Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1538.258ON43843823660.0
Suva_10.1698.258ON43843821420.0
YLR085C (ARP6)8.258ON43843821410.0
Smik_12.1448.258ON43843821260.0
NCAS0B049908.258ON42043816280.0
NDAI0B019608.258ON43944116270.0
KAFR0B027008.258ON42043815970.0
ZYRO0C01738g8.258ON41443815940.0
Kpol_543.368.258ON42744115940.0
TDEL0F038508.258ON41943915920.0
KLTH0G13772g8.258ON42043815730.0
TBLA0H014608.258ON44244815660.0
SAKL0H17138g8.258ON41943915210.0
CAGL0L12166g8.258ON42143315050.0
Kwal_56.238328.258ON41943814990.0
KNAG0G020108.258ON42443714770.0
Ecym_43128.258ON41143514400.0
AGR091W8.258ON41043614070.0
TPHA0A018308.258ON42144013960.0
KLLA0F19063g8.258ON41544213840.0
NCAS0C037008.23ON3754352552e-23
TBLA0C004408.23ON3754352543e-23
ZYRO0F02772g8.23ON3754352524e-23
TPHA0D002508.23ON3754352525e-23
TDEL0C004708.23ON3754352525e-23
CAGL0K12694g8.23ON3754352525e-23
Suva_6.188.23ON3754352525e-23
Smik_6.398.23ON3754352525e-23
YFL039C (ACT1)8.23ON3754352525e-23
KNAG0L002508.23ON3754352516e-23
KAFR0D009408.23ON3754352516e-23
NDAI0G030408.23ON3754352517e-23
ABR222W8.23ON3764352491e-22
SAKL0B00968g8.23ON3754352491e-22
Kpol_1058.158.23ON3754352482e-22
KLLA0D05357g8.23ON3754352463e-22
Skud_6.318.23ON3603872454e-22
KLTH0G18832g8.23ON3754352455e-22
Ecym_15208.23ON3764382439e-22
Kwal_14.11098.23ON3603872374e-21
KLTH0F06490g3.161ON3913862191e-18
Ecym_63852.117ON3774422172e-18
NDAI0G029003.161ON3913872172e-18
TBLA0F008703.161ON3913892137e-18
ZYRO0B04928g3.161ON3913872137e-18
AFR051W2.117ON4054422084e-17
CAGL0K01595g3.161ON3913852066e-17
NCAS0C035503.161ON3923872067e-17
KNAG0K01130na 1ON3933872059e-17
SAKL0E11814g2.117ON3794502031e-16
SAKL0C07370g3.161ON3913852032e-16
Kwal_33.141773.161ON3373182002e-16
KLLA0C03850g3.161ON3913871995e-16
YDL029W (ARP2)3.161ON3913871979e-16
ADR316W3.161ON3913881961e-15
Smik_4.2063.161ON3913871961e-15
Suva_4.2203.161ON3913871951e-15
TDEL0D046103.161ON3913851951e-15
ZYRO0G05676g2.117ON3814341952e-15
KLLA0E22925g2.117ON3804411914e-15
Skud_4.2223.161ON3913871914e-15
Kpol_479.253.161ON3913871898e-15
Ecym_52373.161ON3913841899e-15
Kwal_23.48482.248ON7451571883e-14
TDEL0C041402.248ON7491601855e-14
TPHA0A009203.161ON3913851782e-13
KNAG0I018602.248ON7531581802e-13
KAFR0C01040na 1ON3373181763e-13
NCAS0B071302.117ON3814321773e-13
SAKL0E08602g2.248ON7471571794e-13
TDEL0B048102.117ON3734311754e-13
KNAG0H036502.117ON3874431746e-13
Kpol_1023.188.23ON3193491736e-13
Ecym_32852.248ON7461631741e-12
YNL059C (ARP5)2.248ON7551651732e-12
NDAI0D010602.248ON7531561722e-12
Kpol_1003.162.248ON7491641722e-12
TPHA0I013002.117ON3794301675e-12
Smik_14.2672.248ON7551561661e-11
NDAI0B044602.117ON3813841641e-11
Suva_14.2812.248ON7551581661e-11
KLLA0F03421g2.248ON7471801652e-11
TBLA0E038602.248ON7591561643e-11
Skud_14.2722.248ON7551661624e-11
Smik_8.2102.117ON3843871595e-11
ADL253C2.248ON7511571615e-11
KLTH0G09482g2.248ON7451571616e-11
KLLA0B13904g1.514ON4562581571e-10
Skud_8.1902.117ON3844011552e-10
YHR129C (ARP1)2.117ON3843881552e-10
KNAG0B001701.514ON4532591552e-10
CAGL0F00517g1.514ON4542591542e-10
CAGL0H09042g2.117ON3874301533e-10
TPHA0O010401.514ON4582621534e-10
AFR419C1.514ON4552581516e-10
KAFR0F005902.117ON3864311506e-10
Suva_15.3262.117ON3843831507e-10
NDAI0A039701.514ON4622591508e-10
SAKL0D12804g1.514ON4562591491e-09
KLTH0B05940g2.117ON3834461481e-09
KAFR0D037001.514ON4492611481e-09
Suva_12.1541.514ON4492611482e-09
NCAS0A122701.514ON4542591472e-09
Smik_10.3551.514ON4492611472e-09
Kwal_33.146422.117ON3834411452e-09
Skud_10.2891.514ON4492611463e-09
TPHA0C031602.248ON7551561463e-09
Ecym_31531.514ON4582601453e-09
ZYRO0G01936g1.514ON4612561453e-09
KLTH0C02508g1.514ON4512611454e-09
TDEL0F004701.514ON4612591454e-09
Kpol_1056.161.514ON4602591445e-09
YJR065C (ARP3)1.514ON4492591435e-09
TBLA0B010702.117ON3834351426e-09
ZYRO0A01584g2.248ON7482051439e-09
TBLA0D036801.514ON4584531364e-08
Kwal_27.99581.514ON4451921331e-07
CAGL0J10054g2.248ON7541841322e-07
KAFR0J011602.248ON7511561261e-06
KLLA0D02288g1.287ON5201051171e-05
AFR105C1.287ON4791051152e-05
Kpol_282.41.287ON5011461142e-05
TDEL0D015501.287ON480891044e-04
TBLA0D053601.287ON5961251035e-04
NCAS0G030502.248ON7431411000.001
Ecym_63301.287ON4801051000.001
ZYRO0G21428g1.287ON483145960.003
NDAI0G055801.287ON515242960.003
TPHA0I010301.287ON503106960.004
NCAS0B060601.287ON49797950.005
KLTH0H09702g1.287ON481105930.007
SAKL0D05874g1.287ON497105930.008
CAGL0M03201g1.287ON49384880.029
Kwal_14.23771.287ON48189870.042
KAFR0A015601.287ON485113870.044
Suva_6.1541.287ON489113840.092
Smik_10.1611.287ON489237830.13
SAKL0F13772g7.448ON422290810.19
Skud_10.1321.287ON48889790.38
KLTH0C05324g7.448ON399216780.39
YJL081C (ARP4)1.287ON489237780.55
Kwal_27.105527.448ON351207751.1
KNAG0B019201.287ON505105722.5
KLLA0E06315g7.448ON438140704.2
KNAG0I026506.373ON209150696.5
TDEL0C031207.448ON438145687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.153
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   915   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   829   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   829   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   823   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   631   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   631   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   619   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   618   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   618   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   617   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   610   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   607   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   590   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   584   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   582   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   573   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   559   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   546   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   542   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   537   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   102   2e-23
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   102   3e-23
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   101   4e-23
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   101   5e-23
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   101   5e-23
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   101   5e-23
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   101   5e-23
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   101   5e-23
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   101   5e-23
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   101   6e-23
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   101   6e-23
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   101   7e-23
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   100   1e-22
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   100   1e-22
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   100   2e-22
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    99   3e-22
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    99   4e-22
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    99   5e-22
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    98   9e-22
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    96   4e-21
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    89   1e-18
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    88   2e-18
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    88   2e-18
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    87   7e-18
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    87   7e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    85   4e-17
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    84   6e-17
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    84   7e-17
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    84   9e-17
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    83   1e-16
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    83   2e-16
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    82   2e-16
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    81   5e-16
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    80   9e-16
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    80   1e-15
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    80   1e-15
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    80   1e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    80   1e-15
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    80   2e-15
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    78   4e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    78   4e-15
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    77   8e-15
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    77   9e-15
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    77   3e-14
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    76   5e-14
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    73   2e-13
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    74   2e-13
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    72   3e-13
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    73   3e-13
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    74   4e-13
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    72   4e-13
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    72   6e-13
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    71   6e-13
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    72   1e-12
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    71   2e-12
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    71   2e-12
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    71   2e-12
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    69   5e-12
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    69   1e-11
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    68   1e-11
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    69   1e-11
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    68   2e-11
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    68   3e-11
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    67   4e-11
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    66   5e-11
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    67   5e-11
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    67   6e-11
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    65   1e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    64   2e-10
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    64   2e-10
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    64   2e-10
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    64   2e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    64   3e-10
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    64   4e-10
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    63   6e-10
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    62   6e-10
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    62   7e-10
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     62   8e-10
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    62   1e-09
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    62   1e-09
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    62   1e-09
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    62   2e-09
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    61   2e-09
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    61   2e-09
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    60   2e-09
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    61   3e-09
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    61   3e-09
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    60   3e-09
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    60   3e-09
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    60   4e-09
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    60   4e-09
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    60   5e-09
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    60   5e-09
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    59   6e-09
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    60   9e-09
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    57   4e-08
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    56   1e-07
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    55   2e-07
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    53   1e-06
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    50   1e-05
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    49   2e-05
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    49   2e-05
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    45   4e-04
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    44   5e-04
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    43   0.001
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    43   0.001
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    42   0.003
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    42   0.003
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    42   0.004
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    41   0.005
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    40   0.007
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    40   0.008
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    39   0.029
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    38   0.042
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    38   0.044
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    37   0.092
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    37   0.13 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    36   0.19 
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    35   0.38 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    35   0.39 
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    35   0.55 
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    33   1.1  
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    32   2.5  
KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {...    32   4.2  
KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {...    31   6.5  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    31   7.2  

