPD 733

Query: 760  NVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISG 819
               RLFD++  K+ +F+NAFYSVL+DTLV ++++QAN+VAYGK+R+RVVT+DG LID+SG
Sbjct: 734  QSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSG 793

Query: 820  TMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEEL 879
            TM+GGG +V KGLM+L  + S     ++PEEV  IE+EL ++E  ++ A D  HEMEEEL
Sbjct: 794  TMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEEL 853

Query: 880  KKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLE 939
            +++RD+ P++++ +S+ EM+ ++  +++       +E +   +   N+      ++  L+
Sbjct: 854  RRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLK 913

Query: 940  HLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQN-------SKVGSLCQRIDIXX 992
             L+ + +D+  +T++ K++IK ++D+I+++GG +L  Q+       +K+    +R+    
Sbjct: 914  ELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIK 973

Query: 993  XXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMT 1052
                           ++ +  ++L NF ++ E +  E K IE KL   K +         
Sbjct: 974  SNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESKEIESKLLDIKES--------- 1024

Query: 1053 EISNLKS---ELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQ 1109
             I NLK    +L+ + E     L   ++ + ++KS+ +E  NKLEKL +    +K  IK+
Sbjct: 1025 -IENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKR 1083

Query: 1110 QDKELNDLSIRDVTHTLQML---DNNQMDVVEDGIKDEQ---DADQDKPSGIPDDEKIQ- 1162
             +  L++L+IRDVT  L  +   +N  +D  +  +++     +AD D  S + +++    
Sbjct: 1084 YNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNH 1143

Query: 1163 --EKDDADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVD 1220
              E DD D+N   M ID     I+ GIP                     L  +I  +  +
Sbjct: 1144 NDENDDIDSNK--MEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEAN 1201

Query: 1221 IGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEM 1280
            + VLEEY  R +EF +RK DLN AVQ RD VK++LE +K+ R+DEFM GF IISMTLKEM
Sbjct: 1202 VDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEM 1261

Query: 1281 YQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHK 1340
            YQMIT+GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHK
Sbjct: 1262 YQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1321

Query: 1341 YRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRD 1400
            Y+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QL+GIYK +
Sbjct: 1322 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHE 1381

Query: 1401 NRTKSTTVKNIDILKR 1416
            N TKS  + N D++ R
Sbjct: 1382 NMTKSAALVNEDLVGR 1397

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1169 bits (3023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1369 (48%), Positives = 905/1369 (66%), Gaps = 29/1369 (2%)

Query: 54   SYARSHTPRKLVLSSGENRYAFS--QPTNSATTSLHVPNLQPPKVSS-RGRDY-KAYXXX 109
            S + + TPRKLVL S E +YA S  Q T +A+ ++  P+LQPP   + RGR+Y ++    
Sbjct: 22   SQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQSPPRS 81

Query: 110  XXXXXXXXXXXXLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAG 169
                        LEL++LSP K++R+ELQK+   H+++ +   RL I+KLVL+NFKSYAG
Sbjct: 82   PTRSPTRSPTRKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSYAG 138

Query: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQA 229
             Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE FP L +
Sbjct: 139  IQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLAS 198

Query: 230  CSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKE 289
            CSV +HF Y+ D  +G ++I      +V+ RRAFKNNSSKYY+N KES+YTEVT+LLK+E
Sbjct: 199  CSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEE 258

Query: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIES 349
            GIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGTA +KP IE+ L +IE+
Sbjct: 259  GIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIET 318

Query: 350  LNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXXXXXXXMLQSNSKLAS 409
            LNE+C+EK NRFE+VD+EK +LESGKE A                     +  SN KLA+
Sbjct: 319  LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLAT 378

Query: 410  TLEKISSLNRXXXXXXXXXXXXLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGS 469
            + +KIS+LN              +E + +  +  + K   ++  +  K ++ +KR LE  
Sbjct: 379  SCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD 438

Query: 470  RVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEE 529
             ++ +E+ K++  K+  AEKA   ++ +   + +  + L++   + E E+ +LN S+  E
Sbjct: 439  FIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIE 498

Query: 530  RIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQXXXXXXXXXXXTRXXX 589
            +  L++IK+ L +KTKD+S ++   E++ EP+  Q+QEK+S+I+           +    
Sbjct: 499  KEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNL 558

Query: 590  XXXXXXXXXXIISKKQRKQELQGLVLDLSQR-LKSLIDGR-SQGERDFRSAHLKLKEMQR 647
                      I  +  + +EL+    + S R  KS ++ R S  +++   A  +  EM+ 
Sbjct: 559  LKEKATIESKI--EDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRD 616

Query: 648  ILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIS 707
            +L   RQ   EA+++L+  QNKN VL AL+KLQ SGRI GFHGRLGDLG ID+ +D+AIS
Sbjct: 617  VLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIS 676

Query: 708  TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDV 767
            TACPRLDD+VV+TVEC Q CID+LRKNKLGY RFILLD+LRK NL  I+TPENVPRLFD+
Sbjct: 677  TACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDL 736

Query: 768  VKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNH 827
            + P    F  AFYSVL+DTLVARDL+QAN+VAYGKRRFRVVT+DGKLIDISGTMSGGG+ 
Sbjct: 737  ITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSS 796

Query: 828  VMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEP 887
               GLMR   +++     Y+ +EV K+E +L+ +E N+R A   VHEME  L+K+ D+ P
Sbjct: 797  PQSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLP 853

Query: 888  DLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQ--VNEVMKNLEHLRGEY 945
            +++ QIS+ ++E  S  +E+    Q+   +++A + ++NEK Q  + +  K L+ LR   
Sbjct: 854  EIDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEKKLDILRQHL 911

Query: 946  EDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXX 1005
            +     ++  +++I  L+D+IM+ GG +L  Q +KV SL Q I+I               
Sbjct: 912  QQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKL 971

Query: 1006 XXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQG 1065
              D+ +  ++   + ++  + + ++ ++ E+L+  +L     +  + E +  K+EL    
Sbjct: 972  DIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSV 1031

Query: 1066 EQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHT 1125
            E+LK+ L  +E + +EFK+ E+E  ++LEKL+ L  ++K +++  +  L  L IRDV+  
Sbjct: 1032 EKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKL 1091

Query: 1126 LQMLDNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISR 1185
            L  L+        DGI    ++  D  + + + + +Q +   D  ++    D   +    
Sbjct: 1092 LSQLN--------DGII---ESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHS 1140

Query: 1186 GIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAV 1245
            G+P                     L  Y++  + DI VLEEY RRL E++RRKLDLNQAV
Sbjct: 1141 GLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAV 1200

Query: 1246 QKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1305
             KR+EV+ + E  K  R ++FM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1201 AKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1260

Query: 1306 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1365
             FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1261 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1320

Query: 1366 NYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414
            NYIKERTKNAQFIVISLRNNMFELAQ L+GIYK +N TKSTT++NIDIL
Sbjct: 1321 NYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 207/758 (27%), Positives = 358/758 (47%), Gaps = 105/758 (13%)

Query: 687  GFHGRLGDLG-VIDNSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
            G  G + DL     + + +A+ST   +  D ++VD +  AQ CI + +K + G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 745  DRLRKFNLQP-ISTPENVPRLFDV-VKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGK 802
            D +   + QP ++ P +   +  +     DP++  A   V  D+++   L  A  + + K
Sbjct: 594  DTIS--SEQPTLNLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLKWNK 651

Query: 803  R-RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK--IEHELA 859
              R ++VT++G LI  +G M+GG       + +   N+ D+ E+Y     +K  +  ++ 
Sbjct: 652  GVRSKLVTIEGALIHKAGLMTGG-------ISKDSNNRWDK-EEYQSLMTLKDKLLLQVE 703

Query: 860  EREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSEL----MLAEQQAK 915
            E     R+++    ++E EL  +  +   L  Q+S+ +   D   +E+     L +QQ  
Sbjct: 704  EISTKSRLSSTRARDVEIELSTLNAEISSLRMQLSQVQRSLDENKTEINHQNTLLDQQYN 763

Query: 916  EAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLH 975
              K+   K++ EK  V+E  K+   L+   E LQ+E         I ++   K+G T + 
Sbjct: 764  -PKL---KSLKEK--VDEFDKSWNELKSNKEKLQNE---------IFKELTDKVGFT-IE 807

Query: 976  TQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEE 1035
                  G L ++                    ++ + QK++ N E       N+L+   E
Sbjct: 808  EYERHSGELLRK-----------------QSKELQQLQKEILNIE-------NKLQFEIE 843

Query: 1036 KLKQTKLALTENDTNMTEI-SNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLE 1094
            +L+ T+  LT  ++N+ +    LKS  KD+ E L E++ ++E  I+  ++ E++  NK+ 
Sbjct: 844  RLENTQKRLTSAESNLEKAHETLKSLQKDENE-LAEQVKQIESEINSARN-ELDSVNKVF 901

Query: 1095 KLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDGIKDEQDADQDKPSG 1154
                L I   N +++   ELND S        Q L  N+ ++ ED  K++ +       G
Sbjct: 902  TAQQLDI---NRMEESLGELNDNS--------QTLKRNRDEIKEDIAKNDLER-----IG 945

Query: 1155 IPDDEKIQEKDD---ADNNHHSM---NIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXX 1208
            I  + K+   D    ++ N   +    IDE +  +S  I                     
Sbjct: 946  ILKNAKVTNIDIPVISETNLSDLPIDRIDEDTISVSNEIDVDYTALPAKYKEEMGSATKN 1005

Query: 1209 GLTCYINETSVDIGVLEEYVR---RLIEFKRRKLDLNQAVQK-----RDEVKEQLEILKK 1260
             L   I      + VL+   R   R  E + R   ++   +K     R  +++ L+I KK
Sbjct: 1006 ELDTKIKNVEDLLDVLQPNARAADRFTEAQERFEIIDGETEKIKTTERKALQQFLKI-KK 1064

Query: 1261 NRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMP 1311
             R + F N F+ +S  L  +Y+ +T          GGNA L L D  +PF+ GV +   P
Sbjct: 1065 KRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATP 1124

Query: 1312 PKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKER 1371
            P K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+  
Sbjct: 1125 PLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRH 1184

Query: 1372 -TKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
               N QFIVISL+N MFE +  L+G++++     S  V
Sbjct: 1185 GNPNLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIV 1222

 Score =  107 bits (268), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 113/213 (53%), Gaps = 18/213 (8%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL  + L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRL--SGLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHK--------SEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAF 263
           + + DLI++        +     + +  V   +E    +       D+E+P + + R   
Sbjct: 60  NIVKDLIYRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAIS 118

Query: 264 KNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGL 323
            N  + Y IN K  +Y E ++ L++E I +  K FL+ QG+VE IA   P         L
Sbjct: 119 TNGDTTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DL 171

Query: 324 LEYLEDIIGTANYKPLIEERLSQIESLNEICLE 356
            +  E++ G+  YK   +E   QIE LN+   E
Sbjct: 172 SKLFEEVSGSIQYKKEYDELKEQIEKLNQSAAE 204

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  169 bits (428), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 194/760 (25%), Positives = 345/760 (45%), Gaps = 109/760 (14%)

Query: 687  GFHGRLGDLGVIDNS-FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
            G  G + DL       + +A+ST   R  D ++VD +  AQ CI YL+K + G A FI L
Sbjct: 525  GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 745  DRLR-KFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
            D +  + +  P S         + ++  DP++  A   V  D+++   L+ A  + + + 
Sbjct: 585  DTIEVETSTLPASESSGCILAINAIEY-DPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 804  -RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK--IEHELAE 860
             R ++VT++G LI  +G M+GG       + +  +N+ D+ E+Y     +K  I  ++ E
Sbjct: 644  VRSKLVTLEGTLIHRAGLMTGG-------ISKDSSNRWDK-EEYQSLMTLKDKILVQIEE 695

Query: 861  REKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMA 920
               + R  +    E+E  +  +  +   + +QIS+ +   +   +++   E      K  
Sbjct: 696  VGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDI---EYHQNLIKQE 752

Query: 921  YDKAVNEKTQ----VNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQI-MKIGGTKLH 975
            YD  + E  Q    +N+  K LE    E + LQ++T       K   D++   +   + H
Sbjct: 753  YDPKIQELEQKLAIINDSRKQLEE---EKDSLQTQT------FKEFTDKLGFSMKEYETH 803

Query: 976  TQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEE 1035
            + ++K                           ++ + QKQ+ N E       N+L+  +E
Sbjct: 804  SGDAK----------------------RQQSKELQQLQKQILNVE-------NKLEFEKE 834

Query: 1036 KLKQTKLALTENDTNM----TEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKN 1091
            +L  T   L + +T+M     E+ +L+ + +D G Q K+    ++++  + K +E E+KN
Sbjct: 835  RLTSTSNRLEKTETDMKKVFIELQSLQKQEEDVGVQTKKVEKAIKDHKIKLKKVEEELKN 894

Query: 1092 KLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQ---MDVVEDGIKDEQDAD 1148
            K   +N                LND  + +   +LQ L   +    DV+E G  D +   
Sbjct: 895  KQRTMN----------------LNDEQLIEYNSSLQSLKRERDEVKDVIEKG--DLERIC 936

Query: 1149 QDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRG---IPXXXXXXXXXXXXXXXXX 1205
              K   I +   +Q    +D +  S+ ID + +E  R    I                  
Sbjct: 937  VLKNCKISN---MQIPIVSDVDLQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEA 993

Query: 1206 XXXGLTCYINETSVDIGVLEEYVR---RLIEFKRRKLDLNQAVQ--KRDE--VKEQLEIL 1258
               G    + +    + VL+   +   R  E +++   +N   +  K+DE  V  Q   +
Sbjct: 994  VEKGFERELKQVDEILNVLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIKI 1053

Query: 1259 KKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSV 1309
            K+ R   F   F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1054 KRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHA 1113

Query: 1310 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIK 1369
             PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+
Sbjct: 1114 TPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIR 1173

Query: 1370 ER-TKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
                 + QFIVISL+N MFE +  L+G+Y++     S  V
Sbjct: 1174 RHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIV 1213

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 94/193 (48%), Gaps = 25/193 (12%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+  +R 
Sbjct: 2   GRLL--GLELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRS 59

Query: 212 DRLSDLIHKSEAF-------PDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFK 264
           + L DLI++  A         D+       + +    +  G S I+       ++R   K
Sbjct: 60  NVLKDLIYRGVASEEEGDGESDVVNNPTTAYVKAFYSK--GDSTIE-------LSRSISK 110

Query: 265 NNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLL 324
              + Y +N K   Y      L+ E I +  K FL+ QG+V  IA        +S   L 
Sbjct: 111 GGDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIAS-------QSAMELT 163

Query: 325 EYLEDIIGTANYK 337
           ++ E+  G+  YK
Sbjct: 164 QFFEEFSGSIQYK 176

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  146 bits (369), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 113/170 (66%), Gaps = 12/170 (7%)

Query: 1251 VKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1301
            V EQ   +++ R D F + F+ +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1362 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLIGIYK--RDNRTKSTTV 1408
              +A YI++R   N QFIVISL+N MFE +Q L+G+++  RDN +++ T+
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 98/198 (49%), Gaps = 28/198 (14%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    + L NFKSY G+  +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R 
Sbjct: 2   GRLL--GIELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRS 59

Query: 212 DRLSDLIHK------------SEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVIT 259
             L+DLI++            SE   +    S A  +      PSG     +E     +T
Sbjct: 60  HTLADLIYRGTLQDGDADSGYSETHDNENNPSSA--YVKAFYSPSG-----QENDVAELT 112

Query: 260 RRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKES 319
           R    +  S Y +N +  S+ +    L+ E I +  + FL+ QG+VE +A  KP+     
Sbjct: 113 RTITLSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE---- 168

Query: 320 DDGLLEYLEDIIGTANYK 337
              L    E + G+  YK
Sbjct: 169 ---LTTLFEQVSGSIQYK 183

 Score = 62.4 bits (150), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 186/421 (44%), Gaps = 46/421 (10%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RKFNLQPISTP 758
            + VA+ST   +  D V+VD    AQ C+ +L+K + G   FI LD +   K ++  + T 
Sbjct: 548  YTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALDTK 607

Query: 759  ENVPRLFDVVKPKDPKFSNAFY---SVLKDTL-VARDLKQANKVAYGKRRFRVVTVDGKL 814
                 +  +   +D + +  +    S++ D+L +A+DLK    V     R ++V++DG +
Sbjct: 608  GCTLAIDAIDYERDLERAMQYVCSDSIICDSLAIAKDLKWRRNV-----RAKLVSLDGSI 662

Query: 815  IDISGTMSGG-----GNHVMK----GLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNF 865
            +  +G M+GG     GN   K    GLM L      EI + +    I  E  +   E   
Sbjct: 663  VHKAGLMTGGTTKSSGNRWDKEEYQGLMSLKDTLLGEISELSSANTIDSER-IRSTENEL 721

Query: 866  RVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAV 925
               N  V  +  +L +V+    + E++I   + + + +  E     Q  KEA  A+ K  
Sbjct: 722  SFLNSDVMSLRTQLNQVKRSLNEKETEI---QYQQELIKGEFEPKIQSLKEAMTAHAKTT 778

Query: 926  NEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLC 985
                +  + +     L   Y D + +   K  Q +    ++M+     L     ++  + 
Sbjct: 779  ARFEEEKDRL-----LDSVYADFEGDIGFKVSQYEKHSGEMMRRQLEDLRKLQMQIAGIE 833

Query: 986  QRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKL--KQTKLA 1043
            ++++                  D+ K + +L+    DE+  ++E++ +E  +  +QT+L 
Sbjct: 834  KKLEFETERLQSTQERQQRVQVDIEKAKIKLEALNSDEQRITDEIQGVELTINEEQTRLD 893

Query: 1044 LTENDTN--MTEISNLKSELKDQGEQLK--ERLTE-MEENIDEFKSLEIEMKNKLEKLNS 1098
              +N+ N  + E+++ +  +++  E L+  +R+ E + E+ID         KN LEK N 
Sbjct: 894  NLQNEINKDLVELNSSEETIQEATEHLQSAKRMHEALAEDID---------KNSLEKANV 944

Query: 1099 L 1099
            L
Sbjct: 945  L 945

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 114/174 (65%), Gaps = 12/174 (6%)

Query: 1247 KRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1297
            K  +V E    +K+ R + F   F+ +S ++ E+Y+ +T          GGNA L L D 
Sbjct: 1045 KEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDE 1104

Query: 1298 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1357
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD
Sbjct: 1105 DEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALD 1164

Query: 1358 FRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLIGIYK--RDNRTKSTTV 1408
              NV  VA+YI+ +   + QFIVISL+N MFE +Q L+G+++  ++N +K+ T+
Sbjct: 1165 ISNVERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 113/221 (51%), Gaps = 22/221 (9%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L+NFKSY G+  +G   ++F++++GPNGSGKSN++D++ FV G ++  +R 
Sbjct: 2   GRLI--GLELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRS 59

Query: 212 DRLSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGT------SRIDEEKPGLVITRRAFKN 265
             L+DLI++     + +A S     E   + P+        S  + E   + ++R   ++
Sbjct: 60  HLLADLIYRG-TLSEEEASSADFESE---NHPNSAYVKAFYSPSNNEDDVVELSRTVTRS 115

Query: 266 NSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 325
             S Y I+ K   Y + ++ L+ E I +  + FL+ QG+VE +A  KP+        L +
Sbjct: 116 QESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LTD 168

Query: 326 YLEDIIGTANYKP---LIEERLSQIESLNEICLEKANRFEI 363
             E + G+  YK     I E L +  S    C++   R  I
Sbjct: 169 LFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 103/161 (63%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F N F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1369 KER-TKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            +     + QFIVISL+N MFE +  L+G+Y++     S  V
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

 Score = 92.8 bits (229), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 99/198 (50%), Gaps = 34/198 (17%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRL--TGLELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHK------SEAFP----DLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVI--T 259
           + L DLI++      SE  P    +    S  V   Y +D             G V+   
Sbjct: 60  NILKDLIYRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMD-------------GKVVELM 106

Query: 260 RRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKES 319
           R    N  + Y I+ K  SY +    L+KE I +  K FL+ QG+VE IA        +S
Sbjct: 107 RTININGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QS 159

Query: 320 DDGLLEYLEDIIGTANYK 337
              L +  E+I G+  YK
Sbjct: 160 ALDLSKLFEEISGSIQYK 177

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 103/161 (63%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1369 -KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
             + R  + QFIVISL+N MFE +  L+G+Y++     S TV
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 109/215 (50%), Gaps = 25/215 (11%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 38  GRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 95

Query: 212 DRLSDLIHKS----------EAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRR 261
           + L DLI++           ++  D  A +   +  Y+       +++ E      +TR 
Sbjct: 96  NILKDLIYRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVE------LTRL 149

Query: 262 AFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDD 321
             +N  + Y I+ K  +Y + +  L+ E I +  K FL+ QG+VE IA   P        
Sbjct: 150 ISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT------- 202

Query: 322 GLLEYLEDIIGTANYKPLIEERLSQIESLNEICLE 356
            L    E++ G+  YK   +E   +IE L++   E
Sbjct: 203 DLSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATE 237

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  138 bits (347), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 112/172 (65%), Gaps = 10/172 (5%)

Query: 1247 KRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1297
            K  +++EQ   +K++R + F   +N +S  + ++Y+ +T          GG+A L L D 
Sbjct: 1048 KEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDE 1107

Query: 1298 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1357
             +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1108 DEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1167

Query: 1358 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
              NV  +A YIK   + N QFIVISL+N+MFE +Q L+G++++     S  +
Sbjct: 1168 NTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 94/192 (48%), Gaps = 16/192 (8%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG    +F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTS------RIDEEKPGLVITRRAFKN 265
             L DL+++     D +           I             +  EE P +   R   ++
Sbjct: 60  HLLMDLVYRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESP-IEFMRTISRS 118

Query: 266 NSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 325
             S Y +N K   Y + T +L+KE I +  + FL+ QG+VE IA        +S   L +
Sbjct: 119 GESAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIAS-------QSAGELTK 171

Query: 326 YLEDIIGTANYK 337
             E I G+  YK
Sbjct: 172 LFEQISGSVQYK 183

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 140/336 (41%), Gaps = 53/336 (15%)

Query: 687 GFHGRLGDLG-VIDNSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     + + VA+ST   +  D V+VD    AQ CI YL++ + G A FI L
Sbjct: 532 GVRGLVHDLCHPKKDKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKRQRSGVASFIPL 591

Query: 745 DRLRKFNLQ-PISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
           D +       P+S  +      D +   D +   A   V  D+++   L  A  + + + 
Sbjct: 592 DTIDAITANLPVSNTKGCILAIDSI-SYDSELEKAMQYVCSDSIICDSLDLAKDLKWNRG 650

Query: 804 -RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDY----------TPEEVI 852
            R ++VT++G LI  +G M+GG +       R G N+ D+ E+Y          T E   
Sbjct: 651 IRSKLVTLEGALIHKAGLMTGGAS-------REGNNRWDK-EEYQGLLALKNRLTSESTE 702

Query: 853 KIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQ 912
            I HE        R+ +    E+E E+  +  +   L +Q+++ +        E+   E 
Sbjct: 703 LISHE--------RLDSAKARELENEISVLNTEISGLRTQLNQIQRSLKENKVEIQYHED 754

Query: 913 QAKEAKMA-YDKAVNEKTQVNEVMKNLEH---------LRG----------EYEDLQSET 952
             K+  +   D   N+  Q    +   EH          +G          EYE    E 
Sbjct: 755 MVKKEYIPKIDSLRNKAAQCEARVSQFEHEKETLQERIYKGITEKLGFSIKEYEQHSGEI 814

Query: 953 -RTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQR 987
            R + ++++ LQ QIM I   KL  +N ++ S   R
Sbjct: 815 MRKQAKELQQLQKQIMNIKN-KLEFENERLESTRAR 849

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  137 bits (345), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 106/165 (64%), Gaps = 10/165 (6%)

Query: 1254 QLEILKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEG 1304
            Q   +KK R + F   F+ +S  ++ +Y+ +T          GGNA L L D  +PF  G
Sbjct: 1046 QFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAG 1105

Query: 1305 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIV 1364
            + +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +
Sbjct: 1106 IKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERI 1165

Query: 1365 ANYIKERT-KNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            ANYI++ +  + QFIVISL+N+MFE +  L+GI+++     S  V
Sbjct: 1166 ANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVV 1210

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 89/166 (53%), Gaps = 13/166 (7%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R 
Sbjct: 2   GRLV--GLELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRS 59

Query: 212 DRLSDLIHKSEAFPDLQACSVAVHFEYIID-EPSGTSRIDEEKPGLVI--TRRAFKNNSS 268
             L DL+++  A  D          E+  D E S   +   EK G V+   R       S
Sbjct: 60  STLKDLVYRDIASAD--------ENEFGEDGERSAYVKAFYEKDGTVVELMRAITAGRDS 111

Query: 269 KYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPK 314
            Y I+ K ++Y   +  L  E I +  + FL+ QG+VE IA   P+
Sbjct: 112 VYKIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 99/206 (48%), Gaps = 28/206 (13%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKF-NLQPISTPE 759
           + +A+ST   +  D VVVDT+  AQ CI YL+K + G   FI LD +  F    P +  +
Sbjct: 538 YALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPLDTIDAFVPTLPTTNIQ 597

Query: 760 NVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLIDIS 818
            +  + + +   D ++  A   V  D+++   L  A  + +      ++VT++G LI  +
Sbjct: 598 GITLVLNAI-DYDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKHNVTSKLVTLEGTLIHRA 656

Query: 819 GTMSGG-----GNHVMK----GLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVAN 869
           G M+GG     GN   K    GL+ L     D++       +I+IE +L+   K F +  
Sbjct: 657 GLMTGGVSKEQGNRWDKEEYQGLVTL----KDKL-------LIQIE-QLSNNSKTFAIE- 703

Query: 870 DTVHEMEEELKKVRDQEPDLESQISR 895
               ++E  + ++     DL +QIS+
Sbjct: 704 --ARDLESNISQLNSSISDLRTQISQ 727

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 103/161 (63%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +K+ R + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1369 -KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
             + R  + QFIVISL+N MFE +  L+G+Y++     S T+
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 105/211 (49%), Gaps = 15/211 (7%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 59

Query: 212 DRLSDLIHKS---EAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPG--LV-ITRRAFKN 265
           + L DLI++    +   +      A   +     P         + G  LV + R   +N
Sbjct: 60  NVLKDLIYRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRN 119

Query: 266 NSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 325
             + Y I+ K  SY + +  L+ E I +  K FL+ QG+VE IA   P         L +
Sbjct: 120 GDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSK 172

Query: 326 YLEDIIGTANYKPLIEERLSQIESLNEICLE 356
             E++ G+  YK   +E   +IE L +   E
Sbjct: 173 MFEEVSGSIQYKKEYDELKEKIEKLGKSATE 203

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 68/126 (53%), Gaps = 4/126 (3%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPEN 760
           + +A+ST   R  D V+V+ +  AQ CI +L+K + G A FI LD +   +L  +S P++
Sbjct: 549 YGLAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLPDS 607

Query: 761 VPRLFDV-VKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLIDIS 818
              +  +     D ++  A   V  D+++   L  A  + + K  R ++VT++G LI  +
Sbjct: 608 QDYILSINAIDYDSEYEKAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIHKA 667

Query: 819 GTMSGG 824
           G M+GG
Sbjct: 668 GLMTGG 673

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  135 bits (341), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 102/160 (63%), Gaps = 10/160 (6%)

Query: 1259 KKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSV 1309
            KK R + F   F+ +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1058 KKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHA 1117

Query: 1310 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI- 1368
             PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI 
Sbjct: 1118 TPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIR 1177

Query: 1369 KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            K    + QFIVISL+N+MFE +  L+G+Y+R     S  V
Sbjct: 1178 KHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSRLV 1217

 Score = 98.2 bits (243), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 107/204 (52%), Gaps = 22/204 (10%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRS 59

Query: 212 DRLSDLIHKSEAFP-----DLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNN 266
             ++DLI++    P              H  Y+    S       ++  + + R   KN 
Sbjct: 60  SAVADLIYRG-VVPEEEDDGEGEGDGDAHRAYV----SAFYSKGPQESTVELKRTISKNG 114

Query: 267 SSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 326
            S Y I+ ++ +Y + ++ L+ + I +  K FL+ QG+VE +A   P         L + 
Sbjct: 115 DSTYQIDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKL 167

Query: 327 LEDIIGTANYKP---LIEERLSQI 347
            E++ G+A YK    L++++L Q+
Sbjct: 168 FEEVSGSAQYKKEYDLLKDQLEQL 191

 Score = 55.8 bits (133), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 687 GFHGRLGDLG-VIDNSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     + + V+++T   +  D V+VD++  AQ CI YL+K + G   FI L
Sbjct: 528 GVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPL 587

Query: 745 D-------RLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANK 797
           D        L   N+Q     +N           + ++  A   V  D ++   L  A K
Sbjct: 588 DTVDSAVATLPSVNIQGYLLAKNAMEY-------ESQYERAINYVCGDAIICDTLDLAKK 640

Query: 798 VAYGKR-RFRVVTVDGKLIDISGTMSGG 824
           + +    + +++ +DG LI  +G M+GG
Sbjct: 641 LKWDHGFKNKLIALDGSLIHRAGLMTGG 668

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 102/161 (63%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1056 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1115

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1116 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1175

Query: 1369 -KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
             + R  + QFIVISL+N MFE +  L+G+Y++     S  +
Sbjct: 1176 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKII 1216

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/161 (40%), Positives = 101/161 (62%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1369 KER-TKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            +     N QFIVISL+N MFE +  L+G+Y++     S  V
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 107/215 (49%), Gaps = 30/215 (13%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHK-------SEAFPDLQACSVAVHFEYIIDEPSGT---SRIDEEKPGLVITRR 261
             L DLI++       SE+  D             ++ PS     +  ++E   + + R 
Sbjct: 60  SILRDLIYRGVITGEDSESDEDGS-----------VNNPSTAYVKAFYEKENKTIELMRT 108

Query: 262 AFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDD 321
             +N  + Y I  K  SY + +  L+ E I +  K FL+ QG+VE IA   P        
Sbjct: 109 ISRNGDTNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM------- 161

Query: 322 GLLEYLEDIIGTANYKPLIEERLSQIESLNEICLE 356
            L    E++ G+  YK   ++   ++E L++   E
Sbjct: 162 DLSRLFEEVSGSIQYKKEYDQLKEKMEQLSKAATE 196

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 4/126 (3%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL-RKFNLQPISTPE 759
           + +A+ST   R  D V+VD    AQ CI YL+K + G A FI L+ +  +     +S  +
Sbjct: 542 YSLAVSTCLGRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETIDSEIPTLSVSNSQ 601

Query: 760 NVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLIDIS 818
                 + ++  DP++  A   V  DT++   L  A ++ + +  + ++VT++G LI  +
Sbjct: 602 GCILAINAIEY-DPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALIHKA 660

Query: 819 GTMSGG 824
           G M+GG
Sbjct: 661 GLMTGG 666

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  134 bits (338), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 102/161 (63%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +K+ R + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1369 -KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
             + R  + QFIVISL+N MFE +  L+G+Y++     S  +
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKII 1219

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 107/209 (51%), Gaps = 13/209 (6%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 59

Query: 212 DRLSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRID---EEKPGLV-ITRRAFKNNS 267
           + L DLI++     D          + +      ++ +    ++   +V + R   +N  
Sbjct: 60  NILKDLIYRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGD 119

Query: 268 SKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 327
           + Y I+EK  SY + +  L+ E I +  K FL+ QG+VE IA   P         L    
Sbjct: 120 TSYKIDEKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMF 172

Query: 328 EDIIGTANYKPLIEERLSQIESLNEICLE 356
           E++ G+  YK   +E   +IE L++   E
Sbjct: 173 EEVSGSIQYKKEYDELKEKIEKLSKSATE 201

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  132 bits (331), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 102/162 (62%), Gaps = 12/162 (7%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F   F  ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1369 KERTKNA--QFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
             +R  N   QFIVISL+N+MFE ++ L+GIY+      S  +
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRII 1212

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 86/168 (51%), Gaps = 25/168 (14%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R 
Sbjct: 2   GRLL--GLELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRS 59

Query: 212 DRLSDLIHKSEAF----------PDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRR 261
           + L DLI++   F           D+   S  V   Y            +E     + R 
Sbjct: 60  NVLKDLIYR--GFLSGDDEDNNNEDVNPNSAYVKAFY-----------QKEDVTHELMRS 106

Query: 262 AFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIA 309
              +  S Y IN K  SY + T  L+ E I +  K FL+ QG+VE IA
Sbjct: 107 ISNSGDSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 153/353 (43%), Gaps = 83/353 (23%)

Query: 687 GFHGRLGDLGVIDNS-FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL       + +A+ST   +  D ++ D +  AQ CI YL+K + G A FI L
Sbjct: 524 GVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNISVAQECIAYLKKQRAGVASFIPL 583

Query: 745 DRLR-KFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTL------VARDLKQANK 797
           + +  +    P S  +      + ++  +P++  A   V  D++      +A+DLK  + 
Sbjct: 584 ESIESEVPTLPFSDGQGCILTINAIEY-EPEYERAMQYVCSDSIICDTLTIAKDLKWKHN 642

Query: 798 VAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK---- 853
           V     + ++VT++G LI  +G M+G       G++R  TN+ D+ E++    V+K    
Sbjct: 643 V-----KSKLVTLEGALIHKAGLMTG-------GILRDATNRWDK-EEFQSLTVLKDKLL 689

Query: 854 --IEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAE 911
             IE EL+   K+F +                    DLES IS    +  SL SE     
Sbjct: 690 SQIE-ELSTSSKSFAIKG-----------------RDLESTISLLNTDITSLRSEFTQLN 731

Query: 912 QQAKEAKM-------AYDK-------AVNEKTQV----------------NEVMKNLEHL 941
           +  +E K+         DK       A+N+K +V                 E+ K   + 
Sbjct: 732 RALEENKVEIQYQTDMIDKEFGPKLDALNDKIKVYDEEISQFENKKEDLQGEIFKEFTNR 791

Query: 942 RG----EYEDLQSETRTKK-EQIKILQDQIMKIGGTKLHTQNSKVGSLCQRID 989
            G    EYE+   E R K+ ++++ LQ QI+ I   KL  +  ++ S  +R +
Sbjct: 792 LGFTIKEYEEHSGEIRRKQAKELQQLQRQILNIEN-KLQFEQERLASTEKRFE 843

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/180 (38%), Positives = 110/180 (61%), Gaps = 14/180 (7%)

Query: 1247 KRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1297
            K  + KE+   +K  R + F   F  +   + ++Y+ +T          GGNA L + + 
Sbjct: 1062 KERKAKEKFLEVKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENE 1121

Query: 1298 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1357
             +P+  G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD
Sbjct: 1122 DEPYLGGIKYFATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALD 1181

Query: 1358 FRNVSIVANYIKERTK-NAQFIVISLRNNMFELAQQLIGIYK--RDN--RTKSTTVKNID 1412
              NV  +A+YIK     NAQFIVISL+N MFE +Q L+GI++   DN  R  S  ++N D
Sbjct: 1182 ITNVERIAHYIKRNANPNAQFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 102/217 (47%), Gaps = 52/217 (23%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R 
Sbjct: 2   GRLI--GLELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRS 59

Query: 212 DRLSDLIHK----------------------SEAFPD---------LQACSVAVHFEYII 240
             L DLI++                      SEA P+           A    V+ +  +
Sbjct: 60  SALVDLIYRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDL 119

Query: 241 DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300
           DEP+              TR    +  S Y IN++  SY +  + L+ E I +  K FL+
Sbjct: 120 DEPTK------------FTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLV 167

Query: 301 LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYK 337
            QG+VE IA   P++       L   LE + G+ NYK
Sbjct: 168 FQGDVERIASQGPES-------LTLLLEQVSGSINYK 197

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 96/203 (47%), Gaps = 18/203 (8%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTP-E 759
           + +A+ST   +  D ++VD++  A  CI YL+K + G A FI LD +   ++ P S P  
Sbjct: 562 YAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI---DVNPPSLPVS 618

Query: 760 NVPRLFDVVKP--KDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLID 816
           NV      +     +     A   V  D+++  +L  A ++ + +  + ++VT++G LI 
Sbjct: 619 NVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIH 678

Query: 817 ISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK--IEHELAEREKNFRVANDTVHE 874
            +G M+GG     K   R   ++      Y    V+K  I  EL      FR  N    E
Sbjct: 679 KAGQMTGGT--AQKNQNRWNKDE------YQGLMVLKDQITEELTALSDKFRADNMKSRE 730

Query: 875 MEEELKKVRDQEPDLESQISRAE 897
           +E E+  + ++   L +QI++ E
Sbjct: 731 LENEISLLNNEISSLRTQITQLE 753

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  129 bits (323), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 108/163 (66%), Gaps = 12/163 (7%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F + F+ ++  ++ +Y+ +T          GG A L L D  +PF+ GV + 
Sbjct: 1063 IKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYH 1122