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/438 (100%), Positives = 438/438 (100%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHGPDWCTKQRFGYQNWI
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/438 (89%), Positives = 413/438 (94%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  PIVIDNGSYEIKF PSTN+MPFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNPSEF GFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEFDSLFKSPVAVFVPFTKSYKGK++TISGKDE+ADV  S+S   TFTS+E     NS
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           ++DYHDFQLVIDSGF+CTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KEKCLFVSP SYFDSFK+K+KH LEYVLPDFQTSFIGYVR+P EE+SPLP D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ+I LTDELFTIPETFFHPEISQI KPGIVEAILESLSMLPEIVRPLM+GNIVCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLPNFAQRLA ELQRQLPTDWTC+VSVP GDC LFGWEVMSQFAKTESY+RARVTR+EYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHGPDWCTK RFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/438 (91%), Positives = 415/438 (94%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  PIVIDNGSYEIKF PSTN+ PFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNPSEF GFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEFDSLFKSPVAVFVPFTKSYKG+++TISGKDE+ D+V  NS  T  TS E  +AQ+S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KE+CLFVSPVSYFDSFK KDKHALEYVLPDFQTSF+GYVRNPR+EN PLPED
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ I LTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVP GDCALFGWEVMSQFAKT+SYR+ARVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHGPDWCTK RFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/438 (89%), Positives = 403/438 (92%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME +PIVIDNGSYEIKF PSTNE PFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCFFNP EF GFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEFDSLFKSPVA FVPFTKSYK K+K ISGKDE+AD+V S S      S      Q  
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLD+GGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KEKCLFVSPVSYFDSFK KDKHALEYVLPDFQTSF+GYVRN R+ENSPL ED
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQTI LTDELFTIPETFFHPEI+QITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVP  DCALFGWEVMSQF+ T SYR ARVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHG DWCTK RFGYQNWI
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/438 (68%), Positives = 353/438 (80%), Gaps = 18/438 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME SPI IDNGSYEIKF  +    P+RA+NA A DK+ T+YLSN IKNIKDI+S+TFRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELES IWDY  FNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEFDS +KS +A F+ F      K+  ISGK EE   + S +             Q  
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKI--ISGKTEEDISLDSVN-------------QVR 165

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           + +Y+D+QLVIDSGFNCTWIIPV+KG+PYYKAVKKLDIGGRFL GLLKETLSFRHY++MD
Sbjct: 166 EKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD 225

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KE CLFVSP SYFDSFK K++ A+EYVLP+FQT+F+G+VR   ++  PLPE+
Sbjct: 226 ETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVR---DKTKPLPEN 282

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            QTI L DELF++PETFFHPEI++I KPG+VE ILESLSM+PE++RPL+VGN+VCTGGNF
Sbjct: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLP+FA RL +ELQRQLPTDW C  SVP  +C LFGW+ M+QFA TESYR+ RVTR+EYY
Sbjct: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHG DW TK RFGYQNWI
Sbjct: 403 EHGTDWLTKNRFGYQNWI 420

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/441 (64%), Positives = 355/441 (80%), Gaps = 5/441 (1%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M+ +P+V+DNGSYEIKF  S +E P+RALN  A DK+G++YLSN +K I+++S +T RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELESCIWDYC +NP EF GF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPF---TKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSA 177
           EEYEFDSLFK+P A ++PF       K  L TISGK  + D++  +  +T  T       
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 178 QNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
           +   +DY D++LVIDSGFNCTWIIP++KG+PYYKA+KKLDIGGRFLTGLLKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 238 MMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297
           +MDET+LVNN+KEKCLFVSP SYFDSFKAK++ ++EY+LPD  +S++GY R    ++ PL
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTR--ENKSKPL 298

Query: 298 PEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
           PE +Q + L DELF++PETFFHPEIS+I KPGIVE ILESLSM+PEI+RPL+V NIVCTG
Sbjct: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358

Query: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRD 417
           GNFNLP+FA RLAAELQRQLPTDWTC +SVP  +C LF W+ M QFA T+SY++ R++++
Sbjct: 359 GNFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418

Query: 418 EYYEHGPDWCTKQRFGYQNWI 438
           EYYEHGPDW TK +FGYQNW+
Sbjct: 419 EYYEHGPDWLTKHKFGYQNWL 439

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/438 (65%), Positives = 344/438 (78%), Gaps = 18/438 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME +P+VIDNGSY +KF P++ E P+ ALNA+A DK+  SYLSN IK+IKDISS++ +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H LGQLT WE+++ IWDYC +NP EF GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEF SL KSPVA ++PF ++ K ++  I  +D E  V T                  S
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQI-IIGERDTEPFVETP-----------------S 162

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y DFQLV+DSGFNCTWIIPV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 163 TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KEKCLFVSP SYFDSFK KD  + EYVLPDFQTSF+GYVR   E+  PLPED
Sbjct: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q+I L DELF +PETFFHPEISQI KPG+VE ILESLSM+PE++RPLMV NI+C GGNF
Sbjct: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLP+FA R+A ELQRQLPTDW C +++  G+  L GW+ MS FA T+ Y+  RVTR+EYY
Sbjct: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHG DWCTK RFGYQNW+
Sbjct: 403 EHGIDWCTKHRFGYQNWV 420