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1123 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYI 1182

Query: 1369 -KERTKNAQFIVISLRNNMFELAQQLIGIYKR--DNRTKSTTV 1408
             K   K+ QFI+ISL+N MFE +  L+G++++  +N +K+ T+
Sbjct: 1183 RKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 106/206 (51%), Gaps = 26/206 (12%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRS 59

Query: 212 DRLSDLIHK----SEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNS 267
             + DLIH+    S++  D    +    F  + D     S I E      + R    +  
Sbjct: 60  SGMKDLIHRSVRDSQSSNDDPTSAYVKAFYKVTD----ASEITE------LMRIVNLSGE 109

Query: 268 SKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 327
           + Y IN K +S+   +  L KE I +  K FL+ QG+VE IA        +S   L +  
Sbjct: 110 TIYKINGKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLF 162

Query: 328 EDIIGTANYKP---LIEERLSQIESL 350
           E + G+  YK    L++E L++I  L
Sbjct: 163 EQVSGSIQYKKEYDLLKEDLNKINRL 188

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 130/273 (47%), Gaps = 38/273 (13%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTP-- 758
           + +AI T   +  + V+VD++  AQ CI YL+K + G   FI LD +     Q  S P  
Sbjct: 538 YALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPLDTIEA---QIPSLPTI 594

Query: 759 -ENVPR--------LFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGK--RRFRV 807
            +N P+        L       +P+F  A   +  ++++  +L  A  + + +  +  + 
Sbjct: 595 IQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLDIAKDLKWNQNVKNVKF 654

Query: 808 VTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK----IEHELAEREK 863
           VT+DG +I  S  M+GG +   K  M+   N+ D+ ++Y+    +K    +E E   +E 
Sbjct: 655 VTLDGSIIHKSNLMTGGAS---KNSMQ-SNNRWDK-DEYSSLMTLKDNLILEIETISKEN 709

Query: 864 NFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYD- 922
             ++A+    E+E E+  +  +  +L++Q+++         +EL+  +      K+ YD 
Sbjct: 710 --KLASINSRELETEISLLNSEITNLKTQLTQLTRNLKDNNTELLYHQNL---IKLDYDP 764

Query: 923 --KAVNEK-TQVNEVMKNLEHLRGEYEDLQSET 952
             K +N K   ++  MK +E    E E L++ET
Sbjct: 765 KLKDLNHKIIDIDSKMKIIE---DERESLENET 794

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 110/192 (57%), Gaps = 24/192 (12%)

Query: 1241 LNQAVQKRDEVKEQLEILK---KNRFDEFM-----------NGFNIISMTLKEMYQMITM 1286
             + A  + DEV ++ E LK   +  FDEF+           N F  I+  L  +Y  +T 
Sbjct: 1023 FDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIYSELTR 1082

Query: 1287 ---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1337
                     GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA
Sbjct: 1083 NVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFA 1142

Query: 1338 LHKYRPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLIGI 1396
            ++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  L+G+
Sbjct: 1143 INSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGV 1202

Query: 1397 YKRDNRTKSTTV 1408
            +++     S  V
Sbjct: 1203 FRQQQENSSKIV 1214

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 103/217 (47%), Gaps = 41/217 (18%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   V    ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLV--GLELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRS 59

Query: 212 DRLSDLIHKS----EAFPDL--------QACSVAVHFEYIIDEPSGTSRIDEEKPGLVI- 258
             L DLI++     E  P          +   V   +EY                G V+ 
Sbjct: 60  SALKDLIYRDIISRENTPTGADNDENGNRTAYVKAFYEY---------------DGKVVE 104

Query: 259 -TRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEK 317
             R   +   + Y ++    +Y E ++ L+ + I +  K FL+ QG+VE IA   P    
Sbjct: 105 LMRLISRLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL--- 161

Query: 318 ESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEIC 354
               GL + +E++ G+  YK   EE   Q    ++IC
Sbjct: 162 ----GLTKLIEEVSGSMQYKKEYEELKDQ---YDKIC 191

 Score = 62.4 bits (150), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 149/354 (42%), Gaps = 61/354 (17%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQ-PISTPE 759
            + +A+ST   +  D V+VD++  AQ CI +L+K + G   FI LD +     + P+   E
Sbjct: 542  YKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDAATPRMPVPESE 601

Query: 760  NVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLIDIS 818
                  + V+ KD     A Y V  DT++  +L  A  + + K    ++VT+DG LI+ +
Sbjct: 602  TYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKT 660

Query: 819  GTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEE 878
            G M+GG       +     N+ D+ E    + ++ ++ +L             + ++EE 
Sbjct: 661  GLMTGG-------ITSDSANRWDKDE---YQSLLDLKDKL-------------IVDVEEA 697

Query: 879  LKKVRDQEPDLESQISRA-EMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVM-- 935
              K R       + I+R  E+   SLTSE+     Q  + K A ++   E    N ++  
Sbjct: 698  ANKSRQS-----TLIARELEISLSSLTSEISYIRTQITQTKRAVEETETEINHHNNLIDR 752

Query: 936  ------KNLEHLRGEYEDLQSETRTKKE--QIKILQDQIMKIGGTKLHTQNSKVGSLCQR 987
                  K+LE+     ED   +  TK+E  Q K       K+G T +    S  G + ++
Sbjct: 753  EFIPQVKDLENKISGLEDEIRDWNTKREALQEKCFARLTEKVGFT-MKDYESHTGEMIRK 811

Query: 988  IDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTK 1041
                                ++   QKQ+ N E   E  +      +++L+  +
Sbjct: 812  -----------------QTKELQILQKQILNLENKVEFETGRCNATKDRLQNVQ 848

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 121/214 (56%), Gaps = 33/214 (15%)

Query: 1232 IEFKRRKLDLN-QAVQKRDEVKEQLEI---------------------LKKNRFDEFMNG 1269
            IE   R+L  N +AV++ DE KEQ  +                     +K+ R   F++ 
Sbjct: 1003 IENTLRELQPNSKAVERFDEAKEQFSVAIDESEKLKEIERESKEKYLKIKEKRVKTFLSC 1062

Query: 1270 FNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320
            F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ +   PP K ++++ 
Sbjct: 1063 FQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPPMKRFKDMD 1122

Query: 1321 NLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIV 1379
             LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YIK   +   QFIV
Sbjct: 1123 YLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIKRHASPKFQFIV 1182

Query: 1380 ISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDI 1413
            ISL++N+F  +Q + G++ R+ +  S+ V   D+
Sbjct: 1183 ISLKSNLFGKSQSMAGVF-RNQQANSSMVITTDL 1215

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 74/151 (49%), Gaps = 21/151 (13%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTP-- 758
           + +A+S+   +  D +VVD+V  AQ CI YL+K++ G A FI LD +       I+TP  
Sbjct: 540 YALAVSSMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI------DINTPTL 593

Query: 759 --ENVPRLFDVVKP--KDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGK 813
              N+      V     D +   A   V  D+++   L  A  + + +  + ++VT+ G 
Sbjct: 594 PVRNLKGCILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGA 653

Query: 814 LIDISGTMSGGGNHVMKGLMRLGTNQSDEIE 844
           LI  +G M+G       G+ R  TN+ D+ E
Sbjct: 654 LIHRAGLMTG-------GVGRNNTNRWDKAE 677

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  125 bits (315), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 98/161 (60%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +KK R   F   F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1048 IKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYH 1107

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1108 ATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYI 1167

Query: 1369 -KERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
             +   ++ QFIVISL+N MFE +  L+G+Y++     S  V
Sbjct: 1168 SRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1208

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 107/209 (51%), Gaps = 24/209 (11%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F +++GPNGSGKSN++D++ FV G +++ +R 
Sbjct: 2   GRLV--GLELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRS 59

Query: 212 DRLSDLIHKS----EAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNS 267
             L DLI++     E   D +  +  V   Y+  + +           + ++R   +N  
Sbjct: 60  QILKDLIYRGVEGEEDEEDGEGRTAYVKAFYLKSDST-----------VELSRSISRNGD 108

Query: 268 SKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 327
           ++Y +N K   Y +  + L++E I +  + FL+ QG+V  IA        +S   L +  
Sbjct: 109 TQYKMNGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLF 161

Query: 328 EDIIGTANYKPLIEERLSQIESLNEICLE 356
           E+I G+  YK   +    +++SLN+   E
Sbjct: 162 EEISGSIQYKKEYDSLKGKVDSLNQSAAE 190

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 72/142 (50%), Gaps = 5/142 (3%)

Query: 687 GFHGRLGDLGVID-NSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           G  G + DL     + + +AIST   +  D V+VD V  AQ CI YL+K + G A FI L
Sbjct: 520 GVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKKQRAGIASFIPL 579

Query: 745 DRLR-KFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
           D +  +     +S  +      + +   + ++  A   V  D+++  D+  A  + + K 
Sbjct: 580 DTIDVEIPTLTLSDSQGCTLAINAI-DYEQEYERALQYVCSDSIICDDMNIAKDLKWNKG 638

Query: 804 -RFRVVTVDGKLIDISGTMSGG 824
            R ++VT++G LI  +G M+GG
Sbjct: 639 VRSKLVTLEGALIHKAGLMTGG 660

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  124 bits (311), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 100/161 (62%), Gaps = 10/161 (6%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +K+ R + F+  FN +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1369 KER-TKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            +   +   QFIVISL++N+F  ++ + G+++  +   S  +
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 92/191 (48%), Gaps = 20/191 (10%)

Query: 152 GRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L + NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLI--GLEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRS 59

Query: 212 DRLSDLIHKSEAFPDLQAC-----SVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNN 266
             L DLI++        A      S  V   Y+  + SG  R  E       TR      
Sbjct: 60  SALVDLIYRGRMEEGGSAHENNPKSAYVTAFYVKQDASGAERRME------FTRVIHNTG 113

Query: 267 SSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 326
            S Y ++ K   Y E   +L+ E I +  + FL+ QG+VE IA        +S   L + 
Sbjct: 114 DSTYKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTKL 166

Query: 327 LEDIIGTANYK 337
            E + G+  Y+
Sbjct: 167 FEQVSGSVQYQ 177

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 95/412 (23%), Positives = 176/412 (42%), Gaps = 57/412 (13%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFN-LQPISTPE 759
            + V +ST   +  D V+VD++  AQ CI YL+K++ G A FI LD +   +   P     
Sbjct: 540  YAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDTSSPTLPAGDNT 599

Query: 760  NVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLIDIS 818
                  D ++  +     A   V  D+++   L  A  + + +  + ++VT++G LI  +
Sbjct: 600  GCILTLDAIEY-ESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRA 658

Query: 819  GTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVI--KIEHELAEREKNFRVANDTVHEME 876
            G M+G       G+ +  TN+ D+ E+Y    ++  KI  EL+E     R  +    + E
Sbjct: 659  GLMTG-------GITKNNTNRWDK-EEYQSLLLLKDKISTELSELTTGIRTGSIKSRDYE 710

Query: 877  EELKKVRDQEPDLESQISRAEMEADSLTSEL--------------------MLAEQQAKE 916
             E+  +  +   L SQ+++         +EL                    M+ E   + 
Sbjct: 711  NEVSLLSTEISSLRSQLNQLNRSMKEALTELNYHDDLIEKEYSPKVDSLHKMVEEVDGQM 770

Query: 917  AKMAYDKAVNEKTQVNEVMKNLEHLRGEYED-LQSETRTKKEQIKILQDQIMKIGGTKLH 975
            A +A DKA  + +   +  K +    GEYE       R    +++ LQ ++M I   KL 
Sbjct: 771  ADIAKDKANLQASVYKDFSKKIGFDIGEYEQHTGGRLRKHSRELQQLQKEVMNI-ENKLE 829

Query: 976  TQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNF-EQDEELSSNELKVIE 1034
             +  ++ S  +R                    D+ K Q +L +   Q+ ++ SN  +V  
Sbjct: 830  FETERLESTIKR--------------QQKAREDLKKVQGELDSLTSQETDIQSNLEQVTN 875

Query: 1035 EKLKQTKL------ALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080
            +  ++TK+       L +   N+  I +  ++L D  +  K  +TE +E+I+
Sbjct: 876  QIAEETKVLEEAQEKLKKKGNNIKIIEDTINDLHDSIQTCKREITEWKEDIE 927

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  104 bits (260), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 98/179 (54%), Gaps = 11/179 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      ++A SV + F+    +PS +    E  P + +TR+     +SKY IN 
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVFDN--SDPSSSPFGFETYPKISVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
             +    V  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  GT
Sbjct: 120 HRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAGT 171

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 160/728 (21%), Positives = 310/728 (42%), Gaps = 156/728 (21%)

Query: 701  SFDVAIS---TACPRLDDVVVDTVECAQHCIDY--LRK-------NKLGYARFILLDRLR 748
            +FD A +    A  RL +V+VD  + A   ++   LRK       NK+  AR I  D L 
Sbjct: 537  NFDSANALQVCAGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDALN 595

Query: 749  KFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRV 807
            K        P  V    +++   + + + A   +   +L+ RD   A KV +  + R R 
Sbjct: 596  K---AKSLAPGAVELALNLI-GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARS 651

Query: 808  VTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDY--TPEEVIKIEHELAEREKNF 865
            +T+DG + D  GT+SGG       L+        +I+ Y    ++++ +E EL + +   
Sbjct: 652  ITLDGDIYDPEGTLSGGSRSHTSSLL-------IDIQKYNEAAKQMMVLEKELYQVQ--- 701

Query: 866  RVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAV 925
              AN + HE    + K                    SL +EL LA+ + + A+ A D   
Sbjct: 702  --ANISEHENASRMTK--------------------SLQNELNLAKHKCQLAENALDS-- 737

Query: 926  NEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLC 985
            N   Q+  + +N E  R E E  +++   +  ++  LQ +I++I                
Sbjct: 738  NPAAQI--IKRNGEIHR-EIEASENDRDQQTTRVNALQMEILRI---------------- 778

Query: 986  QRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALT 1045
                                       Q+ +  F  D+    ++LK    +++  K +L+
Sbjct: 779  ---------------------------QRDMDEFNTDKGSKLDQLKA---EIRDLKRSLS 808

Query: 1046 ENDTNMTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKN 1105
            EN+  + +  +L   L+ + EQL+  +  M++ + E + L   ++ ++ KL   ++   N
Sbjct: 809  ENEEVIEKKYDLYQNLQMETEQLQNDVVTMKQELVEKEQLLQSLEERITKLERDVLLRSN 868

Query: 1106 EIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKD 1165
            +++   ++LN+             + N++  +++ I++     +DK   + + E   +K 
Sbjct: 869  DLESVQRDLNE-------------ERNKLLRIDEEIEELTSLIRDKSKKMSESELEYQKL 915

Query: 1166 DADNNHHSMNIDEMSSEISRGIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLE 1225
             A+ N    N +++  EI                         GL   I   +  I  LE
Sbjct: 916  TAEANKSKYNAEKIEEEI------------KALKDENSWLSDAGLVANILNQNEGIN-LE 962

Query: 1226 EYVRRLIEFK------RRKLDLN-----QAVQKRD---------------EVKEQLEILK 1259
            EY  R  + +      RRK++ N     + V+K++               ++ E +E L 
Sbjct: 963  EYRERAKQLQEKFQGMRRKVNPNIMSMIENVEKKEAALRTMIKTIEKDKMKIVETIEKLN 1022

Query: 1260 KNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1319
            + + D  +  +  +++    ++  +     A+L  ++  D  + G+   V        ++
Sbjct: 1023 EYKRDALVKTWEKVNVDFGNIFAELLPNSFAKLAAIEGKD-VTAGLEVKVKLGTLWKESL 1081

Query: 1320 TNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379
              LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K +QFIV
Sbjct: 1082 VELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIV 1141

Query: 1380 ISLRNNMF 1387
            +SL+  MF
Sbjct: 1142 VSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  102 bits (254), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 11/182 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I +L++D FKSYA R V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      +   SV + F  +  +P  +    E  P L +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 101/448 (22%), Positives = 183/448 (40%), Gaps = 89/448 (19%)

Query: 685  INGFHGRLGDLGVIDNSFDVAIS---TACPRLDDVVVDTVECAQHCIDY--LRK------ 733
            + G   +L  L   +N++D A++    A  RL +V+VD    A   ++   LRK      
Sbjct: 523  VKGVAAQLFTLS--ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKRVTIIP 580

Query: 734  -NKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDL 792
             NK+   R I  + L+   L     P  V    ++V  ++ + S A   +  ++LV  D 
Sbjct: 581  LNKIA-TRVINSESLK---LAKQLAPGKVQLALNLVGYEE-EVSKAMEYIFGNSLVCNDA 635

Query: 793  KQANKVAYGKR-RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEV 851
            + A ++ +  + R R +T  G + D  GT+SGG  +          N+S  + D      
Sbjct: 636  ETAKRLTFHPQIRTRSITQQGDVYDPEGTLSGGSRN----------NKSTLLVDI----- 680

Query: 852  IKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAE 911
                       + +  A   +  +E+EL  + ++  + ES    A  +   + ++L L  
Sbjct: 681  -----------QKYNSAAKRMKVLEDELLVISNKLKEQES----ASAKTKEIQNKLNLVS 725

Query: 912  QQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKI-- 969
             +       + + +NE     +++K  + L  +  + + E   K+  +  LQD+I KI  
Sbjct: 726  HKLS----IFQRTLNENP-ATQIIKRNDDLTRQIRECEEEIEQKQSYMSQLQDEIRKIQD 780

Query: 970  --------GGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQK-QLKNFE 1020
                     GTKL     ++ SL + I                   D+  YQ  QL+  +
Sbjct: 781  DMEEFNNDKGTKLEKLKKEIDSLTKEIG--------KLDSITDKKYDL--YQNLQLETEQ 830

Query: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080
               E+SS+E             AL   +T++    N K  L  + E  +  L ++   +D
Sbjct: 831  LTSEISSDED------------ALEHMNTSLDNFQNQKKSLIAELEHAEHTLADVHSEVD 878

Query: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIK 1108
            E K   +++  +L++LN  LIH K E K
Sbjct: 879  EEKKRLVDIDEELKELNG-LIHAKAEKK 905

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score =  100 bits (250), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 97/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G S    E P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNTPIGFS----EYPKISVTRQIVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  I  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 105/416 (25%), Positives = 204/416 (49%), Gaps = 60/416 (14%)

Query: 1028 NELKVIEEKLKQTKLALTENDTNMTEISNLKSEL----KDQGEQLKERLTEMEENIDEFK 1083
            NE+K +E+  KQ  L   EN +   EI  L+ ++    K++G +LKE   E+ E  ++ K
Sbjct: 752  NEVKTLEDSTKQKML---ENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQIK 808

Query: 1084 SLEIE---MKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQ-------MLDNNQ 1133
             LE E   + +  EK+      I NEI    K L D +++D+   L+       ML  ++
Sbjct: 809  DLESESEKLNDTYEKIKVETEQIANEIDTDTKSL-DSTVQDIEKKLEEEIKINKMLKTSE 867

Query: 1134 MDVVEDGIKDEQDADQDKPSGIPDD----EKIQEKDDADNNHHSMNIDEMSSEISR---- 1185
             +++   ++++ + ++ + S I D+    E+  ++ +   N + + + ++  ++S+    
Sbjct: 868  EELM--SVQNDLNVERKRISNIDDELEELERTIKQKEESKNTYELELKQLHHDLSKYKNS 925

Query: 1186 --GIPXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFK------RR 1237
              GI                      L   I E +  + V  EY  R+ + +      RR
Sbjct: 926  TDGIEKALNDIQEEHEWVTDEM----LVRSICEQNAGVNV-NEYRHRMEQLQKNFDELRR 980

Query: 1238 KLDLN-----QAVQKRDE-VKEQLEILKKNR--FDEFMNGFNIISM-TLKEMYQMITMG- 1287
            K++ N     ++V+K+ E +K  +  ++K++   ++ ++  N     TL + ++ +T   
Sbjct: 981  KVNPNIMNMIESVEKKGEALKTMIRTIEKDKKKIEDTISKLNEYKKETLVKTWKKVTKDF 1040

Query: 1288 GNAELELVDS----LDP-----FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFAL 1338
            GN   +L+ +    L P      +EG+   V        ++  LSGG+++L +L+L+ AL
Sbjct: 1041 GNIFCDLLPNSSAKLVPCEGKDITEGLEVKVKLGNLWKESLVELSGGQRSLIALSLIMAL 1100

Query: 1339 HKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLI 1394
             ++RP P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1101 LQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 708 TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL-------RKFNLQPISTPEN 760
            A  RL +V+VD  +     +   R  K      I LD++        K  L     P  
Sbjct: 547 CAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKLAKQLAPGK 604

Query: 761 VPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTVDGKLIDISG 819
           V    +++   D +   A   +  ++L+  D + A K+ +    R R +T++G + D  G
Sbjct: 605 VELALNLIGYSD-EVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEG 663

Query: 820 TMSGG 824
           T+SGG
Sbjct: 664 TLSGG 668

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 96/181 (53%), Gaps = 15/181 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEY--IIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      ++A SV + F+   I   P G  R     P + +TR+     +SKY I
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVFDNSDIKSSPIGFERY----PKISVTRQIALGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 T 333
           T
Sbjct: 171 T 171

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            +QFIV+SL+  MF  A ++     +D  +  + +
Sbjct: 1137 SQFIVVSLKEGMFNNANRVFKTRFQDGTSAVSVI 1170

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 96/430 (22%), Positives = 180/430 (41%), Gaps = 84/430 (19%)

Query: 685  INGFHGRLGDLGVIDNSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
            + G   ++  LG   ++FD A +    A  RL +++VD  + A   ++          + 
Sbjct: 523  VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLE----------KG 570

Query: 742  ILLDRLRKFNLQPIST---------------PENVPRLFDVVKPKDPKFSNAFYSVLKDT 786
            +L  R+    L  IST               P  V    +++  ++   S A   +   +
Sbjct: 571  MLRKRVTIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSKAMQYIFGGS 629

Query: 787  LVARDLKQANKVAYGKR-RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIED 845
            L+  D + A K+ +  + R R +T+DG + D  GT+SGG ++    L++       +I+ 
Sbjct: 630  LICADAETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLK-------DIQK 682

Query: 846  YTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTS 905
            Y         +E + R K+F          E EL  ++ Q  + E    RA     SL +
Sbjct: 683  Y---------NEASRRSKSF----------ESELSLIQQQIMECE----RASQLTKSLQN 719

Query: 906  ELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQ 965
            EL LAE + + ++ A     N   Q+  + KN E L  E E  +++   +K     LQ +
Sbjct: 720  ELDLAEHKFQLSQKAL--VSNPAAQI--IKKNDEML-NEIETCKTDIDLQKISTAELQAE 774

Query: 966  IMKI----------GGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQ 1015
            +++I           G+KL   N +V +L ++I                   +  + Q  
Sbjct: 775  VVRIQKDMQEFNTDKGSKLKQLNKEVSTLAKQIKDKEVVTEQKYDLYQNLQMETEQLQTD 834

Query: 1016 LKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEM 1075
            +   +Q+     + +KV+E+K+  T    +E     +E+ N+K  L ++    + RL  +
Sbjct: 835  ISAMKQEIVEKKSLIKVLEQKIITTD---SEFSCKQSELENVKGNLNEE----RNRLIGI 887

Query: 1076 EENIDEFKSL 1085
            +E I E ++L
Sbjct: 888  DEEIKELETL 897

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 95/182 (52%), Gaps = 11/182 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      +   SV V F+      S     +  K  + +TR+     SSKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDNSDKSNSPIGFTNSAK--ISVTRQVMLGGSSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 83/142 (58%), Gaps = 3/142 (2%)

Query: 1248 RDEVKEQLEILKKNRF--DEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1305
            +D+VK Q  I K N +  D  +  +  +++   +++  +     A+L  ++     +EG+
Sbjct: 1009 KDKVKIQETIHKLNEYKKDTLIKTWKKVTVDFGQVFADLLPNSFAKLVPLEG-KEVTEGL 1067

Query: 1306 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1365
             F V        ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + 
Sbjct: 1068 EFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIG 1127

Query: 1366 NYIKERTKNAQFIVISLRNNMF 1387
            + IK R K +QFIV+SL+  MF
Sbjct: 1128 HLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 103/450 (22%), Positives = 183/450 (40%), Gaps = 77/450 (17%)

Query: 685  INGFHGRLGDLGVIDNSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
            + G   +L  L   ++++D A +    A  RL +VVVD    A   ++  R  K      
Sbjct: 523  VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 742  ILLDRL--RKFNLQPI-----STPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQ 794
            I L+R+  R  N Q +     + P  V    ++V  ++ + S A   +  ++L+ +D + 
Sbjct: 579  IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEE-EVSRAMEFIFGNSLICKDAET 637

Query: 795  ANKVAYGKR-RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK 853
            A K+ +  + R R +T+ G + D  GT+SGG  +    L+        +++ Y      K
Sbjct: 638  AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLI-------DVQKYN-----K 685

Query: 854  IEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQ 913
                + E E   +     + E E +L+K R    DL           +  T +L LA++ 
Sbjct: 686  TAKRIEELELKLKSITRDLEEQESKLQKTRSVRNDL-----------NLATHKLTLAQRS 734

Query: 914  AKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKI---- 969
                         E  Q   +++  E L  E ++ Q E  +K+  I   + +I +I    
Sbjct: 735  L------------ESNQAAHIIRKNEELIKEIDESQKEIASKRSSISDCEKEIQRIQTDI 782

Query: 970  ------GGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDE 1023
                   G+KL     +V  L + I I                 D     +QL       
Sbjct: 783  QEFSTDKGSKLKQLKDEVSKLFKEIGILETKVESKYDSYQTFQLDT----EQLAGEIASG 838

Query: 1024 ELSSNELKVIEEKLKQTKLALTEN-DTNMTEISNLKSELK-------DQGEQLKERLTEM 1075
              +  +L  +++ L+  + +L EN   N TE+ N++ ELK       D  E+LKE  T +
Sbjct: 839  NDTVKQLSELQQTLEGERRSLEENLGMNQTELDNVQVELKAEQSRLVDINEELKELDTVI 898

Query: 1076 EENIDEFKSLEIEMKNKLEKLNSLLIHIKN 1105
            +   +   + E+E    L+KL++ L   KN
Sbjct: 899  KTKTEAKNNYELE----LQKLSNDLNKFKN 924

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 97/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV V F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDNSDRDNSPIGFTN----SPKISVTRQVVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFNNANRVF 1156

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 15/156 (9%)

Query: 690 GRLGDLGVIDNS-FDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD 745
           G    L  +D   FD AI+    A  RL +++VD    A   ++  R  K      I L 
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 746 RL--RKFNLQPIS-----TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKV 798
           ++  R  N   ++      P  V    +++   D + S A   +  + LV +D   A KV
Sbjct: 583 KIATRTLNKNTLALAKELAPGKVELALNLI-GYDDEVSKAMEFIFGNGLVCKDADTAKKV 641

Query: 799 AYGKR-RFRVVTVDGKLIDISGTMSGGGNHVMKGLM 833
            +    R R +T  G + D  GT+SGG  +  + L+
Sbjct: 642 TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL 677

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 97/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F     ++ P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNNTDKLNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WRN-ITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W++ +  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G +        + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGITKASVTIVFDNTDKTNSPIGFNN----SAKISVTRQVVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1138 SQFIVVSLKEGMFSNANRVF 1157

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 700 NSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RKFNLQPIST 757
           NS       A  RL +VVVD  + A   ++  R  K      I L+++  R  N +  +T
Sbjct: 539 NSATALQVCAGGRLYNVVVDNEKTASSLLERGRLRK--RVTIIPLNKISARTLNERSCTT 596

Query: 758 ------PENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTV 810
                 P  V    +++   D + SNA   +   +L+ +D   A KV +  + R R +T+
Sbjct: 597 KRKKLAPGKVELALNLI-GYDDEVSNAMEFIFGGSLICQDADTAKKVTFHPQIRTRSITL 655

Query: 811 DGKLIDISGTM 821
           +G + D  GT+
Sbjct: 656 EGDVYDPEGTL 666

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WRN-ITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W++ +  LSGG+++L +LAL+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 100/443 (22%), Positives = 201/443 (45%), Gaps = 55/443 (12%)

Query: 684  RINGFHGRLGDLGVIDNS---FDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYA 739
            + N  +G +G L  +D+    +  A+ T A  RL +VVV   + A   ++  R  K    
Sbjct: 519  KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK---- 574

Query: 740  RFILLDRLRKFNLQPIS----------TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVA 789
            R  ++  L K + +PIS           P  V    +++K  D   + A   +  ++L+ 
Sbjct: 575  RVTIIP-LNKISTRPISPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLIC 632

Query: 790  RDLKQANKVAY-GKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTP 848
             D + A K+ +  K R R +T+ G + D  GT+SGG  +    L+ +   + ++I+    
Sbjct: 633  EDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLL-VDIQKYNQIQRKI- 690

Query: 849  EEVIK--IEHELAEREKNFRVANDT---VHEMEEELKKV----RDQEPDLESQI-SRAEM 898
             E+I+  + H   E +K +  +  T    +++   L K+    R+ E +  SQI +R E 
Sbjct: 691  -EIIQADLNHVTEELQKQYTTSQKTKTIQNDLNASLHKLDLAKRNLEVNPSSQIMARNE- 748

Query: 899  EADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRG-EYEDLQSETRTKKE 957
                +  E+   E + K  +M  ++   E + + + MK  ++ +G +  +L++E    K 
Sbjct: 749  ---EILREIGECENEIKIRQMDLERCRQEVSSIEKDMKEYDNDKGSKLNELKNEL---KS 802

Query: 958  QIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLK 1017
              K L++Q          +++     L Q +++                 + LK  + LK
Sbjct: 803  LAKNLEEQ---------ESESEGKYDLFQNLELETEQLSSELDSNKTLLQNYLKSIESLK 853

Query: 1018 --NFEQDEELSSNE--LKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLT 1073
              N E +E++ S E  L  I+ KL + K  L + D  +TE+  L  + +++ +  +  L 
Sbjct: 854  SENTELEEKIRSIEDNLATIQAKLNEEKKRLMDIDDELTELETLMKKKQEKKKSSELELQ 913

Query: 1074 EMEENIDEFKSLEIEMKNKLEKL 1096
            ++  +++++KS    ++ K+E+L
Sbjct: 914  KLIHDLNKYKSNTDNIEKKIEEL 936

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 95/180 (52%), Gaps = 13/180 (7%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRID-EEKPGLVITRRAFKNNSSKYYIN 273
            DLI+K      +   SV + F+   +    +S I  E  P + +TR+     +SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFD---NTDKSSSPIGFESYPKISVTRQIILGGTSKYLIN 118

Query: 274 EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
              +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 84/147 (57%), Gaps = 1/147 (0%)

Query: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
            + +++E +E L + + D  +  +  +S+    ++  +     A+L   +  D  +EG+  
Sbjct: 1011 KTKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLVPCEGKD-VTEGLEV 1069

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1367
             V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1368 IKERTKNAQFIVISLRNNMFELAQQLI 1394
            IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMFTNANRVF 1156

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 135/308 (43%), Gaps = 55/308 (17%)

Query: 701 SFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RKFN---- 751
           +FD A +    A  RL +VVVD    A   ++  R  K      I L+++  R  N    
Sbjct: 537 NFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENAL 594

Query: 752 -LQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVT 809
            L     P NV    +++  +D + S A   +   +L+ +D + A +V +  + R R +T
Sbjct: 595 KLAKSVAPGNVELALNLIGYED-EVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSIT 653

Query: 810 VDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVAN 869
           +DG + D  GT+SGG  +    L+                  I I+         F  A+
Sbjct: 654 LDGDIYDPEGTLSGGSRNTKNSLL------------------IDIQ--------TFNAAS 687

Query: 870 DTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKT 929
             ++EME ELK++  +  + E    +   +  SL +EL LA  +   AK +   A N  T
Sbjct: 688 KRLNEMELELKQINSKIAEYE----QTSQKTKSLQNELNLATHKLSLAKKSL--AANSAT 741

Query: 930 QV----NEVMKNLEHLRGEY--EDLQSETRTKKEQIKILQD--QIMKIGGTKLHTQNSKV 981
           Q+    NE+   +     E   + L SE   ++E IKI +D  +  +  G+KL     ++
Sbjct: 742 QIIRRNNEISDEISSCTAEINRQTLLSE-EFEQEIIKIQKDMEEFNQDKGSKLRELKEEI 800

Query: 982 GSLCQRID 989
            +L ++I+
Sbjct: 801 TNLSKKIE 808

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 186/773 (24%), Positives = 324/773 (41%), Gaps = 185/773 (23%)

Query: 686  NGFHGRLGDLGVIDNSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
            +  HG LG+L  ++  +   A +     L  VVVDT E A   ++ L   K G   FI L
Sbjct: 533  DSVHGPLGELIKVNEKYKACAEAVGGNALLHVVVDTDETASILMEELYNTKAGRVTFIPL 592

Query: 745  DRLRKFNLQPISTPEN-----VPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVA 799
            +R+   N  P++ P+N      P ++ +   K  +F  A   V   T+V RD+   +K+A
Sbjct: 593  NRIADSN--PVTFPDNSQAECTPLIWKMKYEK--RFEKAVRHVFGRTIVVRDIGTGSKLA 648

Query: 800  YGKRRFRV--VTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHE 857
               + F +  VT+DG   D  G ++GG +   K       N+ D +++ +       + +
Sbjct: 649  ---KSFNLDAVTLDGDRTDKRGLITGGYHDYHK------RNRLDCLKEMSA-----AKRQ 694

Query: 858  LAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAE--------MEA--DSLTSEL 907
            L E  KN   A   +  ++ E+ ++ D+   +++Q SR E        M A  +  T+E 
Sbjct: 695  LLEATKNLDAARGQITAIDTEIDQINDE---IKTQSSRKEAILSNIENMRAKLNKKTAER 751

Query: 908  MLAEQ-----QAKEAKMAYDKAVNE-KTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKI 961
             L ++       K A+M     +NE KT+  E   N    +G   D + +T      +K 
Sbjct: 752  ALKKEILDSITTKHARMETSLKLNEEKTERFETDLNKPFEKG-LSDEEEQT------LKS 804

Query: 962  LQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQ 1021
            L D+ M+     L      +  L  +ID+                   LK +  +K   Q
Sbjct: 805  LADK-MRAVSEPLSVTADALNELTLKIDL-------------------LKAELGVKLVPQ 844

Query: 1022 DEELSSNELKVIEEKLKQT----KLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEE 1077
             +E        IE+++ Q     +LA +E      E+S + +EL+    +  E  T ++ 
Sbjct: 845  KKE--------IEDRISQASGSKRLASSE------ELSQISTELEKLASREHELQTSLQG 890

Query: 1078 NIDEFKSLEIEMKNK---LEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQM 1134
              D   SL  E +N    LEK NS           Q + L           L+ LD  Q 
Sbjct: 891  ISDNIASLNEEKENNQQILEKANS-----------QQRAL-----------LKKLDGYQK 928

Query: 1135 DVVEDGIK-----DEQDADQDKPS--GIPDDEKIQEKDDADNNHHSMNIDEMSSEISRGI 1187
            D  +  I+       +D  Q K S  G+  +E +    + D+      ++E++ +IS+  
Sbjct: 929  DAEKSVIRKTTLVSRRDEVQQKISEIGLLSEESLDRHQNLDSEEVLRRLNEVNDKISK-- 986

Query: 1188 PXXXXXXXXXXXXXXXXXXXXGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQA--- 1244
                                   T  +N  ++      E  R+  E KR +L+ N+A   
Sbjct: 987  -----------------------TSNVNRRAI------ENFRKFNE-KREELE-NRAEEL 1015

Query: 1245 VQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELV--------- 1295
             + ++ ++E ++ LKK + +     F+ ++     +++ +   G  +L +          
Sbjct: 1016 ARSKESIEELVDSLKKQKIEAVEATFSKVANNFTHIFEKLVPAGVGKLVIHRNESTRNAS 1075

Query: 1296 ----------------DSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFA 1337
                            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A
Sbjct: 1076 GGRGPQQGSGASGNEDDSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILA 1135

Query: 1338 LHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1390
            +    P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R++M ++A
Sbjct: 1136 IQMVDPAPFYLFDEIDAALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVA 1188

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 97/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFTN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFANANRVF 1156

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 95/182 (52%), Gaps = 11/182 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      +   SV + F    D+ + +    E  P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 97/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFAN----SPQISVTRQVVLGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 96/441 (21%), Positives = 182/441 (41%), Gaps = 85/441 (19%)

Query: 689  HGRLGDLGVIDNS---FDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
            +G +G L  +DN    +  A+ T A  RL +VVV   + A   ++  R  K      I L
Sbjct: 524  YGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRK--RVTIIPL 581