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/438 (67%), Positives = 342/438 (78%), Gaps = 24/438 (5%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  PIV+DNGSYEIKF     E P RA NALA+DKFG+ YLSN IK IKDISS+ FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WELES IWDYCFFNP EF GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEF S+FKSP+A F PF +        ISGK ++                   + +  
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPSIA----ISGKGDDQP-----------------NRKAE 159

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
              Y  FQLVID GFNCTW++PV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 160 PDAYEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KE CLFVSPVSYF+SFK K++ A+EYVLPDFQTSF+GYV++P++   PLP+D
Sbjct: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QT+ L DELF++PETFFHPEI Q+ KPGI+E ILESLS+LPE +RPLM+GNIVCTGGNF
Sbjct: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNF 336

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           NLPNFA RLA ELQRQLPTDWTC V +P G   L+GW  M+ F  +  Y  ARVTR+EY+
Sbjct: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHG DWCT+ RFGYQNW+
Sbjct: 397 EHGVDWCTRHRFGYQNWM 414

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/441 (65%), Positives = 358/441 (81%), Gaps = 17/441 (3%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME++PIVIDNGSYE+KF  S  ++P RALNALAKDK+G  YLSN + NIKDISS+T RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE  +WDYCFFNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEE--ADVVTSNSGITTFTSRECGSAQ 178
           EEYEF+SLFKSPVA FVPF  + +  +K I GK ++   D++++              +Q
Sbjct: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISN------------MDSQ 167

Query: 179 NSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNM 238
           N  + Y DF LVIDSGFNCTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++
Sbjct: 168 NIKNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDV 227

Query: 239 MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLP 298
            DETILVNN+KEKCLF+SP SY DSFK KD+++++YVLPDFQTSFIGYV++ ++ NS LP
Sbjct: 228 TDETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLP 286

Query: 299 EDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358
           E++Q I LTDELF++PET FHPE++++ KPGIVE ILESLS++PE +RPL+V NIVC GG
Sbjct: 287 ENSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGG 346

Query: 359 NFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAK-TESYRRARVTRD 417
           NFN+PNF  RLA ELQRQLPTDW C++ +P  DC L GW+ MSQFA+ T+ Y++AR++R+
Sbjct: 347 NFNMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISRE 406

Query: 418 EYYEHGPDWCTKQRFGYQNWI 438
           EYYEHG DW TK+RFGYQNWI
Sbjct: 407 EYYEHGTDWTTKKRFGYQNWI 427

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/439 (65%), Positives = 351/439 (79%), Gaps = 21/439 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME  P+V+DNGSYE+KF  ST   PFRALNALA+DKFG +YLSN I  IKDISS++F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WEL+SC+WDYCFFNP+EF GFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEFDSL K+P++ F+PF+K +    K ISGK +                 E G++ + 
Sbjct: 121 EEYEFDSLLKAPISGFMPFSK-HTENTKVISGKGDS----------------ESGTSTSE 163

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             DY  FQ+VIDSGFNCTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+MD
Sbjct: 164 TKDYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMD 223

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KEKCLF+SPVSYFDSF  KD+ A+EYVLPDFQT+F+GYV + +   +P  +D
Sbjct: 224 ETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRK---NPPSKD 280

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQT+ L DELF++PETFFHPEI+Q+ KPGI+E ILESLS++PE +RPLMV NI+CTGGNF
Sbjct: 281 AQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNF 340

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPI-GDCALFGWEVMSQFAKTESYRRARVTRDEY 419
           NLP+F +RLA ELQRQLPTDW+  + +P    C L GW  MS FA T+ Y+ ARV+R EY
Sbjct: 341 NLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEY 400

Query: 420 YEHGPDWCTKQRFGYQNWI 438
           YEHG +W TK RFGYQNWI
Sbjct: 401 YEHGVEWTTKNRFGYQNWI 419

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/438 (64%), Positives = 347/438 (79%), Gaps = 18/438 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME +PIVIDNGSYEIKF  +++  PF ALN++AKDK+G  +LSN +++IKDISS+TF RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELES IWDYC FNP EF G+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYE+DSLFK+PV VFVPF    +G    I    E+ADVV S+               + 
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVVASDH-------------PSD 165

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
           + DY D++LVIDSGFNCTW++PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVN++KEKCLF+SP SYFDSF+++ K A EYVLPDF TSF GY+R P +    LPED
Sbjct: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT---LPED 282

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QTI L DELF +PETFFHPEI+ +  PGI+EAILES+SMLPE +RPL+VGN+V TGGNF
Sbjct: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           N+PNFA RLA ELQRQ PTDW+C VSVP GD  L+GW+ M +F++T++YR +RV+R+EYY
Sbjct: 343 NIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYY 402

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHG DWCT +RFGYQ W+
Sbjct: 403 EHGVDWCTSKRFGYQAWL 420

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/448 (63%), Positives = 356/448 (79%), Gaps = 16/448 (3%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M+  PIVIDNGSYEIKF  S + +PFRA+NA+AKDK+ T YLSN IK IKDISS+ FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           +ELGQLT WELES IWDYCF+NP EF GF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDE----------EADVVTSNSGITTFT 170
           EEY + S++KSPVA F+PF    K  + +ISGK +          +  +VT++  + T+ 
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVI-SISGKADDDDDDNNAKFQEQLVTND--LNTYI 177

Query: 171 SRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
           S E  S   + ++Y DFQL+IDSGFNCTWIIPV+KGIPYYKA+KK+DIGGRFLTGLLKET
Sbjct: 178 SSEEPSVTKT-AEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKET 236

Query: 231 LSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
           LSFRHYN+ DETILVNN+KEKCLFV+P SY +SFK K+K A+EYVLPDF T+F+GY+++ 
Sbjct: 237 LSFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKD- 295

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
               + LP++AQ I L DELF++ ET FHPEIS+I KPGI+E I+ESLSMLPE++RPLMV
Sbjct: 296 -NSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMV 354

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYR 410
            NIVC GGNFNLPNF++RL +ELQRQLPTDWT HV +P  D  LFGW+ M+QF+ T+SYR
Sbjct: 355 NNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYR 414

Query: 411 RARVTRDEYYEHGPDWCTKQRFGYQNWI 438
           +AR+TR+EY EHG +WCTK RFGYQNWI
Sbjct: 415 KARITREEYMEHGVEWCTKHRFGYQNWI 442

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/439 (63%), Positives = 342/439 (77%), Gaps = 21/439 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M+ +PI+IDNGSYE+KF P+TN  PFRALNALA+DK+G  +LSN +  +KDIS++ FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WEL+SCIWDYC +NP EF  +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEF S FK PVA FVPF  +++     +    E++     ++G               
Sbjct: 120 EEYEFGSCFKGPVAGFVPF--NWQALEHNMIYAKEDSVYRKDSTG--------------E 163

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
            ++Y+DFQLVIDSGFNCTW++P++KGIPYYKA+KKLDIGGRFL G LKETLSFRHYN+MD
Sbjct: 164 RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD 223

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVNN+KEKCLF+SPVSYF+SF+ K+    EYVLPDFQTSF GYV+  +++   +PED
Sbjct: 224 ETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPED 280

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QTI L DELF+IPETFFHPEI+ + KPGIVE ILES+SMLPE +RPLMV N V TGGNF
Sbjct: 281 SQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNF 340

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVP-IGDCALFGWEVMSQFAKTESYRRARVTRDEY 419
           N+ NFA+RLA ELQRQ PTDW   VSVP   D ALFGW+ M QF++T +Y++ RVTR+EY
Sbjct: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400

Query: 420 YEHGPDWCTKQRFGYQNWI 438
           YEHG DWCTKQRFGYQ W+
Sbjct: 401 YEHGVDWCTKQRFGYQKWL 419

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/433 (61%), Positives = 341/433 (78%), Gaps = 18/433 (4%)