Query: 745  DRLRKFNLQPIS-------TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANK 797
            D++    + P          P  V    ++++   P  + A   +  ++L+  D + A K
Sbjct: 582  DKIYTRPITPQVLELAKSIAPGKVELAINLIRFDKP-VTKAMEFIFGNSLICDDPETAKK 640

Query: 798  VAY-GKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLM-----------RLGTNQSDEIED 845
            + +  K R R +T+ G + D  GT+SGG  +  + L+           ++GT Q+D   +
Sbjct: 641  ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLLVDIQKYNQIQEKIGTIQADL--N 698

Query: 846  YTPEEVIKIEHELAEREKNFRVAND-TVHEMEEELKK------------VRDQE-----P 887
               EE+ K   + A  +K   + ND  + + + +L K            VR++E      
Sbjct: 699  QVAEELRK---QYATSQKTKTIQNDLNLSQHKLDLAKRNLEVNPSSQIMVRNEEILRDIG 755

Query: 888  DLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYED 947
            D E++I   +M       E+   E+  KE    YD   ++ +++NE+ K L+    + E 
Sbjct: 756  DCENEIKNKQMILQRWQEEISTIEKDMKE----YDS--DKGSKLNELKKELKLFAKDLEK 809

Query: 948  LQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXX 1007
             +SE   K +                          L Q +++                 
Sbjct: 810  QESEAECKYD--------------------------LFQNLELETEQTRSELDSNKALLQ 843

Query: 1008 DVLKYQKQLK--NFEQDEELSSNE--LKVIEEKLKQTKLALTENDTNMTEISNLKSELKD 1063
              LK  + LK  N E + ++ + E  L  I+ +L + K  L + D  +TE+  LK + ++
Sbjct: 844  SYLKSIESLKLENSELEGKIQTMEDHLVTIQTELNEEKRRLIDIDDELTELETLKKKKQE 903

Query: 1064 QGEQLKERLTEMEENIDEFKS 1084
              +  +  L ++  +++++KS
Sbjct: 904  DRKNAELELQKLVYDLNKYKS 924

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 94/182 (51%), Gaps = 11/182 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      +   SV + F+    + S      E  P + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDN--SDKSNAPIGFESSPTISVTRQVALGGTSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 110/496 (22%), Positives = 206/496 (41%), Gaps = 108/496 (21%)

Query: 685  INGFHGRLGDLGVIDNSFDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
            + G   RL  L   +N++  A +    A  RL +VVVD  + A   +   R  K      
Sbjct: 523  VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTI 578

Query: 742  ILLDRL--RKFNLQPIS-----TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQ 794
            I L+++  RK N + ++     +P NV    +++  ++   + A   +   +L+ +D + 
Sbjct: 579  IPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAET 637

Query: 795  ANKVAYGKR-RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK 853
            A KV +  + R R +T+ G + D  GT+SGG  ++   L+        +I+ Y       
Sbjct: 638  AKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLLV-------DIQKYNE----- 685

Query: 854  IEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQ 913
                          A+   + ++EEL  ++++   LE    R       L +E  L + +
Sbjct: 686  --------------ASKQTYVLQEELSVIQERLVALE----RVYEGTRVLQNEYNLLKHK 727

Query: 914  AKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKI---- 969
             + A+   D   N  TQV   MK  E +  E     +E  T  E +    ++I +I    
Sbjct: 728  LRLAQRNLDS--NSSTQV---MKRNEEIYQELAVCNNEITTNNELVLKFGNEIKQIERDM 782

Query: 970  ------GGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQ--LKNFEQ 1021
                   G+KL    +++ SL ++I+                  +V+   K    +N + 
Sbjct: 783  KEFSKDKGSKLKELKNELESLGKQIE----------------NQEVIAESKSDLFQNLQL 826

Query: 1022 DEELSSNELKVIEEKLKQTKLA-------LTENDTNMTEISNLKSELKDQGEQLKERLTE 1074
            + E  SNE++  E  ++QT ++       L    T + EI N    ++DQ  + K+RL +
Sbjct: 827  ETEQLSNEIQADEHYIEQTSVSKKSLEEELETISTQLKEIENELQLVQDQLSEEKKRLLD 886

Query: 1075 MEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQM 1134
            ++E   +  +               +I  K+EIK      ++L ++ +TH L    N+  
Sbjct: 887  IDEEAADLAN---------------IIKSKSEIKSN----SELELQKLTHDLTKFKNSTS 927

Query: 1135 DVVEDGIKDEQDADQD 1150
             + E   K +Q AD++
Sbjct: 928  GINE---KIKQLADEN 940

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 95/183 (51%), Gaps = 13/183 (7%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRID-EEKPGLVITRRAFKNNSSKYYIN 273
            DLI+K      +   SV + F    +     S I  E  P + +TR+     +SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFA---NSDKNNSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 274 EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
              +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 334 ANY 336
             +
Sbjct: 172 KMF 174

 Score = 67.0 bits (162), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G +        + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNSDKTNSPIGFNN----SSKISVTRQIILGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 333 TANY 336
           T  +
Sbjct: 171 TKMF 174

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WRN-ITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W++ +  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 14/134 (10%)

Query: 702 FDVAIS---TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRL--RKFNLQPIS 756
           FD A +    A  RL +VVVD  + A   ++  R  K      I L+++  R  N + + 
Sbjct: 538 FDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQ 595

Query: 757 -----TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-RFRVVTV 810
                 P  V    +++   D + S A   +   +LV +D   A KV +  + R R +T+
Sbjct: 596 MAKDIAPGKVELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITL 654

Query: 811 DGKLIDISGTMSGG 824
           DG + D  GT+SGG
Sbjct: 655 DGDVYDPEGTLSGG 668

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 94/180 (52%), Gaps = 13/180 (7%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRID-EEKPGLVITRRAFKNNSSKYYIN 273
            DLI+K      +   SV + F    +  +  S I  E    + ITR+      SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFN---NSDTSNSPIGFESHAKISITRQIILGGVSKYLIN 118

Query: 274 EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
              +    V +L +   +++++  FLI+QG++  +  MKP+        +L  +E+  GT
Sbjct: 119 GHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGT 171

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 86/147 (58%), Gaps = 1/147 (0%)

Query: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
            + +++E +E L + + +  +  +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANY 1367
             V   K    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1368 IKERTKNAQFIVISLRNNMFELAQQLI 1394
            IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMFTNANRVF 1156

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 94/181 (51%), Gaps = 15/181 (8%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
            DLI+K      +   SV + F+     + P G +      P + +TR+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFNT----SPRISVTRQIVIGGTSKYLI 117

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N   +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAG 170

Query: 333 T 333
           T
Sbjct: 171 T 171

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1375 AQFIVISLRNNMFELAQQLI 1394
            AQFIV+SL+  MF  A ++ 
Sbjct: 1141 AQFIVVSLKEGMFTNANRVF 1160

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 95/182 (52%), Gaps = 11/182 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      +   SV + F+      S     D  K  + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNSDKSNSPIGFNDSLK--ISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L +   +++++  FLI+QG++  +  M+P         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 105/451 (23%), Positives = 202/451 (44%), Gaps = 82/451 (18%)

Query: 1017 KNFEQDEELSSNELKVIEEKLKQTKLA--LTENDTNMTEISNLKSELKD---QGEQLKER 1071
            KN +++ EL+ ++LK+ E  L+    A  + +N+   +EI+  K E+KD   Q +QLK++
Sbjct: 715  KNLQKELELAQHKLKLSERNLQSNTAAQLIRKNEELESEIAQCKEEIKDKTSQIKQLKKQ 774

Query: 1072 LTEMEENIDEF---------------KSLEIEMKN-----------------KLEKLNSL 1099
            + ++E++ DEF               +S+ +++                   ++E+L   
Sbjct: 775  IAKIEKDADEFSHDKGSKLDELRREVESMSVQISEEEQRCETQYDAYQNFQLEIEQLGGD 834

Query: 1100 LIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDGIKDEQ---DADQDKPSGIP 1156
            +   K+ ++Q +  +  L      H + + D NQ       ++D+Q   + ++++  GI 
Sbjct: 835  IDSSKDTLEQAELTVKKLQTEVSEHDMNLRDLNQ------ALQDKQVELEEERNRLMGID 888

Query: 1157 DDEK-----IQEKDDADNNHHSMNIDEMSSEIS--RGIPXXXXXXXXXXXXXXXXXXXXG 1209
            D+ K     I+ K D  NN   ++I +++ E++  R                        
Sbjct: 889  DELKEIEALIKSKTDIKNNAE-LDIQKINHELNKLRSTSNSFESELAQLLDEHEWLSDES 947

Query: 1210 LTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQ----------------------- 1246
               YI E    I  L EY  R  + + R  D+ + V                        
Sbjct: 948  QVAYIIEQHASIN-LAEYRERGAQLQERFDDMKRKVNPNIMSMIESVEKKESALKTMIRT 1006

Query: 1247 -KRDEVKEQLEILKKNRF--DEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSE 1303
             ++D+VK Q  I K N +  +  +  +  ++     ++  +     A+L   +  D  +E
Sbjct: 1007 IEKDKVKIQETITKLNEYKRETLIKTWEKVTEDFGNVFADLLPNSFAKLVPCEGKD-ITE 1065

Query: 1304 GVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI 1363
            G+   V        ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   
Sbjct: 1066 GLEVKVKLGSIWKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQN 1125

Query: 1364 VANYIKERTKNAQFIVISLRNNMFELAQQLI 1394
            + + IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1126 IGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 101/451 (22%), Positives = 184/451 (40%), Gaps = 68/451 (15%)

Query: 686  NGFHGRLGDLGVID--NSFDVAISTACP--RLDDVVVDTVECAQHCIDYLRKNKLGYARF 741
            N   G    L  +D  N +       C   RL +VVVD    A   ++  R  K   A  
Sbjct: 521  NSVKGIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATI 578

Query: 742  ILLDRLRK-------FNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQ 794
            I L+++          N+     P  V    +++  ++ +   A   +   +LV +D + 
Sbjct: 579  IPLNKIAARTLNDNIVNMAKSVAPGRVELALNLIGYEE-EVRRAMEFIFGSSLVCKDAEA 637

Query: 795  ANKVAYG-KRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIK 853
            A  V +  K R R +T+DG + D  GT+SGG  +    L+                  I 
Sbjct: 638  AKMVTFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLL------------------ID 679

Query: 854  IEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQ 913
            I+         +    + V E+E +L  +  ++  ++ +IS    +  +L  EL LA+ +
Sbjct: 680  IQR--------YNNNCNLVKELETKLNDIA-KKIAIQFEISN---KTKNLQKELELAQHK 727

Query: 914  AKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIKILQDQIMKI---G 970
             K +    ++ +   T    + KN E L  E    + E + K  QIK L+ QI KI    
Sbjct: 728  LKLS----ERNLQSNTAAQLIRKN-EELESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDA 782

Query: 971  GTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQLKNFEQDEELSSNEL 1030
                H + SK+  L + ++                      +Q +++    D + S + L
Sbjct: 783  DEFSHDKGSKLDELRREVESMSVQISEEEQRCETQYDAYQNFQLEIEQLGGDIDSSKDTL 842

Query: 1031 KVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLEIEMK 1090
            +  E  +K+ +  ++E+D N          L+D  + L+++  E+EE  +    ++ E+K
Sbjct: 843  EQAELTVKKLQTEVSEHDMN----------LRDLNQALQDKQVELEEERNRLMGIDDELK 892

Query: 1091 NKLEKLNSLLIHIKN----EIKQQDKELNDL 1117
             ++E L      IKN    +I++ + ELN L
Sbjct: 893  -EIEALIKSKTDIKNNAELDIQKINHELNKL 922

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 491 LKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIK---LSLKDKTKDI 547
           + S+K ++ ++E   ++LQ + +EH+  ++DLNQ+L+++++ L++ +   + + D+ K+I
Sbjct: 835 IDSSKDTLEQAELTVKKLQTEVSEHDMNLRDLNQALQDKQVELEEERNRLMGIDDELKEI 894

Query: 548 SAKI 551
            A I
Sbjct: 895 EALI 898

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 94/182 (51%), Gaps = 11/182 (6%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + +L++D FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            DLI+K      +   SV + F+    + S      E    + +TR+     +SKY IN 
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDN--SDKSKAPIGFETSLTISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 85/149 (57%), Gaps = 3/149 (2%)

Query: 1248 RDEVKEQLEILKKNRF--DEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1305
            +D+VK Q  I K N +  D  +  +  +++    ++  +     A+L   +  D  +EG+
Sbjct: 1009 KDKVKIQDTITKLNEYKRDTLIKTWKKVTVDFGNIFADLLPNSFAKLVPSEGKD-ITEGL 1067

Query: 1306 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1365
               +   K    ++  LSGG+++L +L+L+ AL ++RP P+Y++DE+DAALD  +   + 
Sbjct: 1068 EVKIKLGKLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIG 1127

Query: 1366 NYIKERTKNAQFIVISLRNNMFELAQQLI 1394
            + IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1128 HLIKTRFKGSQFIVVSLKEGMFNNANRVF 1156

 Score = 39.7 bits (91), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 20/153 (13%)

Query: 685 INGFHGRLGDLGVIDNSFDVAIS---TACPRLDDVVVDTVECAQHCID--YLRK------ 733
           + G   RL    +   ++D A +    A  RL +VVVD    A   ++   LRK      
Sbjct: 523 VKGVAARL--FTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRKRVTIIP 580

Query: 734 -NKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDL 792
            NK+  AR I  + L   N      P  V    +++  +D + + A   +   +L+  D 
Sbjct: 581 LNKIS-ARTIDNNTL---NYAKQLAPGKVELALNLIGYED-EVAKALQFIFGSSLICNDA 635

Query: 793 KQANKVAYG-KRRFRVVTVDGKLIDISGTMSGG 824
           + A K+ +  K R R +T+DG + D  GT+SGG
Sbjct: 636 ETAKKITFNPKIRTRSITLDGDVYDPEGTLSGG 668

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 115/237 (48%), Gaps = 41/237 (17%)

Query: 1214 INETSVDIGVLEEYVRRLIE----FKRRKLDLNQAVQKRDEVKEQLE----ILKKNRFDE 1265
            +N  + DI  L    +R  E    F  ++ +L +  ++ DE K  ++     LK+ + + 
Sbjct: 977  LNSVNEDISGLSNVNKRAFENFKKFGEKRTELEERAEELDESKSSIQNLITRLKRQKVNA 1036

Query: 1266 FMNGFNIISMTLKEMYQMITMGGNAEL---------------ELVD-------------S 1297
              + FN +S    ++++ +   G A+L               E V+             S
Sbjct: 1037 VDSTFNKVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDGDENDESRSKS 1096

Query: 1298 LDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1355
            ++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1097 VEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDAA 1156

Query: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNID 1412
            LD +  + VA+ IKE ++NAQFI  + R++M E+A +    Y+     K +TV  +D
Sbjct: 1157 LDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF---YRVKYENKISTVIEVD 1210

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 86/186 (46%), Gaps = 15/186 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHFE---YIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKY 270
              LIH+      + + SV + F    + I  PSG   I   +   V  RR        Y
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSG---IPPRENDEVFVRRTVGLKKDDY 115

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N++  + ++V ++L+  G  + +   ++ QG +  +   K       D   L  LE++
Sbjct: 116 QLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEEV 168

Query: 331 IGTANY 336
           +G  ++
Sbjct: 169 VGAKSF 174

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 68/143 (47%), Gaps = 15/143 (10%)

Query: 690 GRLGDLGVIDNSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +   A       L  +VVDT E A   I  L + K G   F+ L+R+ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV- 595

Query: 749 KFNLQPISTPEN-----VPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
            ++   I+ P N      P +  +    D +F  A   V   T+V RDL    ++A   +
Sbjct: 596 -YSDPNITYPPNEQASCTPLIKKI--RYDARFEKAVKQVFGKTIVVRDLSTGARLA---K 649

Query: 804 RFRV--VTVDGKLIDISGTMSGG 824
           RFR+  +T+DG   D  G ++GG
Sbjct: 650 RFRLNAITLDGDRADKKGALTGG 672

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1300 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1357
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1358 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKST 1406
             +  + VAN +KE +KNAQFI  + R +M ++A +   + K +N+  S 
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 117/257 (45%), Gaps = 50/257 (19%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHK-SEAFPDLQACSVAVHFE------YIIDEPSGTSRIDEEKPGLVITRRAFKNN 266
              LIH+ +     + +CSV + F        +    S   R + E    V  RR     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNE----VFIRRTVGLK 116

Query: 267 SSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 326
              Y IN++  + +++ ++L+  G  + +   ++ QG++  +   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 327 LEDIIGTANY-----------------KPLIEERLSQIES-LNE-----ICLEKANRFE- 362
           LED++G  ++                 K  I++ LS++++ LNE     + LEK N+F+ 
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKIKETEFKKSTIDKELSELKNKLNEMEWEKLELEKFNKFDK 229

Query: 363 --------IVDREKNSL 371
                   + DRE N L
Sbjct: 230 NRKVLQFTLYDRELNDL 246

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 7/113 (6%)

Query: 716 VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTP--ENVPRLFDVVKP--K 771
           ++VDT E A   +  L + K G   FI L+++  +N   I+ P  +       ++K    
Sbjct: 570 IIVDTEETASLLMQELYRMKGGRVTFIPLNKI--YNDPNITYPPADQYSSFTPLIKKLKY 627

Query: 772 DPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGG 824
           + KF  A   +   T+V +DL    K+A  K +   +T+DG   D  G ++GG
Sbjct: 628 ESKFEGAMKHIFGKTIVVKDLSYGLKLA-KKFKLNAITLDGDRADKRGVLTGG 679

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 1295 VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEI 1352
             D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1353 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1390
            DAALD +  + VAN IKE + +AQFI  + R +M ++A
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 105/231 (45%), Gaps = 18/231 (7%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +++  FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYIN 273
              LIH+      + +  V + F    D+   TS I   +  +V  RR       +Y +N
Sbjct: 85  RQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 274 EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K    ++++++ +  G    +   ++ QG +  +   K K         L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLLEDVVGA 195

Query: 334 ANYKPLIEERLSQIESLN--------EICLEKANRFEIVDREKNSLESGKE 376
            +++  + E   ++E+ N        E+   KA R E +D E+  LE  +E
Sbjct: 196 RSFEIKLRESSKKMEATNRDRAKITSELSELKA-RLEELDEERQELEKYQE 245

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 64/144 (44%), Gaps = 11/144 (7%)