Query: 6   IVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQ 65
           IVIDNGSY++KF  ++   P  ALNALAKDK+G ++LSN ++NIKDISS+ FRRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125
           LT WELESCIWDYC +NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNSDSDYH 185
           DSL+K+P A ++PF  + +  +KTISGK +  ++             +      +  +Y+
Sbjct: 126 DSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGEL-------------DIEEKIEAGKEYN 171

Query: 186 DFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILV 245
           DF LVIDSGFNCTW+IP++KG+PYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+ILV
Sbjct: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231

Query: 246 NNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIA 305
           NN+KE+CL+V PVSYF++FKAK K+ +++VLPDFQTSF GYVR+P+   + LP++AQ + 
Sbjct: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQILT 288

Query: 306 LTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365
           LTDE F++PE FFHPEISQ  KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP F
Sbjct: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348

Query: 366 AQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPD 425
             RL +ELQRQLPTDW C   +  GD +L GW  M++FA T++Y++ARVT+++Y+EHG D
Sbjct: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLD 408

Query: 426 WCTKQRFGYQNWI 438
           W TK+RFGYQNW+
Sbjct: 409 WTTKERFGYQNWV 421

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/438 (62%), Positives = 335/438 (76%), Gaps = 19/438 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           ME SP++IDNGSYEIKF   + + P RALN++AKDK+G  +LSN +++IKDISS+ F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE+ IWDYC FNP +F G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEYEF+++FK+PV VFVPF           +GK     +V      +     E   A+N 
Sbjct: 121 EEYEFETMFKAPVPVFVPFN----------TGKKSTHMLVAKED--SEVEESEVAPAKN- 167

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
              Y+DFQLVIDSGFNC+WI+PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 168 ---YNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           ETILVN++KE CLF+SP +YF+SF+++ K A EYVLPDF TSF GY+R P +    LP +
Sbjct: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQ---VLPAE 281

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QTI L DELF +PETFFHPEI+ +   GIVE ILES+SMLPE +RPLMVGNIV TGGNF
Sbjct: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420
           N+PNFA RLA ELQRQ PTDW+C VS+P GD  L+GW+ M +F++TE Y  +RVTR EYY
Sbjct: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401

Query: 421 EHGPDWCTKQRFGYQNWI 438
           EHG DWCT +RFGYQ W+
Sbjct: 402 EHGVDWCTAKRFGYQAWL 419

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/437 (61%), Positives = 328/437 (75%), Gaps = 18/437 (4%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64
           P VIDNGSYEIKF  +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHELG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTLWELESCIWDYCFFNPSEFRGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEEY 123
           QL  WELE CIWDYC +NP EF GF L +  +   L+ +E+C TLPELSK++DQV+FEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFDSLFKSPVAVFVPFTKSYKGK-LKTISGKDEEADVVTSNSGITTFTSRECGSAQNSDS 182
           EF ++FKSP + F+PF      K ++ + GKD        N+  TT T++E         
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAV-----NTDYTTATTKE--------- 168

Query: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242
            Y DFQLVIDSGFNCTW++P++KG+P+YKA+KK+DIGGRFL GLLKETLSFRHYNMMDET
Sbjct: 169 -YRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDET 227

Query: 243 ILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ 302
           IL+NN+KEKCLFVSPVSYFDSFK K + A+EYVLPDFQTSF+GY+ +            Q
Sbjct: 228 ILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 303 TIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
           TI LTDE F +PETFFHPE++ I KPG+VE ILE++SM+PE +RP++V NIVC GGNF L
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSVP-IGDCALFGWEVMSQFAKTESYRRARVTRDEYYE 421
           P+ + RL +ELQRQLPTDWTC V+VP   DC L  W  M+QF+ T+ Y+  RVTR+EY E
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLE 407

Query: 422 HGPDWCTKQRFGYQNWI 438
           HG DWC+K RF YQNWI
Sbjct: 408 HGTDWCSKHRFTYQNWI 424

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/435 (60%), Positives = 327/435 (75%), Gaps = 28/435 (6%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64
           PI+IDNGSYEIKF PS+ + P+RALN LA+DK+G  +LSN +K I+++S+   RRP ELG
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63

Query: 65  QLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124
           QL  WELE  IWDYC FN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEYE
Sbjct: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122

Query: 125 FDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADV-VTSNSGITTFTSRECGSAQNSDSD 183
           F SL K PVA ++PF              D  AD  V  + G+     ++         D
Sbjct: 123 FGSLMKCPVAQYIPF--------------DNMADYKVYGSDGLPVVRKKD---------D 159

Query: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI 243
           Y+DFQLV+DSGFNCTW+IPV+KG+PYYKAVKKLDIGGRFLTGLLKET+SFRHYN+MDETI
Sbjct: 160 YNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI 219

Query: 244 LVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQT 303
           L NN+KE+C F+ PVSYFDSF+ K +  ++YVLPDFQTS IGYVR P++    +PED+QT
Sbjct: 220 LANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ---AIPEDSQT 276

Query: 304 IALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
           + L DELFTIPETFFHPEI+ I KPG++E +LES+SMLPE++RPLMV NI   GGNFN+ 
Sbjct: 277 LNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNIS 336

Query: 364 NFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHG 423
           NFA RLA ELQRQ PTDW+  V +P GD  L GW+ M +F+ T+SY++ RVTR EY EHG
Sbjct: 337 NFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396

Query: 424 PDWCTKQRFGYQNWI 438
            DWCTK RFGY+ WI
Sbjct: 397 VDWCTKYRFGYEQWI 411

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/436 (58%), Positives = 322/436 (73%), Gaps = 27/436 (6%)

Query: 3   RSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHE 62
           R P++++NGSYEIKF P+  E P+RA N L +D++G  +LSN +  I+DIS    RRP E
Sbjct: 2   RVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSE 61

Query: 63  LGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEE 122
           LGQL  WELE  IWDYC FNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEE
Sbjct: 62  LGQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120

Query: 123 YEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNSDS 182
           YEF S+ K PVA FVPF ++             + D+V              G    + S
Sbjct: 121 YEFGSMMKCPVAQFVPFDRA------------RDYDIVGG-----------AGEVVEAKS 157

Query: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242
            Y++FQLV+DSGFNCTW++PV+KG+PYYKA KKLDIGGRFL GLLKET+SFRHYN+MDET
Sbjct: 158 GYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDET 217

Query: 243 ILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ 302
           IL+NN+KE+C F+ PVSYFDSF+ K++  +EY+LPDFQTS IGYVR P++    +P+ +Q
Sbjct: 218 ILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQ 274

Query: 303 TIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
            + L DELFT+PETFFHPEIS I KPG+VE ILE +SM+PE++RPL+V NIV  GGNFN+
Sbjct: 275 ILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNI 334

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEH 422
            NFA RLA ELQRQ PTDW   V  P  D AL GW+ M QF++T+SY+ +RVTR EY EH
Sbjct: 335 ANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEH 394

Query: 423 GPDWCTKQRFGYQNWI 438
           G DWCTK RFGY+ WI
Sbjct: 395 GADWCTKHRFGYEQWI 410

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/440 (57%), Positives = 329/440 (74%), Gaps = 21/440 (4%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M  +P++IDNGSYEIKF  S  E PF ALNALAKDK+ T YLSN I NIKDISS++ +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELE  IWDYCF+N  +F+GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180
           EEY FDSL+K+P A F+PF K+       +SGK +            T+     GS +N 
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSK------------TYLD---GSKEN- 164

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240
             +Y DF LVIDSG+NC+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 165 --NYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222

Query: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300
           E++LVNN+KE C+F+SPVSY +SFK K    +EYVLPDFQTSF+GYVR+ + ++S LPE 
Sbjct: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMK-KHSTLPEH 281

Query: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q+I L DELF++PE FFHPE++ + KPGI+E ILESL +LPE +R LMV NIVCTGGNF
Sbjct: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKT--ESYRRARVTRDE 418
           N+PNF  R+  ELQ+Q+ T+W C VS+P  +  L  W+ M  F +   E Y+  RVT+ E
Sbjct: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401