Query: 687 GFHGRLGDLGVIDNSF-DVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD 745
             HG LG+L  ++  +   A +     L  VVVDT E A   +  L   K G   FI L+
Sbjct: 558 AVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLN 617

Query: 746 RLRKFNLQPISTPENV-----PRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAY 800
           R+   N   ++ PEN      P L+ +    D  F  A   V   T+V RDL   +K+A 
Sbjct: 618 RISDRN--AVTFPENAQAECTPLLWKI--KYDKVFEKAVRHVFGRTIVVRDLGNGSKLAR 673

Query: 801 GKRRFRVVTVDGKLIDISGTMSGG 824
                  VT+DG   D  G ++GG
Sbjct: 674 S-YNLDAVTLDGDRADNRGVITGG 696

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 119/243 (48%), Gaps = 40/243 (16%)

Query: 1210 LTCYINETSVDIGVLEEYVRRLIE-FKR---RKLDLNQAVQKRDE----VKEQLEILKKN 1261
            L   +NE + +I  L    +R  E FKR   ++ +L+Q   + +E    +++ +E LK+ 
Sbjct: 974  LLSKLNEVNKNIAGLSNVNKRAFENFKRFNEKQRELSQRAAELEESKVSIQDLIERLKQQ 1033

Query: 1262 RFDEFMNGFNIISMTLKEMYQMITMGGNAEL---------------ELVD---------- 1296
            +     N F  +S     +++ +   G A L               E VD          
Sbjct: 1034 KISAVDNTFKKVSDNFVTVFEQLVPKGTARLIIHKNTDKGDLAVRDEDVDEDVNMDGESQ 1093

Query: 1297 SLDPFSEGVTFSV-MPPKKSWR-NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDA 1354
             L+    GV+ SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1094 DLESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1153

Query: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414
            ALD +  + VAN IK+ +KNAQFI  + R +M  +A +    Y+     K +T+  I+I 
Sbjct: 1154 ALDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF---YRVKYENKISTI--IEIN 1208

Query: 1415 KRD 1417
            K+D
Sbjct: 1209 KQD 1211

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 17/187 (9%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF----EYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F      II       R ++E    V  RR        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILSSGVIPRPNDE----VFVRRTVGLKKDD 114

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y IN++  + +++ ++L+  G  +     ++ QG +  +   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 330 IIGTANY 336
           +IG  ++
Sbjct: 168 VIGAKSF 174

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%), Gaps = 10/171 (5%)

Query: 662 SLSKAQNKNMV--LTALSKLQKSGRI--NGFHGRLGDLGVIDNSF-DVAISTACPRLDDV 716
           +L++  NKN+   ++++ ++ +  ++  +   G LG+L  +   +   A       L  V
Sbjct: 505 ALNETMNKNLANGISSIKEITEKLKLSPDAVFGTLGELLKVSEKYKTCAEVVGGNSLFHV 564

Query: 717 VVDTVECAQHCIDYLRKNKLGYARFILLDRLRK---FNLQPISTPENVPRLFDVVKPKDP 773
           VVDT + A   +  L K K G   F+ L+RL +       P         L   +K  D 
Sbjct: 565 VVDTDKTASLLMRELYKMKGGRVTFMPLNRLHEDSGVTFPPQDQSAACTPLLKKIKY-DA 623

Query: 774 KFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGG 824
           KF  A   V   T+V RDL    K+A    +   +T+DG   D  G ++GG
Sbjct: 624 KFEKAVKHVFGKTIVVRDLTTGVKMAKS-YQLNAITLDGDRADNRGVLTGG 673

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 99/193 (51%), Gaps = 20/193 (10%)

Query: 1234 FKRRKLDLNQAVQKRDE----VKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGN 1289
            F  +K++LN+   + D+    ++  +E LK+ +     + F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1290 AELEL------------VDSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALV 1335
            A+L +             +S +    G++ SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1336 FALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1395
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1396 IYKRDNRTKSTTV 1408
            + K +N+  ST V
Sbjct: 1181 V-KYENKI-STVV 1191

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 99/199 (49%), Gaps = 17/199 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I+++V+  FK+Y    V+  F  +++ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHFE---YIIDEPSG-TSRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F    + +  PSG   R ++E    +  RR        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFRDPGHRMILPSGVVPRENDE----IFIRRTVGLKKDD 114

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  + ++V ++L+  G  + +   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLED 167

Query: 330 IIGTANYKPLIEERLSQIE 348
           ++G  +++  +   L +++
Sbjct: 168 VVGAKSFESKLRASLKKMD 186

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 9/144 (6%)

Query: 686 NGFHGRLGDLGVIDNSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           +   G LG+L  +   +   A       L +VVVDT E A   ++ L   K G   F+ L
Sbjct: 533 DAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPL 592

Query: 745 DRLRKFNLQPISTPEN----VPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAY 800
           +R+   N   I+ P N       L   +K  D ++  A   +   T+V +DL + +K+A 
Sbjct: 593 NRIHVDN--NITYPPNEQASCTPLIKKIKY-DVRYEKAVKHIFGRTIVVKDLLEGSKIA- 648

Query: 801 GKRRFRVVTVDGKLIDISGTMSGG 824
            K +   VT+DG   D  G ++GG
Sbjct: 649 KKLKLNAVTLDGDRADKMGVLTGG 672

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 1299 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAAL 1356
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1390
            D +  + VAN IKE + NAQFI  + R++M  +A
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVA 1191

 Score = 72.4 bits (176), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 91/201 (45%), Gaps = 16/201 (7%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++ +  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSG---TSRIDEEKPGLVITRRAFKNNSSKY 270
              LIH+           ++ + E + D   G    +      P  V+ RR       +Y
Sbjct: 61  RQGLIHQG------SGSVMSAYVEIVFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N K  S  E+  LL+  G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 331 IGTANYKPLIEERLSQIESLN 351
            G  +++  + + L+++++ N
Sbjct: 168 TGANSFEKKLRDSLNKMDATN 188

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 73/122 (59%), Gaps = 5/122 (4%)

Query: 1293 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMD 1350
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1351 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKN 1410
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   + K +N  K +TV  
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYEN--KISTVIE 1208

Query: 1411 ID 1412
            +D
Sbjct: 1209 VD 1210

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 98/198 (49%), Gaps = 13/198 (6%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V+  FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKY 270
              LIH+      + + SV + F   E+ +  PSG   +  E    +  RR        Y
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N++  +  +V ++L+  G  + +   ++ QG++ ++   K K         L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170

Query: 331 IGTANYKPLIEERLSQIE 348
           +G  +++  ++  L ++E
Sbjct: 171 VGAKSFEVKLKASLKKME 188

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 5/142 (3%)

Query: 686 NGFHGRLGDLGVIDNSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILL 744
           +   G LG+L  ++  + +         L  +VVDT E A   +  L K K G   FI L
Sbjct: 535 DSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPL 594

Query: 745 DRLR-KFNLQ-PISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGK 802
           +R+    N+Q P +   +   L + +K  D +F  A   +   T+V +DL    +++  K
Sbjct: 595 NRIYLDANIQYPPNDQTSFTPLINKIKY-DQRFDKAVRHIFGKTIVVKDLTTGLRIS-KK 652

Query: 803 RRFRVVTVDGKLIDISGTMSGG 824
            +   +T+DG   D  G ++GG
Sbjct: 653 FKLNSITLDGDRADKRGVLTGG 674

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 109/233 (46%), Gaps = 37/233 (15%)

Query: 1214 INETSVDIGVLEEYVRRLIE----FKRRKLDLNQAVQKRDEVKEQLE----ILKKNRFDE 1265
            +N  + DI  L+   ++  E    F  +KL+L    ++ DE K  ++     LK+ +   
Sbjct: 977  LNAVNEDISGLKNVNKKAFENFKKFHEKKLELEDRSKELDESKTSIQNLIVKLKQQKVAA 1036

Query: 1266 FMNGFNIISMTLKEMYQMITMGGNAELELVDSLDP------------------------F 1301
              + F  +S    E+++ +   G A+L +  S D                          
Sbjct: 1037 VDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDDDGTQTESM 1096

Query: 1302 SEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFR 1359
              GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +
Sbjct: 1097 YTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQ 1156

Query: 1360 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNID 1412
              + VA  IK  + NAQFI  + R +M ++A +   + K +N  K +TV  +D
Sbjct: 1157 YRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYEN--KISTVVEVD 1206

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 99/199 (49%), Gaps = 17/199 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGTS-RIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F   ++ I  PSG + R ++E    V+ RR        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILPSGVAPRSNDE----VLVRRTVGLKKDD 114

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  +V ++L+  G  +++   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLED 167

Query: 330 IIGTANYKPLIEERLSQIE 348
           ++G  +++  +   L ++E
Sbjct: 168 VVGAKSFEVKLRASLKKME 186

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 70/149 (46%), Gaps = 16/149 (10%)

Query: 683 GRINGFHGRLGDLGVIDNSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARF 741
           GR+    G LG+L  ++  + +         L  +VVDT E A   I  L + + G   F
Sbjct: 533 GRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTF 589

Query: 742 ILLDRLRKFNLQPISTPENVPRLFDVVKP--KDPKFSNAFYSVLKD----TLVARDLKQA 795
           + L+R+  +N   I+ P   P       P  K  KF   F SV+K+    T+V RDL   
Sbjct: 590 MPLNRI--YNDPNITYP---PNAQSSCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAG 644

Query: 796 NKVAYGKRRFRVVTVDGKLIDISGTMSGG 824
           +K+A    +   +T+DG   D SG ++GG
Sbjct: 645 SKIA-KHYKLDAITLDGDRADKSGLLTGG 672

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 1298 LDPFSEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAA 1355
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNID 1412
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K +N  K +TV  ID
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYEN--KISTVIEID 1212

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 90/187 (48%), Gaps = 16/187 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHFE---YIIDEPSG-TSRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F    + I  PSG   R ++E    V  RR        
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVFHDPNHKIILPSGVVPRENDE----VYIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  +V ++L+  G  +++   ++ QG++  +   K K         L  LED
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLED 168

Query: 330 IIGTANY 336
           ++G  ++
Sbjct: 169 VVGAKSF 175

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 2/100 (2%)

Query: 1299 DPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAAL 1356
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            D +  + VA  IKE +KNAQFI  + R +M ++A +   +
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV 1199

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 100/199 (50%), Gaps = 16/199 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGT-SRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F   ++ +  PSG  SR D+E    V  RR        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERLSQIE 348
           ++G  +++  ++  L ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 690 GRLGDLGVIDNSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +           L  VVVDT E A   ++ L + K G   FI L+RL 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597

Query: 749 -----KFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
                KF     +  +  P L   +K + P+F  A   V   T+V +DL Q  K+A  K 
Sbjct: 598 LDSDVKFPSNTTTQIQFTP-LIKKIKYQ-PRFEKAVKHVFGRTIVVKDLGQGLKLA-KKH 654

Query: 804 RFRVVTVDGKLIDISGTMSGG 824
           +   +T+DG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGVLTGG 675

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 81/152 (53%), Gaps = 5/152 (3%)

Query: 1258 LKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS-- 1315
            LK+ + +     FN +S    ++++ +   G  EL +      +S GV+  V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1316 WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1375
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1376 -QFIVISLRNNMFELAQQLIGIYKRDNRTKST 1406
             QFI+ + R++M E+A  +I + K  N+  S 
Sbjct: 1074 TQFILTTFRSDMIEIA-DMIYMVKYHNKVSSV 1104

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 5/141 (3%)

Query: 687 GFHGRLGDLGVIDNSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLD 745
             +G LG+L  +   +   +   A   L +++VDT E A   ++ L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 746 RLRK-FNLQ-PISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
           R+    N+  P +   N   L   +K  D KF     +V   T+V +DL+  N++   + 
Sbjct: 520 RIENGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC-KEF 577

Query: 804 RFRVVTVDGKLIDISGTMSGG 824
           + + +T+DG  ID  G +SGG
Sbjct: 578 KLQAITLDGDRIDSKGVVSGG 598

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            + VA  +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 100/199 (50%), Gaps = 16/199 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGT-SRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F   ++ +  PSG  SR D+E    V  RR        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERLSQIE 348
           ++G  +++  ++  L ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 83/337 (24%), Positives = 140/337 (41%), Gaps = 37/337 (10%)

Query: 505 FQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPW-DL 563
           +QEL +++  ++ ++  L Q  ++  +IL   + + + K+KD          E + W   
Sbjct: 359 YQELTKEEAMYKLQLASLQQ--KQRDLILKKGEYA-RFKSKD----------ERDTWIHS 405

Query: 564 QLQEKKSQIQXXXXXXXXXXXTRXXXXXXXXXXXXXI------ISKKQRKQELQGL---V 614
           +++E KS IQ            R             I      I+    K +L+     +
Sbjct: 406 EIEELKSSIQNLNELESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSEL 465

Query: 615 LDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLT 674
           + L Q+L   +D R +  R  +     L+ +   +N + QR +    S S A     V  
Sbjct: 466 IHLKQKLSESLDTRKELWRKEQKLQTVLETLLSDVNQN-QRNVNETMSRSLANGIINVKE 524

Query: 675 ALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRK 733
              KL+ S       G LG+L  +++ +           L  +VVDT E A   ++ L +
Sbjct: 525 ITEKLKISPE--SVFGTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYR 582

Query: 734 NKLGYARFILLDRLR-----KFNLQPISTPENVPRLFDVVKPK-DPKFSNAFYSVLKDTL 787
            K G   FI L+RL      KF   P +T   +     + K K +P+F  A   V   T+
Sbjct: 583 MKGGRVTFIPLNRLSLDSDVKF---PSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTI 639

Query: 788 VARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGG 824
           V +DL Q  K+A  K +   +T+DG   D  G ++GG
Sbjct: 640 VVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGG 675

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVMPPKK--SWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361
            GV+ SV    K     ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            + VA+ IK  + NAQFI  + R +M ++A +   +
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV 1186

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 94/200 (47%), Gaps = 19/200 (9%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I K+++  FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF-----EYIIDEPSGTSRIDEEKPGLVITRRAFKNNSS 268
              LIH+      + + SV + F       I+  PSG +         V  RR       
Sbjct: 61  RQGLIHQGSG--SVMSASVEIQFYDPGNSMIL--PSGVAV---NPDSTVSIRRTVGLKKD 113

Query: 269 KYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLE 328
            Y IN++  + +++ ++++  G  + +   ++ QG +  +   K K         L+ LE
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILE 166

Query: 329 DIIGTANYKPLIEERLSQIE 348
           D++G  +++  +   L ++E
Sbjct: 167 DVVGAKSFEAKLTASLKKME 186

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 95/216 (43%), Gaps = 39/216 (18%)

Query: 619 QRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSK 678
           QRL+++++  S+G          +K  +RILN    R++        A     V   + K
Sbjct: 486 QRLQTILENMSEG----------VKRSERILNETMHRSV--------ANGIKNVKEIVDK 527

Query: 679 LQKSGRINGFHGRLGDLGVIDNSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLG 737
           L      +   G LG+L  +   +   A       L ++VVDT E A   +D L + K G
Sbjct: 528 LNLPD--DAVLGTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGG 585

Query: 738 YARFILLDRLR---KFNLQPISTPENVPRL----FDVVKPKDPKFSNAFYSVLKDTLVAR 790
              F+ L+R+R    F   P       P +    FDV      ++  A   V   T+V +
Sbjct: 586 RVTFMPLNRIRMDSNFTYPPNDQASCTPLIKKIKFDV------RYEKAVMHVFGKTIVVK 639

Query: 791 DLKQANKVAYGKRRFRV--VTVDGKLIDISGTMSGG 824
           DL + +K+A   +RF++  +T+DG   D  G ++GG
Sbjct: 640 DLGEGSKLA---KRFKMNAITLDGDRADKRGELTGG 672

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 104/220 (47%), Gaps = 37/220 (16%)

Query: 1214 INETSVDIGVLEEYVRRLIE----FKRRKLDLNQAVQKRDEVKEQLE----ILKKNRFDE 1265
            +N+ + +I  L+   +R  E    F  ++ DL+    + DE K+ ++     LK+ +   
Sbjct: 981  LNDMNTEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSA 1040

Query: 1266 FMNGFNIISMTLKEMYQMITMGGNAELEL----VDSLDPFSE------------------ 1303
              + F  +S   K +++ +   G A+L +     DS+D  ++                  
Sbjct: 1041 VDSTFQKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEG 1100

Query: 1304 -----GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAAL 1356
                 GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1101 ETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1160

Query: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            D +  + VA  IKE + NAQFI  + R +M ++A +   +
Sbjct: 1161 DKQYRTAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 100/199 (50%), Gaps = 16/199 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGT-SRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F   ++ +  PSG  SR D+E    V  RR        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERLSQIE 348
           ++G  +++  ++  L ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 690 GRLGDLGVIDNSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +           L  +VVDT E A   ++ L + K G   FI L++L 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKLS 597

Query: 749 -----KFNLQPISTPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
                KF     +  +  P L   +K + P+F  A   V   T+V +DL Q  K+A  K 
Sbjct: 598 LDADVKFPSNSTTQIQFTP-LIKKIKYQ-PRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 804 RFRVVTVDGKLIDISGTMSGG 824
           +   +T+DG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGVLTGG 675

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 63/115 (54%), Gaps = 5/115 (4%)

Query: 1296 DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEID 1353
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1354 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            AALD +  + VA  IKE +  AQFI  + R++M  +A +    Y+     K +TV
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKF---YRVKYENKISTV 1204

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 92/196 (46%), Gaps = 12/196 (6%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I K+++  FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYIN 273
              LI++  +        +  H     D  + T     +  G +  RR       +Y IN
Sbjct: 61  RRSLIYQGTSSVMSGYVEIVFH-----DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 274 EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K SS ++V +LL+  G    +   ++ QG + ++   K       D   L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVGA 168

Query: 334 ANYKPLIEERLSQIES 349
            +++  ++E L ++++
Sbjct: 169 KSFERKLKESLQRMDA 184

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 690 GRLGDLGVIDNSF-DVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +   +   A       L  VVVDT   A   +  L  +K G   F+ L+R+ 
Sbjct: 534 GPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRIY 593

Query: 749 -KFNLQPISTPE-NVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFR 806
              N+Q  S  E N   L   +K  D KF  A   V   T+V +DL Q +K+A   ++F 
Sbjct: 594 VDPNIQYPSNEEYNCTPLIKKIKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQFN 649

Query: 807 V--VTVDGKLIDISGTMSGG 824
           +  VT+DG   D  G ++GG
Sbjct: 650 LNSVTLDGDKADNKGVLTGG 669

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 62/109 (56%), Gaps = 4/109 (3%)