Query: 419 YYEHGPDWCTKQRFGYQNWI 438
           Y EHG +W TKQRFGYQNW+
Sbjct: 402 YNEHGFEWTTKQRFGYQNWL 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/442 (59%), Positives = 321/442 (72%), Gaps = 31/442 (7%)

Query: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60
           M    +VIDNGSYEIKF  S  + P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117
           HELGQL  WELES +WDYCF+N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSA 177
           VIFEEY+F S+FK PVA ++PF   Y+G+         + D +T+     T         
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPF---YQGQY--------QDDAMTAAEDKKT--------- 159

Query: 178 QNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237
               S Y DFQLVIDSGFNCTW +P++KG+PYYKA+KKLDIGGRFLTGLL+ET+SFRHYN
Sbjct: 160 ----SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215

Query: 238 MMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297
           +M+ETILVNN+KE+C FV P SYF SF  K    +EYVLPDFQTSF+GYV+ P +E   L
Sbjct: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK--L 273

Query: 298 PEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
            +DAQT+ LTDE+F++PETFFHPEI+QI KPGIVE ILE ++M PE+VRPL+V NIVCTG
Sbjct: 274 TDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333

Query: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPI-GDCALFGWEVMSQFAKTESYRRARVTR 416
           GNFN+PNF +RL  ELQRQ P DW+C V  P   D +L GWE M  FA ++ +R ARVTR
Sbjct: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393

Query: 417 DEYYEHGPDWCTKQRFGYQNWI 438
           +EY EHG DWCTK RFGYQ W+
Sbjct: 394 EEYLEHGLDWCTKNRFGYQQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (255), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/435 (24%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP I  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  102 bits (254), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMEVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 103/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   G+ +    S+      VR  +
Sbjct: 234 SSVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  101 bits (252), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 104/435 (23%), Positives = 172/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTASQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG+   P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 64

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 116

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 117 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 150

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + L
Sbjct: 151 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKIL 194

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 195 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 234

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 235 SAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKEL 294

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 295 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 353

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 354 QQMWISKQEYDESGP 368

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQILFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/435 (23%), Positives = 170/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G      + ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 102/435 (23%), Positives = 171/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKNN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQILFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           + R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 AERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTASQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 94/387 (24%), Positives = 155/387 (40%), Gaps = 73/387 (18%)

Query: 40  SYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHL 99
           SY+ +  ++ + I  +T R P E G +T W+    IW + F+N  E R       + H +
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPV 88

Query: 100 VASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADV 159
           + +E+ M      +   Q++FE +   + + S  AV   ++                   
Sbjct: 89  LLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYS------------------- 129

Query: 160 VTSNSGITTFTSRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIG 219
               SG TT                    +V+DSG   T ++P+  G     A+ ++D+ 
Sbjct: 130 ----SGRTT-------------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 166

Query: 220 GRFLTGLLKETLSFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLP 277
           GR LT  L + LS R Y+     E  +V ++KEK                    L YV  
Sbjct: 167 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVAL 206

Query: 278 DFQTSFIGYVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILES 337
           DF+       ++   E S    D Q I + +E F  PE  FHP +  +   GI +    S
Sbjct: 207 DFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNS 266

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGW 397
           +      VR  + GNIV +GG    P  A+R+  E+    P+     +  P  +     W
Sbjct: 267 IMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVW 325

Query: 398 EVMSQFAKTESYRRARVTRDEYYEHGP 424
              S  A   ++++  +++ EY E GP
Sbjct: 326 IGGSILASLTTFQQMWISKQEYDESGP 352

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 99.0 bits (245), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 102/435 (23%), Positives = 170/435 (39%), Gaps = 83/435 (19%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQILFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G      + ++D+ GR +T  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+      VR  +
Sbjct: 234 SAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKEL 293

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESY 409
            GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 294 YGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASLTTF 352

Query: 410 RRARVTRDEYYEHGP 424
           ++  +++ EY E GP
Sbjct: 353 QQMWISKQEYDESGP 367

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 98.2 bits (243), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 176/438 (40%), Gaps = 89/438 (20%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +        Y+ +  ++ + 
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRG 64

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 65  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 116

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 117 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 150

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + L
Sbjct: 151 ----------------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKIL 194

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEY---VLPDFQTSFIGY 286
           S R Y+     E  +V ++KEK  +V               AL+Y   +    Q+S I  
Sbjct: 195 SERGYSFSTTAEREIVRDIKEKLCYV---------------ALDYDQEMQTAAQSSAI-- 237

Query: 287 VRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                E++  LP D Q I + +E F  PE  FHP +  +   GI +    S+      VR
Sbjct: 238 -----EKSYELP-DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVR 291

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKT 406
             + GNIV +GG    P  A+R+  E+    P+     +  P  +     W   S  A  
Sbjct: 292 KELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVWIGGSILASL 350

Query: 407 ESYRRARVTRDEYYEHGP 424
            ++++  +++ EY E GP
Sbjct: 351 TTFQQMWISKQEYDESGP 368

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 92/387 (23%), Positives = 154/387 (39%), Gaps = 73/387 (18%)

Query: 40  SYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHL 99
           SY+ +  ++ + I  +T R P E G +T W+    IW + F+N  E R       + H +
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPV 88

Query: 100 VASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADV 159
           + +E+ M      +   Q++FE +   + + S  AV   ++                   
Sbjct: 89  LLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYS------------------- 129

Query: 160 VTSNSGITTFTSRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIG 219
               SG TT                    +V+DSG   T ++P+  G      + ++D+ 
Sbjct: 130 ----SGRTT-------------------GIVLDSGDGVTHVVPIYAGFSLPHGILRIDLA 166

Query: 220 GRFLTGLLKETLSFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLP 277
           GR +T  L + LS R Y+     E  +V ++KEK                    L YV  
Sbjct: 167 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVAL 206

Query: 278 DFQTSFIGYVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILES 337
           DF+       ++   E S    D Q I + +E F  PE  FHP +  +   GI +    S
Sbjct: 207 DFEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNS 266

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGW 397
           +      VR  + GNIV +GG    P  A+R+  E+    P+     +  P  +     W
Sbjct: 267 IMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP-PERKYSVW 325

Query: 398 EVMSQFAKTESYRRARVTRDEYYEHGP 424
              S  A   ++++  +++ EY E GP
Sbjct: 326 IGGSILASLTTFQQMWISKQEYDESGP 352

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 88/386 (22%), Positives = 149/386 (38%), Gaps = 80/386 (20%)

Query: 3   RSPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI--------- 52
           R+PIV+D G+  +K   +    P +   + + +        +N +  +KDI         
Sbjct: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63

Query: 53  -SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
            S +    P E G +  W     +WDY F++        L    G  ++ +E  M     
Sbjct: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRN 118

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   +V+FE+Y+F  ++ +  AV   + +                     +SG+     
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV----- 154

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                             V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 155 ------------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196

Query: 232 SFRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y  N   +   V  +KEK  +VS     D+  A++   L                 
Sbjct: 197 SRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV---------------- 240

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
              EN  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +
Sbjct: 241 ---ENYELP-DGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSAL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 102/442 (23%), Positives = 170/442 (38%), Gaps = 88/442 (19%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK   S  E P    +  +  +  +K       G +++ N  + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW Y F      +   L+  + H ++ +E+ +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFN-----KSLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             +++FE +   +L+ S  AV   +                        SG TT      
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYA-----------------------SGRTT------ 152

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DI GR    FL  LL++T
Sbjct: 153 -------------GCVVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKT 199

Query: 231 LSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
                 +  +  + V  +KEK  +V          AKD H  E            +  NP
Sbjct: 200 TGVSLLSSSEREV-VRIIKEKACYV----------AKDPHIEEQ----------NFSINP 238

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D +TI L  E F  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 239 NYTKFKLP-DGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLF 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYR 410
            N++ +GG   LP F  RL +EL+    +     +  P  +     W   S  +   +++
Sbjct: 298 SNVLLSGGTSILPGFGDRLLSELKSLSDSQTKIKIFAP-PERKYSTWIGGSILSGLSTFK 356

Query: 411 RARVTRDEYYEHGPDWCTKQRF 432
           +  VTR E+ E     C   RF
Sbjct: 357 KLWVTRAEWEEAAD--CIHSRF 376

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 148/387 (38%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           SPIV+D G+  +K   +    P +   + + +        +N    ++DI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FFN        L    G  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++   L   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E +  ++      VR  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSA 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 93/389 (23%), Positives = 152/389 (39%), Gaps = 88/389 (22%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP---FRALNA---LAKDKFGTSYLSNHIKNI-------K 50
           SPIV+D G+  +K   +    P   F ++     L  ++ GT  +S  +K+I       +
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGT--ISTPLKDIMIGDEASE 62

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPE 110
             S +    P E G +  W     +WDY FFN        L    G  ++ +E  M   +
Sbjct: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPVK 117

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFT 170
             +   +V+FE Y+F  ++ +  AV   + +                     +SG+    
Sbjct: 118 NRERMCEVMFERYDFGGVYVAIQAVLALYAQGL-------------------SSGV---- 154

Query: 171 SRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                              V+DSG   T I+PV + +      ++LD+ GR +T  L + 
Sbjct: 155 -------------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195

Query: 231 LSFRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGY 286
           LS R Y  N   +   V  +KEK  +VS     D+  A++   L  EY LPD        
Sbjct: 196 LSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD-------- 247

Query: 287 VRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                          + I +  E F  PE  F P++  +  PG+ E +  ++      VR
Sbjct: 248 --------------GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVR 293

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
             +   IV +GG+   P    RL  EL++
Sbjct: 294 SSLYKAIVLSGGSSMYPGLPSRLERELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 92/387 (23%), Positives = 157/387 (40%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP---FRALNA---LAKDKFGTSYLSNHIKNI------KD 51
           SPIV+D G+  +K   +    P   F ++     L  ++ G+  +S  +K+I       D
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGS--ISTPLKDIMIGEEASD 62

Query: 52  ISS-ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPE 110
           + S +    P E G +  W+    +WDY F+N  +F         G  ++ +E  M   +
Sbjct: 63  VRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLK 117

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFT 170
             +   +V+FE+Y+F  ++ +  AV   + +                     +SG+    
Sbjct: 118 NRELMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV---- 154

Query: 171 SRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                              V+DSG   T I+PV + +      ++LD+ GR +T  L + 
Sbjct: 155 -------------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 195

Query: 231 LSFRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVR 288
           LS R Y  N   +   V  +KEK  +VS     D+  A++   L                
Sbjct: 196 LSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV--------------- 240

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
               EN  LP D + I +  E F  PE  F P++  + +PGI E +  ++      +R  
Sbjct: 241 ----ENYELP-DGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 84.7 bits (208), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 102/442 (23%), Positives = 169/442 (38%), Gaps = 88/442 (19%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----------FRALNALAKDKFGTSYLSNHIKNIKDISS 54
           P+V+DNGS  IK   S  E P           +    +A    G +++ N  + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +T W     +W Y F      +   L+  + H  + +E+ +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFN-----KSLQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             +++FE +   +L+ S  AV   +                        SG TT      
Sbjct: 150 MCELLFESFNVPALYVSVQAVLSLYA-----------------------SGRTT------ 180

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DI GR    FL  LL++T
Sbjct: 181 -------------GCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKT 227

Query: 231 LSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
                 +  +  I V  +KEK  FV+          KD    E   P           NP
Sbjct: 228 TGVSLLSSSEREI-VRTIKEKACFVT----------KDPKLEEQNFP----------MNP 266

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D +TI L  E +  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 267 SFSKFKLP-DGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLY 325

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYR 410
            NI+ +GG   LP F  RL  EL+    +     +  P  +     W   S  +   +++
Sbjct: 326 SNILLSGGTSMLPGFGDRLLKELKSLSGSRTKIKIFAP-PERKYSTWIGGSILSGLSTFK 384

Query: 411 RARVTRDEYYEHGPDWCTKQRF 432
           +  VT+ E+ E  PD C   RF
Sbjct: 385 KLWVTKSEWEEF-PD-CIHSRF 404

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 89/385 (23%), Positives = 148/385 (38%), Gaps = 80/385 (20%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P +   + + +        +   K +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FFN  +     L    G  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQMQ-----LPTTSGGKILLTEPPMNPVKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
            R Y  N   +   V  +KEK  +VS     D+  A++   L                  
Sbjct: 198 RRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV----------------- 240

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
             EN  LP D + I +  E F  PE  F P +  + + GI E +  ++      VR  + 
Sbjct: 241 --ENYELP-DGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLY 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQR 375
             IV +GG+   P    RL  EL++
Sbjct: 298 KAIVLSGGSSMYPGLPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 84.0 bits (206), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 88/387 (22%), Positives = 147/387 (37%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           SPIV+D G+  +K   +    P +   + + +        +N    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF         L       ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPTTSNGKILLTEPPMNPTKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++   L   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E + +++      VR  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSA 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 90/387 (23%), Positives = 147/387 (37%), Gaps = 82/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP---FRALNALAKDKFGTSYLSNHIKNIKDI-------- 52
           SPIV+D G+  +K   +    P   F ++      +       +    IKDI        
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASD 64

Query: 53  --SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPE 110
             S +    P E G +  W     +WD+ FF         L    G  ++ +E  M   +
Sbjct: 65  VRSYLQISYPMENGIIKHWTDMELLWDHAFFEK-----MKLPSTSGGKILLTEPPMNPLK 119

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFT 170
             +   QV+FE+Y+F  ++ +  AV   + +                     +SG+    
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV---- 156

Query: 171 SRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKET 230
                              V+DSG   T I+PV + +      ++LD+ GR +T  L + 
Sbjct: 157 -------------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 197

Query: 231 LSFRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVR 288
           LS R Y  N   +   V  +KEK  +VS    FD+  A++   L                
Sbjct: 198 LSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTTLV--------------- 242

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
               EN  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 243 ----ENYELP-DGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSS 297

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 298 LYKAIVLSGGSSMYPGLPSRLEKELKQ 324

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 105/450 (23%), Positives = 175/450 (38%), Gaps = 104/450 (23%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK   S  E P           +    +A    G  ++ N  + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW++ F      +   L   + H ++A+E+ +   +  + 
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFH-----KSLQLNNIEEHPVLATEAPLNPLKNREA 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             +++FE +   +++ S  AV   +                        SG TT      
Sbjct: 124 MCEMLFETFNVPAVYVSIQAVLSLYA-----------------------SGRTT------ 154

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++D+ GR    FL  LL++T
Sbjct: 155 -------------GCVLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKT 201

Query: 231 LSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
                 +  +  I V  +KEK  +V          A+D       L + QT    Y   P
Sbjct: 202 TGVSLLSSSEREI-VRIIKEKACYV----------ARDP------LTEEQT----YHLTP 240

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
                 LP D + + L +E F  PE  F P++       I E   +S+S +   +RP ++
Sbjct: 241 TSTIFKLP-DGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALL 299

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFG--------WEVMSQ 402
            NIV +GG    P F  RL  EL+         ++S P     +F         W   S 
Sbjct: 300 SNIVLSGGTTMFPGFGDRLLTELR---------NLSEPQTKIKIFAPPERKYSTWIGGSI 350

Query: 403 FAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            +   ++++  VT+ E+ E+ PD C   RF
Sbjct: 351 LSGLSTFKKIWVTKSEWQEN-PD-CVHSRF 378