Query: 1300 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1357
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1358 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKST 1406
             +    VA  I + + NAQFI  + R++M + A +   + K +N+  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 97/198 (48%), Gaps = 13/198 (6%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y    ++G F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKY 270
              LIH+  A   + + SV + F   E+ I  P+G +         V  RR        Y
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGIN--SNGSSDEVRIRRTVGLKKDDY 117

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N++  +  ++ ++L+  G  + +   ++ QG + ++   K K         L+ LE++
Sbjct: 118 QVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEV 170

Query: 331 IGTANYKPLIEERLSQIE 348
           +G  +++  ++  + Q++
Sbjct: 171 VGAKSFEVKLKASMKQMD 188

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 67/140 (47%), Gaps = 8/140 (5%)

Query: 690 GRLGDLGVIDNSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  ++  + V         L  VVVDT E A   ++ L + K G   F+ L++L+
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 749 KFNLQPISTPE--NVPRLFDVVKPK-DPKFSNAFYSVLKDTLVARDLKQANKVAYGKR-R 804
             N Q I  P   N+P    + K K D +F      V    LV +DL   N ++  K+ +
Sbjct: 599 NGN-QNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYK 655

Query: 805 FRVVTVDGKLIDISGTMSGG 824
              +T+DG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 5/114 (4%)

Query: 1297 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDA 1354
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTV 1408
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +    Y+ +   K +TV
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRF---YRVNFENKISTV 1209

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 95/196 (48%), Gaps = 13/196 (6%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I K+++  FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYIN 273
              LI++        +  ++ + E +       + +  +  G++  RR       +Y IN
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 274 EKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K +S ++V +LL+  G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 334 ANYKPLIEERLSQIES 349
            +++  ++E L ++E+
Sbjct: 168 KSFERKLKESLQKMET 183

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 9/189 (4%)

Query: 643 KEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRIN----GFHGRLGDLGVI 698
           +++Q +L +       A  +LS+  ++++     +  + + R+N       G LG+L  I
Sbjct: 482 QKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGPLGELIKI 541

Query: 699 DNSFD-VAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFN--LQPI 755
              +   A       L  VVVDT   A   +  L  +K G   FI L+R+   +  + P 
Sbjct: 542 SEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYPS 601

Query: 756 STPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLI 815
           +   +   L   +K  DPKF  A   V   T+V +DL Q  K+A  + R   +T+DG   
Sbjct: 602 NDEHHCTPLIKKIKY-DPKFERAIKHVFGKTIVVKDLNQGTKLA-KQFRLNAITLDGDKA 659

Query: 816 DISGTMSGG 824
           D  G ++GG
Sbjct: 660 DSRGVLTGG 668

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNV 1361
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1396
            + VA  IKE + +AQFI  + R +M ++A +   +
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV 1200

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 99/199 (49%), Gaps = 16/199 (8%)

Query: 154 LFINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++V+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPDLQACSVAVHF---EYIIDEPSGT-SRIDEEKPGLVITRRAFKNNSSK 269
              LIH+      + + SV + F   ++ +  PSG  SR D+E    V  RR        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N++  +  ++ ++L+  G  + +   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEERLSQIE 348
           ++G  +++  ++  L ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 96/218 (44%), Gaps = 14/218 (6%)

Query: 614 VLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVL 673
           +++L QRL   +D R +  R  +     L+ +   +N + QR +    S S A     V 
Sbjct: 465 LINLKQRLNESLDTRKELWRKEQKLQTILETLLSDVNQN-QRNVNETMSRSLANGIINVK 523

Query: 674 TALSKLQKSGRINGFHGRLGDLGVIDNSFD-VAISTACPRLDDVVVDTVECAQHCIDYLR 732
               KL+ S       G LG+L  +++ +   A       L  +VVDT E A   ++ L 
Sbjct: 524 EITEKLKISPE--SVFGTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELY 581

Query: 733 KNKLGYARFILLDRLRKFNLQPISTPENVPR------LFDVVKPKDPKFSNAFYSVLKDT 786
           + K G   FI L+RL  F    +  P N         L   +K + P+F  A   V   T
Sbjct: 582 RMKGGRVTFIPLNRL--FLDSDVKFPSNTTTQIQFTPLIKKIKYQ-PRFEKAVKHVFGKT 638

Query: 787 LVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGG 824
           +V ++L Q  K+A  K +   +T+DG   D  G ++GG
Sbjct: 639 IVVKELGQGLKLA-KKHKLNAITLDGDRADKRGLLTGG 675

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 68.9 bits (167), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1319 ITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1378
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1379 VISLRNNMFELAQQLIGIYKRDNRTKSTT 1407
              + R +M  +A     + K +N+  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 20/198 (10%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 215
           I  +++  FK+Y  R VV  F    + VVG NGSGKSN   ++ FV     + ++++   
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 216 DLIHKSEAFPDLQACSVAVHFEYIIDEPS----GTSRIDEEKPGLVITRRAFKNNSSKYY 271
             I++       Q  S  V  E I D+P        R D    G V  RR       +Y 
Sbjct: 64  GFIYQGAG----QVMSAFV--EIIFDDPENLMLAPLRND---TGEVRIRRTVGLKKDEYM 114

Query: 272 INEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 331
           IN+K S+  +V ++L+  G    +   ++ QG + ++   K       D   L  LED++
Sbjct: 115 INDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVV 167

Query: 332 GTANYKPLIEERLSQIES 349
           G  +++  ++E L ++E+
Sbjct: 168 GAKSFENKLKESLKKMEA 185

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 109/265 (41%), Gaps = 36/265 (13%)

Query: 690 GRLGDLGVIDNSFDVAISTACPR-LDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  + + + +         L +VVVD  E A   I  L   K G   FI L++L 
Sbjct: 534 GPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH 593

Query: 749 KFNLQPISTPENVPR-----LFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKR 803
                  + P N+ +     L   +K  D KF      V   TLV + L     +A  + 
Sbjct: 594 VDT--NFTYPNNLEKNQCTPLIKKIKY-DVKFEKVIKQVFGRTLVVKSLIDGASLA-KEY 649

Query: 804 RFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQSDEIEDY--TPEEVIKIEHELAER 861
           +   +T+DG   D  G +SGG       L +  +N+ D + D+  +  E  KI+ EL   
Sbjct: 650 KLNAITLDGDRADSKGVLSGG------YLDQYKSNRLDTLRDFKQSKREYKKIQVEL--- 700

Query: 862 EKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAK---EAK 918
                       E+++ L+ +  +   L + +  A  E D+  + +  A  Q K     K
Sbjct: 701 -----------QEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQK 749

Query: 919 MAYDKAVNE-KTQVNEVMKNLEHLR 942
           +  D ++   K ++N++   LE  R
Sbjct: 750 ITIDDSIKALKARLNKIDTELEQCR 774

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (46%), Gaps = 17/181 (9%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L+NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNS-SKYYI 272
           + D I   E   D  +  + +     ++   G   +D E   + ITR   K+ S S+Y I
Sbjct: 93  VEDFIKNGE---DRGSIEITLKNSPKVE---GMPGVDSEADTIKITRELIKSKSKSRYMI 146

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK-----PKAEKESDDGLLEYL 327
           N++  S  +V  L+ K  I LD+    + Q  VE  A++K      +  +  D  LL+ L
Sbjct: 147 NDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVL 206

Query: 328 E 328
           E
Sbjct: 207 E 207

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1378 IVIS 1381
             +I+
Sbjct: 1039 FLIT 1042

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 77/159 (48%), Gaps = 16/159 (10%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLS 215
           + +L L NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + +    
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGR---- 110

Query: 216 DLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEK 275
             + +S++F    A S  +      ++P  T ++       V+TR   K  +S YY++  
Sbjct: 111 --MKRSDSFIKNGADSARIDVWLAGEDPGTTLKVSR-----VLTRNHKK--ASLYYVDGV 161

Query: 276 ESSYTEVTKLLK-KEGIDLDHKRFLILQGEVENIAQMKP 313
           E+S   V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 162 ETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 72/171 (42%), Gaps = 42/171 (24%)

Query: 1214 INETSVDIGVLEEYVRRLIEFKRR------KLDLNQAVQK--RDEVKEQLEILKKNRFDE 1265
            IN     I +L+E  R+L + K R      KLD   A     + E++ +L+ + +   + 
Sbjct: 896  INHDESSIAILQEVERKLADVKARLPAMVRKLDAATASMSTMQAELEPRLDTIVEKISER 955

Query: 1266 FMNGF------NIISMTLKEMYQ------MITMGGNAELELVDSLDPFSEGVTFSVMPPK 1313
            F N F        I ++   +YQ      M+    NA L+ +DS                
Sbjct: 956  FTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS---------------- 999

Query: 1314 KSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIV 1364
                     SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 ------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 80/179 (44%), Gaps = 20/179 (11%)

Query: 156 INKLVLDNFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I K+ L NF +YA    +  FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 213 RLSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKN-NSSKYY 271
           R+ D I   E       C + +  +    +  G + +      + ITR   ++   S Y+
Sbjct: 104 RVEDFIKNGE-----DECEIEITLKNN-SKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 272 INEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
           IN++ +S   V  ++ +  I LD+    + Q  VE  A++K      SD  L E +  I
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK------SDKLLFETIRSI 210

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 20/144 (13%)

Query: 1248 RDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDP--FSEGV 1305
            RD VKE+ ++L+  R DE +     +S     ++  +   G   LE      P  FSE  
Sbjct: 922  RDSVKEKRDVLEP-RLDEVVQR---VSQRFARLFVGVGSAGAVNLE-----KPTLFSEW- 971

Query: 1306 TFSVMPPKKSWRNITNL-----SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN 1360
               +M   +    +  L     SGGE+ +S++  + AL ++   P  V+DEI+  +D RN
Sbjct: 972  KLEIMVKFRDNATLKRLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRN 1031

Query: 1361 VSIVANYIKERT---KNAQFIVIS 1381
              IV   + E       +Q+ +I+
Sbjct: 1032 ERIVHKAMVENACAENTSQYFLIT 1055

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1300 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFR 1359
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1360 NVSIVANYIKERTKN---AQFIVIS 1381
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I  L L+NF +YA    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 213 RLSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKN-NSSKYY 271
           ++ D I   E   D     V +       +P    R         +TR   +N  +S+Y+
Sbjct: 103 KIEDYIKNGE---DRSVIEVTLK-----RDPEAEDRYVASDGTTKVTRVLHRNRKASEYF 154

Query: 272 INEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK 312
           +N +  + + V +L+ +  I LD+    + Q  VE  A++K
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1380 IS 1381
            ++
Sbjct: 1049 VT 1050

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 88/203 (43%), Gaps = 26/203 (12%)

Query: 156 INKLVLDNFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I KL L+NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 213 RLSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYI 272
           R+   I   E    ++          +  +P  T           ++R  +    S+YY+
Sbjct: 125 RVDSFIKNGENRGLIEVT--------LKRDPGRTGSFVAVDGTTKVSRVLWVGKKSEYYL 176

Query: 273 NEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII- 331
           N++  S   V  L+ +  I LD+    + Q  VE  A++K      SD  L+E +  +  
Sbjct: 177 NDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKLLMETVRSVNV 230

Query: 332 ----GTANYKPLIEERLSQIESL 350
                  N K L EE++++ + L
Sbjct: 231 NLLESFKNLKTLQEEQITEAKEL 253

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1380 IS 1381
            ++
Sbjct: 1072 VT 1073

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 33/187 (17%)

Query: 1214 INETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNII 1273
            + +T+ DI +LE+ +  L    R KL  N   Q   E++  LE     R D+ +     I
Sbjct: 917  LKKTNEDISILEKTLPHL----RAKLASN--AQTILEIRNSLE----PRLDDIVKQ---I 963

Query: 1274 SMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SGG 1325
            S     ++  +   G  EL+  DS + +        +  K  +R+ + L        SGG
Sbjct: 964  SKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSGG 1016

Query: 1326 EKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI-----VANYIKERTKNAQFIVI 1380
            E+ +S++  + AL ++  +P  V+DEI+  +D  N  I     V N   E T     I  
Sbjct: 1017 ERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLITP 1076

Query: 1381 SLRNNMF 1387
             L  N+F
Sbjct: 1077 KLLTNLF 1083

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 86/186 (46%), Gaps = 25/186 (13%)

Query: 158 KLVLDNFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           KL L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++
Sbjct: 62  KLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 215 SDLIHKS--EAFPD--LQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITR-RAFKNNSSK 269
            + I     E   +  L+  S  +H ++        + I+ +   + + R  + +   SK
Sbjct: 118 EEYIKNGTDEGVIEITLKNSSALLHSDF--------NMINTDDDVVHVKRVLSMEKKKSK 169

Query: 270 YYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLL 324
           YYIN K  +   V  +++   I LD+    + Q  VE  A++KP     +  +  + GLL
Sbjct: 170 YYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAGLL 229

Query: 325 EYLEDI 330
           E L ++
Sbjct: 230 EKLSEL 235

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1307 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVAN 1366
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1367 YIKERTKN---AQFIVIS 1381
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 155 FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 212
           +I K+VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 213 RLSDLI 218
            L DLI
Sbjct: 131 SLKDLI 136

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 83/189 (43%), Gaps = 39/189 (20%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I KL L N  +Y+  +  + P   S + +VGPNGSGKS  + ++      +   + R  +
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPG------LVITRRAFKNNS 267
           + + I   E                       T++ID    G      + ITR   +N  
Sbjct: 94  IDNFIKNGE----------------------NTAQIDTFLRGHMPNEVIKITRIMTRNKK 131

Query: 268 -SKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDD 321
            S+YYI++  S+ T V KL  +  I LD+    + Q  VE+ A++K      +  +  + 
Sbjct: 132 KSEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINP 191

Query: 322 GLLEYLEDI 330
            LLE LED+
Sbjct: 192 SLLETLEDL 200

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1380 IS 1381
            I+
Sbjct: 1035 IT 1036

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 1251 VKEQLEILKKN---RFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
             K Q+ +L+ N   + D  + G   IS    +++  +   G  +LE  ++   +   +  
Sbjct: 922  TKSQIAVLRDNTEPKIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNFSNWQVKILV 978

Query: 1308 SVMPPKKSWRNITNLS--GGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1365
                  +S R +T+ S  GGEK +S+   + +L  +   P  V+DEI+  +D RN  I+ 
Sbjct: 979  K-FRDNESVRELTSQSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIH 1037

Query: 1366 NYIKERT---KNAQFIVIS 1381
              + E       +Q+I+++
Sbjct: 1038 RIMVENACEDNTSQYILVT 1056

 Score = 37.4 bits (85), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 18/74 (24%)

Query: 125 LQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSFSAVV 184
           ++LSP++         YD +++         I K+ + NF +Y    V      SF+ ++
Sbjct: 36  IKLSPIQ---------YDDYQAGS-------IIKIKMKNFMTYG--LVEYQLCPSFNMII 77

Query: 185 GPNGSGKSNVIDSM 198
           GPNGSGKS V+ ++
Sbjct: 78  GPNGSGKSTVVCAL 91

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 99/233 (42%), Gaps = 31/233 (13%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           I K+ L NF +Y  R        S + ++GPNGSGKS  + ++      +   + R  R+
Sbjct: 38  IVKIKLQNFVTY--RLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRID-----EEKPGLVITR---RAFKNN 266
            D I   E         + +  +   D     S ++       K  L +TR   R     
Sbjct: 96  DDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKC 150

Query: 267 SSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDD 321
            S Y+IN+K  +   +  L+K   I LD+    + Q  VE  A++K      +  +  D 
Sbjct: 151 KSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSIDA 210

Query: 322 GLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANRFEIVDREKNSLESG 374
            LL+ L+D+  + N +  +E         NE+ + K  RF  ++ ++N LE+ 
Sbjct: 211 QLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEAS 253

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1380 IS 1381
            I+
Sbjct: 1050 IT 1051

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 155 FINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I K+ L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   R + 
Sbjct: 84  YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 214 LSDLI 218
           L DLI
Sbjct: 142 LKDLI 146

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1369 KERTK---NAQFIVIS 1381
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 39.3 bits (90), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 155 FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I KL L NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 213 RLSDLI 218
            L DLI
Sbjct: 136 SLKDLI 141

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1290 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNITNLSGGEKTLSSLALVFA 1337
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1338 LHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1381
              K   + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 155 FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I K++L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A+   R +
Sbjct: 75  YIKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGN 131

Query: 213 RLSDLI 218
            + DLI
Sbjct: 132 AMKDLI 137

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1380 IS 1381
            I+
Sbjct: 1074 IT 1075

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 96/233 (41%), Gaps = 43/233 (18%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L+NF +Y   +  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYI----------------------IDEPSGTSRIDE 251
           + D I   E         + +  + +                      +D   G  ++D 
Sbjct: 109 VDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCG--QLDL 161

Query: 252 EKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQM 311
            K   +I R   K   S YYIN+K  S   V  L+K   I LD+    + Q  VE  A++
Sbjct: 162 IKFTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARL 218

Query: 312 KP-----KAEKESDDGLLEYLEDIIGTANYKPLIEERLS-QIESLNEICLEKA 358
           K      +  +  D  LL+ LE++    N +  +E+ L  + +   E+C E+ 
Sbjct: 219 KSDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDELEIKQKRYTELCNERT 271

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 72/162 (44%), Gaps = 16/162 (9%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFPDLQAC---SVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKY 270
           + D I   +    ++     S  VH    I+    T +I       +ITR   +   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK 312
            IN+ + S   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 155 FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I K+VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A +  R +
Sbjct: 81  YIKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGAKAAETNRGN 137

Query: 213 RLSDLI 218
            L DLI
Sbjct: 138 SLKDLI 143

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 75/165 (45%), Gaps = 22/165 (13%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFPDLQAC---SVAVH-FEYI--IDEPSGTSRIDEEKPGLVITRRAFKNNS 267
           + D I   +    ++     S  +H  E+I   DE    +RI        ITR   +   
Sbjct: 99  VEDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTRI--------ITRSKRR--- 147

Query: 268 SKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK 312
           S Y IN+++ S   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 148 SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

 Score = 39.7 bits (91), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 8/136 (5%)

Query: 179 SFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLIHKSEAFPDLQACSVAVHFE 237
           S + ++GPNGSGKS  + ++      +   + R  R+ D I   +   D+    + +   
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFIKNGQ---DVSRIEITLKNS 119

Query: 238 YIIDEPSGTSRIDEE-KPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHK 296
             +++    +  DE  K   +ITR   +   S Y IN+ E S + V  L+ +  I LD+ 
Sbjct: 120 PKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEVSESVVKALVAQLNIQLDNL 176

Query: 297 RFLILQGEVENIAQMK 312
              + Q  VE  A++K
Sbjct: 177 CQFLSQERVEEFARLK 192

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 16/162 (9%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTS--RIDEEKPGLVITRRAFKNN-SSKY 270
           + D I   +   D+    + +      + P+ T    ID     + ITR   ++   S Y
Sbjct: 99  VEDFIKNGQ---DVSKIEITLK-----NSPNVTDIEYIDARDETIKITRIITRSKRRSDY 150

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK 312
            IN+ + S + V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 151 LINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (49%), Gaps = 21/131 (16%)

Query: 1262 RFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1321
            R DE +     IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  
Sbjct: 933  RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAE 982

Query: 1322 L--------SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKER-- 1371
            L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E   
Sbjct: 983  LKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENAC 1042

Query: 1372 TKN-AQFIVIS 1381
             KN +Q+ +I+
Sbjct: 1043 AKNTSQYFLIT 1053

 Score = 36.6 bits (83), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 70/164 (42%), Gaps = 20/164 (12%)

Query: 156 INKLVLDNFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I KL L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R  
Sbjct: 46  IIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAK 101

Query: 213 RLSDLIHKS--EAFPDLQA-CSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFK-NNSS 268
           ++ D I     E+  +L    S AV         SG S I      + I     K     
Sbjct: 102 KVEDFIKNGTEESVIELTVKNSKAV---------SGYSMIGGSDEVINIKTVIMKAKKKC 152

Query: 269 KYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK 312
            YYIN +     +V  L+    I LD+    + Q  VE  A++K
Sbjct: 153 IYYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1380 IS 1381
            I+
Sbjct: 1072 IT 1073

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 74/162 (45%), Gaps = 16/162 (9%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR- 213
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R 
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 214 LSDLIHKSEAFPDLQAC---SVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKY 270
           + D I   E   +++     S A+H    + E S T  I       ++TR   K   S+Y
Sbjct: 123 VDDYIKNDEEHGEIEITLKNSEAIHDVEGVLEGSDTITITR-----ILTRSKKK---SEY 174

Query: 271 YINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMK 312
            IN+   +   V +L+    I LD+    + Q  VE  A++K
Sbjct: 175 KINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1378 IVIS 1381
             +I+
Sbjct: 1056 FLIT 1059

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 158 KLVLDNFKSYAGRQVVGPF--HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           KL ++NF +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 48  KLRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKL 103

Query: 215 SDLIHKSE 222
            D I   E
Sbjct: 104 EDFIKNGE 111

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI-----VANYIKERTKNAQF 1377
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I     V N   E T     
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1378 IVISLRNNM 1386
            I   L  N+
Sbjct: 1044 ITPKLLTNL 1052

 Score = 33.1 bits (74), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 177/438 (40%), Gaps = 59/438 (13%)

Query: 156 INKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           I K+ L NF +Y+  +       S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 44  IIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKL 101

Query: 215 SDLIHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINE 274
            D I   E         V V  + + +    T  I      L+ T         +Y IN 
Sbjct: 102 EDYIKNGE-----DQSVVEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAING 150

Query: 275 KESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
              + T +   +KK  I LD+    + Q  VE  A++K        D LLE     I ++
Sbjct: 151 STVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK-------SDKLLEETIRSIDSS 203

Query: 335 NYKPLIEERLSQIESLNEICLEKANRFEIVDREKNSLESGKETAXXXXXXXXXXXXXXXX 394
               L  E+L  +++  EI L+K    ++ +++   L + +E                  
Sbjct: 204 MLTSL--EKLKTLQT-TEISLQKD--VDLKNKKLQELTAQREKLEGAVKALKEYEHLKKE 258

Query: 395 XXXXXMLQSNSKLASTLEKISSLNRXXXXXXXXXXXXLREVDE-VKAQHKDIKDRISSST 453
                +L    K+     K+ S  R             RE  + +K+  +D K  I +  
Sbjct: 259 IEIHQLLLPYVKIKDHKSKVQSYIRD-----------FREAKQKLKSFLQDKKPFIKAKN 307

Query: 454 SREKT---LSLEKRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQR 510
           S EK        K++   S ++  ++  +++N +GK ++ +   K  I   E+  ++LQ 
Sbjct: 308 SLEKKQAKYQALKQDTNSSLINERKKLNSILNDLGKGKEEIIKRKKQIEYYENRTKKLQE 367

Query: 511 QQTEHEKEIKDLNQSLEEERI----ILDDI---KLSLKDKTKDISAKI---------IRH 554
                EKE +D   SLE  ++     LD+I   + +L +K  +I+ KI         I H
Sbjct: 368 SIRSTEKEKEDKIASLETLQLPDQQTLDEITNERNTLIEKESNITTKIRSIDSRVATINH 427

Query: 555 EKESEPWDLQLQEKKSQI 572
           E  +   D Q QE+K ++
Sbjct: 428 EMMT--LDRQQQERKKKL 443

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1371
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1372 TKNAQFIVISLRN--NMFELAQQLIGIYKRDNRTKSTTVKNI 1411
              + Q I+I+ ++   M  +  +   I+K  N  +   V ++
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKNPERHNNVNSL 1098

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 40.0 bits (92), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 73/179 (40%), Gaps = 19/179 (10%)

Query: 161 LDNFKSYAGRQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDL 217
           L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + R  R+ D 
Sbjct: 51  LTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDF 106

Query: 218 IHKSEAFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFK-NNSSKYYINEKE 276
           I    A       ++ +      +  SG   I  E   + +     K      YYIN + 
Sbjct: 107 IKNGTA-----ESTIEIQLRNSRN-VSGLPMISAEDEAINVRTVLMKARRKCAYYINGEP 160

Query: 277 SSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLLEYLEDI 330
            S  ++  L+    I LD+    + Q  VE  A++K      +  +  D  LL  LE +
Sbjct: 161 VSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGLLEQL 219

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1378 IVISLRNNM 1386
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 39.3 bits (90), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 1320 TNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379
            T LSGG+K   +LA  F L    PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLLE---PT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1380 ISL 1382
            IS+
Sbjct: 655  ISI 657

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 19/98 (19%)

Query: 144 HKSSGKQQGRL------FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVID 196
           + SSG   G +      +I ++ L NF  +   ++  GP     + +VG NGSGKS ++ 
Sbjct: 44  YSSSGNINGDVQEPPAGYIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILT 100

Query: 197 SMLFVFGFRANKM-RQDRLSDLIHKSEAFPDLQACSVA 233
           ++  VFG +A+   R   L  LI         + C++A
Sbjct: 101 AITIVFGAKASDTNRGTSLKSLIR--------EGCNIA 130

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 8/84 (9%)

Query: 155 FINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I K++L NF  +    V    + +F  +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 214 LSDLIHKSEAFPDLQACSVAVHFE 237
           L +LI K        +  V +H +
Sbjct: 130 LKELIRKG-----CNSSKVTLHLD 148

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI 1363
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 125/261 (47%), Gaps = 44/261 (16%)

Query: 862  EKNFRVANDTVHEMEEEL----KKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEA 917
            E+   V+   + E++ +L    K VR+ + D  +     +++ +SL S L  +E+QAKE 
Sbjct: 1302 EEQISVSEKQIEEVKSQLQASEKTVRNLKSDSIASQQTNDIKVESLKSALASSEKQAKEV 1361

Query: 918  KMAYDKAVNEKTQVNEVMKNLEHLRGEYEDL----QSETRTKKEQIKILQD-----QIMK 968
               YDK    KT  +E   N   L+G+ E L    +SETR K+   K L       Q   
Sbjct: 1362 TQKYDKL---KTSSDE---NASSLKGQIERLTEAVKSETRAKEINAKDLNQLKEKLQCFV 1415

Query: 969  IGGTKLHTQNSKVGSLCQRIDIXXXXXXXXXXXXXXXXXDVLKYQKQ--LKNFEQDEELS 1026
                KL T   +   L QR+                     LK +K+  +KN E   E  
Sbjct: 1416 ETMNKLETLEKENAVLDQRV-------------------KKLKNEKEETVKNLEVKLETL 1456

Query: 1027 SNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENIDEFKSLE 1086
            S+E + ++EKL+   ++L +N++   E ++LK ++    E L+E     +++++E KS+ 
Sbjct: 1457 SSEKQSLKEKLQGQSISLNDNESLREENNSLKKKI----ESLEELTDACDKSLEESKSMI 1512

Query: 1087 IEMKNKLEKLNSLLIHIKNEI 1107
            ++ +  ++ LNS+   +K+E+
Sbjct: 1513 VQHEEGIKSLNSINSTLKSEL 1533

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 98/216 (45%), Gaps = 28/216 (12%)

Query: 156 INKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I K+ L+NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 214 LSDLIHKSEAFPDLQACSVAVHFEYIID-EPSGTS----RIDEEKPGLV----------- 257
           + D I   +   D     + +  +  ID E  G+S    R +    GL+           
Sbjct: 95  VEDFIKNGQ---DTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTK 151

Query: 258 ITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEK 317
           I R   K  + +Y IN   ++ + V  L+ K  I LD+    + Q  VE  A+++P  EK
Sbjct: 152 IGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP--EK 209

Query: 318 ESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEI 353
             D+ +     +++    ++ L + +L +IE  NEI
Sbjct: 210 LLDETIRAIDSELLSM--FEVLKKLQLQEIEMSNEI 243

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 7/64 (10%)

Query: 1323 SGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD--FRNV---SIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL K+   P  V+DEI+  +D  F  +   ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1378 IVIS 1381
             +I+
Sbjct: 1058 FLIT 1061

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1345 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1395
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1396 IYKRDNRTKST 1406
              K+ +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSI 1363
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 155 FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I K++L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    R  
Sbjct: 74  YIKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 130

Query: 213 RLSDLI 218
            L DLI
Sbjct: 131 SLKDLI 136

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1301 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDF 1358
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1359 RN----VSIVANYIKERTKNAQFIV 1379
             N      ++ N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 155 FINKLVLDNFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 207
           ++ ++ L NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1368
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
           YLR383W
          Length = 1098

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 155 FINKLVLDNFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I K+ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +AN   R +
Sbjct: 70  YIKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGN 126

Query: 213 RLSDLI 218
            L DLI
Sbjct: 127 SLKDLI 132

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 92/405 (22%), Positives = 165/405 (40%), Gaps = 77/405 (19%)

Query: 1012 YQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTE--NDTNMTEISNLKSELKDQGEQLK 1069
            Y +Q+   +Q+     NE K+I+ KL      +TE   D N    + +    KD+ ++++
Sbjct: 703  YDEQINELKQNIRTLDNEKKIIQNKLNNNTKQITELKKDLNKVVDTGVLDSAKDEYQRIQ 762

Query: 1070 ERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQML 1129
              +   E  ++  K          E +N+LL        ++ + LND  IRD        
Sbjct: 763  NAIVSYETALEGLK----------ENMNTLL--------EKARPLND--IRDTAQKTYRN 802

Query: 1130 DNNQMDVVEDGIKDEQDADQDKPSGIP--DDEK--IQEKDDADNNHHSMNIDEMSSEISR 1185
               + + ++  ++D     +     I   +DEK  IQEK D        NI+++ S I  
Sbjct: 803  IKKEFEALKQELEDRDIRIRRYKDDITIQNDEKARIQEKID----RVQSNINDLMSGIET 858

Query: 1186 GIPXXXXXXXXXXXXXXXXXXXXGLTCYINE-TSVDIGVLEEYVRRLIE-----FKRRKL 1239
             I                        C   E TS ++   ++ +R+ +E      KR + 
Sbjct: 859  QIENASEF------------------CSEEESTSENLPDNQDDIRKELEDISRKIKRNES 900

Query: 1240 DLNQAVQKRDEVKEQLE---ILKKNRFDEFMNGFNIISMTLKEM-----YQMITMGGNAE 1291
            D+  + +K  E+ EQ     +  K ++ E  N  +I++ ++K       YQ  +   +A+
Sbjct: 901  DIGVSYEKALELYEQTMSKFLSAKEKYIEMDNALSILNHSIKSRTVNFGYQKTSTFADAD 960

Query: 1292 LELVDSL--DPFSEGVTFS--------VMPPK--KSWRNITNLSGGEKTLSSLALVFALH 1339
             +  +SL    F   + F            P+  K  RN+  LSGGEK+ S +AL+ A  
Sbjct: 961  FDFRNSLRIRKFKGKLDFGKTKETLNVYTGPQTDKEPRNVDTLSGGEKSFSQIALLLATW 1020

Query: 1340 KYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1381
            K   + +  +DE D  +D  N       I ++ K+    Q I+I+
Sbjct: 1021 KPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLKDDSRTQTIIIT 1065

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1301 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN 1360
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1361 VSIVANYIKERT 1372
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 1301 FSEGVTFSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMD 1350
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1351 EIDAALDFRNVSIVANYI 1368
            E D  +D  N  I    I
Sbjct: 1036 EFDVFMDQVNRQIGTKLI 1053

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar to
            uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
            Minus-end-directed microtubule motor that functions in
            mitosis and meiosis localizes to the spindle pole body
            and localization is dependent on functional Cik1p
            required for nuclear fusion during mating potential
            Cdc28p substrate
          Length = 731

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 59/106 (55%), Gaps = 5/106 (4%)

Query: 1012 YQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKER 1071
            YQK  K   Q  E  SN++ V+ +++K T L    N+  M E++ L+ +L++    LK+R
Sbjct: 254  YQKNWKENVQMNENFSNDVTVLGQQIK-TVLEPQCNEK-MQEVAALRGKLQNLQNSLKQR 311

Query: 1072 ---LTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKEL 1114
                  M+  IDE K   ++ K K ++L+  + + K+E++Q D+ L
Sbjct: 312  QDDTQSMKRQIDEIKGKTVQTKRKRQELHDYIHNTKSELQQIDEIL 357

>Skud_11.179 Chr11 complement(322462..325224) [2763 bp, 920 aa] {ON}
           YKL050C (REAL)
          Length = 920

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 457 KTLSLEKRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHE 516
           K LS EK +L G   S E   ++L N   +  +  KS  + +  SE  + +L  ++ E +
Sbjct: 533 KNLSAEKDDLTGWNESCE---RDLKNTSIEQAQVFKSNANDLRVSEKEYDDLVGERNEIQ 589

Query: 517 KEIKDLNQSLEEERIIL 533
           +EIK L+ S+ E RI++
Sbjct: 590 REIKKLDASIAEHRIVI 606

>ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highly
            similar to uniprot|P15436 Saccharomyces cerevisiae
            YDL102W CDC2 Catalytic subunit of DNA polymerase delta
            required for chromosomal DNA replication during mitosis
            and meiosis intragenic recombination repair of double
            strand DNA breaks and DNA replication during nucleotide
            excision repair (NER)
          Length = 1090

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1345 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1395
            PLYV++   +ID+     N      +SIVA  + E+  NA F+V S++ N   +   L+G
Sbjct: 935  PLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMKGGLMG 994

Query: 1396 IYKRDNRTKST 1406
              K+ +  K+ 
Sbjct: 995  FVKKVDSCKNC 1005

>KLLA0E04115g Chr5 complement(372858..373421) [564 bp, 187 aa] {ON}
            weakly similar to uniprot|Q99176 Saccharomyces cerevisiae
            YLR119W SRN2 Component of the ESCRT-I complex which is
            involved in ubiquitin-dependent sorting of proteins into
            the endosome suppressor of rna1-1 mutation may be
            involved in RNA export from nucleus
          Length = 187

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 1047 NDTNMTEISNLKSELKDQGEQLKERLTEMEEN-------IDEFKSLEIEMKNKLEKLNSL 1099
            ND  + +ISN     K Q EQL E L ++ EN       +D FK LE E   K + L+ L
Sbjct: 56   NDNLVQDISNKSVAWKAQAEQLIEGLNKLAENKRHLKGELDSFKKLEFEYMKKWQDLDLL 115

Query: 1100 L 1100
            +
Sbjct: 116  I 116

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (53%)

Query: 473  LEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEE 528
            L E+ + L    G  EK +   KHS  E+E   +E   Q ++ EKE KDL Q LEE
Sbjct: 1535 LAEKDEKLETCKGDNEKKITKLKHSFDETEDKLKESNMQTSKLEKENKDLRQKLEE 1590

>KLLA0C06116g Chr3 complement(536524..538881) [2358 bp, 785 aa] {ON}
           similar to uniprot|P04786 Saccharomyces cerevisiae
           YOL006C TOP1 topoisomerase I
          Length = 785

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 71/155 (45%), Gaps = 18/155 (11%)

Query: 838 NQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAE 897
           N   EI+D T EE + I   + ERE   R       E E E +K   ++P  +SQ+    
Sbjct: 620 NYFKEIDDLTKEEELTIHKRIIERE---REKYKRKFERENEKRKFSKEDPIPDSQLLEWL 676

Query: 898 MEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKE 957
            + D L     L E+++   K+          ++ E ++NLE L+   E L+        
Sbjct: 677 AKVDDLEK---LYERESTTGKI----------ELRESLQNLEKLKQNVEKLEKRITNCSL 723

Query: 958 QIKILQDQ-IMKIGGTKLHTQNSKVG-SLCQRIDI 990
           Q+K  +D   + +G +K++  + ++  + C++ D+
Sbjct: 724 QLKDKEDNSTVALGTSKINYIDPRLSVAFCKKFDV 758

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 32.7 bits (73), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1301 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRN 1360
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1361 VSIVANYIKERTKNAQFIVISL 1382
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>Ecym_1052 Chr1 complement(93652..95130) [1479 bp, 492 aa] {ON}
            similar to Ashbya gossypii AFR702W
          Length = 492

 Score = 32.3 bits (72), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 8/110 (7%)

Query: 1024 ELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENIDEFK 1083
            E+  NE ++I ++ +QT   + E+DT + E+ +LK E     + LK++L  ++   DE +
Sbjct: 302  EIKENEERMIRQRRRQT--VILEDDTQVAELESLKYE----NDDLKKQLQALKRKQDELE 355

Query: 1084 SLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIR--DVTHTLQMLDN 1131
             L  +   + EKL +    +  E     +EL D   R  DV  +  M  N
Sbjct: 356  KLRFKWDTEREKLTTHNNSLNQEFDAISRELVDTQRRLDDVIQSQSMKSN 405

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,145,902
Number of extensions: 6140181
Number of successful extensions: 50116
Number of sequences better than 10.0: 1782
Number of HSP's gapped: 46828
Number of HSP's successfully gapped: 3961
Length of query: 1417
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1295
Effective length of database: 39,492,147
Effective search space: 51142330365
Effective search space used: 51142330365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)