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/385 (22%), Positives = 146/385 (37%), Gaps = 80/385 (20%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P +   + + +        ++    +KDI          
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY F+         L    G  ++ +E  M      
Sbjct: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      K+LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
            R Y  N   +   V  +KEK  +VS     D+  A++   L                  
Sbjct: 198 RRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV----------------- 240

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
             EN  LP D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  + 
Sbjct: 241 --ENYELP-DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALY 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQR 375
             +V +GG+   P    RL  EL++
Sbjct: 298 RAVVLSGGSSMYPGLPSRLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 125/318 (39%), Gaps = 69/318 (21%)

Query: 60  PHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY F++  +     L    G  ++ +E  M   +  +   +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFYDQMQ-----LPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQN 179
           FE+Y+F  ++ +  AV   + +                     +SG+             
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------------- 100

Query: 180 SDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--N 237
                     V+DSG   T I+PV + +      ++LD+ GR +T  L + LS R Y  N
Sbjct: 101 ----------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297
              +   V  +KEK  +VS     D+  A++   L                    EN  L
Sbjct: 151 RSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV-------------------ENYEL 191

Query: 298 PEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
           P D + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +   IV +G
Sbjct: 192 P-DGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSG 250

Query: 358 GNFNLPNFAQRLAAELQR 375
           G+   P    RL  EL++
Sbjct: 251 GSSMYPGLPSRLEKELKQ 268

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 143/387 (36%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKN-IKDI---------- 52
           +PIV+D G+  +K   +    P     ++       +    H    +KDI          
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF         L    G  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIRNWADMELLWDYAFFEQ-----MKLPTTSGGKVLLTEPPMNPIKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F   + +  AV   + +                     +SG+      
Sbjct: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++   L   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        + I +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 248 ------------GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 147/387 (37%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P +   + + +        ++    +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF         L       ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++  AL   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/388 (21%), Positives = 144/388 (37%), Gaps = 84/388 (21%)

Query: 3   RSPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI--------- 52
           + PIV+D G+  +K   +    P +   + + +        +N    +KDI         
Sbjct: 4   QKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQV 63

Query: 53  -SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
            S +    P E G +  W     +WDY F+         L    G  ++ +E  M     
Sbjct: 64  RSYLQISYPMENGIIRDWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRN 118

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   +V+FE+Y+F  ++    AV   + +                     +SG+     
Sbjct: 119 REQMCEVMFEKYDFGGVYVGIQAVLALYAQGL-------------------SSGV----- 154

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                             V+DSG   T I+PV + +      ++LD+ GR +T  L + L
Sbjct: 155 ------------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLL 196

Query: 232 SFRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYV 287
           S R Y  N   +   V  +KEK  +VS     D+  A++   L  +Y LPD         
Sbjct: 197 SRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD--------- 247

Query: 288 RNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                         + I +  E F  PE  F P +  + +PGI E +  ++      +  
Sbjct: 248 -------------GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVS 294

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQR 375
            +   IV +GG+   P    RL  EL++
Sbjct: 295 TLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 147/387 (37%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P +   + + +        ++    +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF         L       ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++  AL   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 147/387 (37%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P +   + + +        ++    +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF         L+      ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLQSTSNGKILLTEPPMNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++   L   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/385 (22%), Positives = 145/385 (37%), Gaps = 80/385 (20%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNAL-AKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P     ++  +        +N    +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF+        L       ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFDQ-----MKLPTTSNGKILLTEPPMNPVKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
            R Y  N   +   V  +KEK  +VS     D+  A++   L                  
Sbjct: 198 RRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV----------------- 240

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
             EN  LP D + I +  E F  PE  F P +  + + G+ E +  ++      +R  + 
Sbjct: 241 --ENYELP-DGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALY 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQR 375
             IV +GG+   P    RL  EL++
Sbjct: 298 RAIVLSGGSSMYPGLPSRLEKELKQ 322

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 96/434 (22%), Positives = 167/434 (38%), Gaps = 91/434 (20%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFG--------TSYLSNHIKNIKDISSI 55
           P+V+DNGS  +K   S  + P F   + +   + G         +++ N  +  + I  +
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--L 69

Query: 56  TFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHA 115
             R P + G +  W     IWDY F +        LK+   H ++ +E+ +         
Sbjct: 70  QLRHPVDHGVVKNWNDMELIWDYMFKDK-----LKLKDVDEHPVLITEAPLNPVSNRDEM 124

Query: 116 DQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECG 175
             ++FE +   +L+ +  AV   +                        SG  +    +CG
Sbjct: 125 CDLLFESFGVQALYVANPAVLSLYA-----------------------SGKISGCVLDCG 161

Query: 176 SAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
                             G++C+  +PV +G     A+K++D+GGR LT  L+  L  R 
Sbjct: 162 D-----------------GYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQLRK 200

Query: 236 YNMMDETI-----LVNNVKEKCLFVSPVSYFDSFKAK---DKHALEYVLPDFQTSFIGYV 287
              +  T      LV  +KEK  +V+     +  K     D+  L++ LPD         
Sbjct: 201 STGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPD--------- 251

Query: 288 RNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                         + I L+ + F +PE  F P +       I E I +S+S L   +RP
Sbjct: 252 -------------GKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRP 298

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTE 407
            M  +I+ +GG   L  F  RL  EL +         +  P  +     W   S  A+  
Sbjct: 299 QMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAP-PERKYTSWIGGSILAELS 357

Query: 408 SYRRARVTRDEYYE 421
           ++++  VT+ ++ E
Sbjct: 358 TFQKIIVTKSQWQE 371

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 99/441 (22%), Positives = 176/441 (39%), Gaps = 86/441 (19%)

Query: 5   PIVIDNGSYEIKFA------PSTNEMPFRALNALAK---DKF-GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK        P   E     +   +K    +F G +++ N  + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +T W     +W + F      +G  L   + H ++ +E+ +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFE-----KGLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             +++FE +   +++ S  AV   +                        SG TT      
Sbjct: 125 MCELLFETFSVPAVYVSIQAVLSLYA-----------------------SGRTT------ 155

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
                          V+DSG  C+  +PV  G     A++++DI GR ++ LL+  +   
Sbjct: 156 -------------GCVLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKS 202

Query: 235 HYNMM---DETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
               +    E  +V  +KEK  +++     D  K ++K+   Y +   QT F    R P 
Sbjct: 203 TGVSLLSSSEREIVRIIKEKACYIA----LDP-KEEEKN---YTMHGKQTMF----RLP- 249

Query: 292 EENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
                   D + I L +E F  PE  F+P++       + E + ES+  +   +R  +  
Sbjct: 250 --------DGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRR 411
           NIV +GG   +P F  R+  EL+          +  P  +     W   S  +   ++++
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELKLSCEPQTKIKIFAP-PERKYSTWIGGSILSGLSTFKK 360

Query: 412 ARVTRDEYYEHGPDWCTKQRF 432
             VT+ E+ E+    C   RF
Sbjct: 361 IWVTKKEWEEN--PRCVHARF 379

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 85/387 (21%), Positives = 146/387 (37%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K   +    P +   + + +        ++    +KDI          
Sbjct: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF         L       ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++   L   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E +  ++      +R  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 143/387 (36%), Gaps = 84/387 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKN-IKDI---------- 52
           SPIV+D G+  +K   +    P     ++       +     I   +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY F+         L    G  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            V+DSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVR 288
            R Y  N   +   V  +KEK  +VS     D+  A++   L  +Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD---------- 247

Query: 289 NPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
                        + I +  E F  PE  F P +  +   G+ E +  ++      VR  
Sbjct: 248 ------------GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSS 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 85/384 (22%), Positives = 144/384 (37%), Gaps = 80/384 (20%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K   +    P +   + + +        SN    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRS 65

Query: 54  SITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY F++        +    GH ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWADMEQLWDYAFYDQ-----MKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRE 173
              +V+FE+Y+F  ++ +  AV   + +                     +SG+       
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------- 154

Query: 174 CGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
                           V+DSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 155 ----------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSR 198

Query: 234 RHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
           R Y  N   +   V  +KEK  +VS     D+  A +   L                   
Sbjct: 199 RGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV------------------ 240

Query: 292 EENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
            E   LP D + I +  E F  PE  F P +  + + GI E +  ++      +   +  
Sbjct: 241 -ETYELP-DGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYR 298

Query: 352 NIVCTGGNFNLPNFAQRLAAELQR 375
            IV +GG+   P    RL  EL++
Sbjct: 299 AIVLSGGSSMYPGLPSRLEKELKQ 322

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 74/157 (47%), Gaps = 11/157 (7%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILES-------- 337
           ++R PR  +S        + L  E   +PE  F P +  + + GI+E I E+        
Sbjct: 586 FLRGPRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGS 644

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGW 397
                  +   +  N+  TGGN  LP   +R+  E +  LP     +V +   DCAL  W
Sbjct: 645 SRSELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA-NDCALDAW 703

Query: 398 EVMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
             M++ ++T+S +R   VTR EY+E+GPD+  +   G
Sbjct: 704 RGMAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 80/160 (50%), Gaps = 9/160 (5%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S    +   + L  E   +PE FF P +    + G+ E     +L      
Sbjct: 589 FLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGAS 648

Query: 342 PEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWE 398
           P  +  +   M  N+  TGGN  +P   +R+  E    LP + + +V++   D +L  W 
Sbjct: 649 PRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNIS-SDPSLDAWR 707

Query: 399 VMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFGYQNW 437
            M+++A+ E+ Y+++ +++ EY E+GPD+  + + G  N+
Sbjct: 708 GMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/385 (21%), Positives = 142/385 (36%), Gaps = 80/385 (20%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNAL-AKDKFGTSYLSNHIKNIKDI---------- 52
           SPIV+D G+  +K   +    P     ++  +         N    +KD+          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY F+         L    G  ++ +E  +   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
                            VIDSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 155 -----------------VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290
            R Y  N   +   V  +KEK  +VS     D+  A++   L                  
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL------------------ 239

Query: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
             EN  LP D + I +  E F   E  F P +  +   G+ E +  ++      VR  + 
Sbjct: 240 -VENYELP-DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLY 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQR 375
             IV +GG+   P    R+  EL++
Sbjct: 298 KAIVLSGGSSMYPGLPSRIEKELKQ 322

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 72/158 (45%), Gaps = 13/158 (8%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S        + L  E   +PE  F P I+   + GI E     +L+     
Sbjct: 590 FLRGPRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSK 649

Query: 342 P---EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLP--TDWTCHVSVPIGDCALFG 396
           P         MV N+  TGGN  +P    R+  E    LP  T  + H+S    D +L  
Sbjct: 650 PGNLSAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMS---EDPSLDA 706

Query: 397 WEVMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
           W+ M++ A  E+ Y+   VTR EY E+GPD+  + + G
Sbjct: 707 WKGMAKLANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 124/318 (38%), Gaps = 69/318 (21%)

Query: 60  PHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY F+   + +  D   GK   ++ +E  M   +  +   +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFY--EQMKLPDTSNGK---ILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQN 179
           FE+Y F  ++ +  AV   + +                     +SG+             
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQGL-------------------SSGV------------- 100

Query: 180 SDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--N 237
                     V+DSG   T I+PV + +      ++LD+ GR +T  L + LS R Y  N
Sbjct: 101 ----------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297
              +   V  +KEK  +VS     D+  A++   L                    E+  L
Sbjct: 151 RTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV-------------------ESYEL 191

Query: 298 PEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
           P D + I +  E F  PE  F P +  + + G+ E +  ++      +R  +   IV +G
Sbjct: 192 P-DGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSG 250

Query: 358 GNFNLPNFAQRLAAELQR 375
           G+   P    RL  EL++
Sbjct: 251 GSSMYPGLPSRLEKELKQ 268

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 95/432 (21%), Positives = 157/432 (36%), Gaps = 100/432 (23%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP-FRALNALAKDKFGTSYLSNHIKNIKDISSI-------- 55
           P+V+DNGS  IK   S    P     N +   K+    L+N I N  D++ I        
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISN-NDLTYIGNRAQKSR 68

Query: 56  ---TFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
                R P   G +  W+    +W + F +  +   FD      H L+ +E+ +   +  
Sbjct: 69  GLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNR 123

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
               +V FE+++F +++     +  P T S                     SG TT    
Sbjct: 124 DKMCEVFFEKFDFAAVY-----IANPSTLSLYA------------------SGRTTGCVL 160

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
           +CG    S                    +P+ +G     +++++D+GGR +T  L+    
Sbjct: 161 DCGDGYCSS-------------------VPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQ 199

Query: 233 FRHYNMMD-----ETILVNNVKEKCLFVSPVSYFDSFKAK---DKHALEYVLPDFQTSFI 284
            R Y  +      E  +V NVKEK  +VS     D   +    +K   ++ LPD      
Sbjct: 200 IRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD------ 253

Query: 285 GYVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEI 344
                            + + L    F  PE  F P+I  +    + +   ES+S +   
Sbjct: 254 ----------------GKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLE 297

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP--------IGDCALFG 396
           +RP +  +I+  GG+     F  RL  ELQ +        +  P        IG   L G
Sbjct: 298 LRPKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAPPERKYTSWIGGSILTG 357

Query: 397 WEVMSQFAKTES 408
                Q   T++
Sbjct: 358 LSTFKQLWMTKA 369

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 11/157 (7%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLP--- 342
           ++R PR  +S    +   + L  E   +PE  F P +  + + GI+E + E++ M     
Sbjct: 587 FLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGS 645

Query: 343 -----EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGW 397
                  V   M  N+  TGGN  +P    R+  E    LP     ++ V   D A+  W
Sbjct: 646 SRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKV-ASDPAIDAW 704

Query: 398 EVMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
           + M++FA++ + Y+ + VT+ EY E+GPD+  + + G
Sbjct: 705 KGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 95/431 (22%), Positives = 160/431 (37%), Gaps = 82/431 (19%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRALNALAKDK------FGT----SYLSNHIKNIKDISS 54
           P+VIDNGS  +K      E P     +L  D        G     S++ N  + ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  + P E G ++ W+    +W +  F+        L  G  H L+ +E+ +  PE +K 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILFD-----SLQLTSGMEHPLLITEAPLN-PESNKE 122

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
               +F    F++     + V +P   S                     SG TT    +C
Sbjct: 123 KMLEVF----FETFNIPAICVSIPGVLSLYA------------------SGRTTGCVVDC 160

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
           G    S                    +PV +G     ++K++++GG  +T  L+  L   
Sbjct: 161 GEGYCSS-------------------VPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKE 201

Query: 235 HYNMM---DETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
               +    E  LV  +KEK  +VS     +  K ++K   E   P    +         
Sbjct: 202 SGVWLFSSGERELVRTMKEKSCYVS----LNQLKDEEKFTFE---PGKMNT--------- 245

Query: 292 EENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
             N  LP D   + L+   F  PE  F P+I    +P + E  L+S+  +   +RP ++ 
Sbjct: 246 --NFKLP-DGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMS 302

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRR 411
            I  +GG      F  R   ELQ          +  P  +     W   S  A   ++R+
Sbjct: 303 RITLSGGTTMFRGFGDRFLQELQISTCKKSNIRILAP-PERKYTAWIGGSMLAGLTTFRK 361

Query: 412 ARVTRDEYYEH 422
              T+ ++ EH
Sbjct: 362 MLTTKSDWREH 372

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 96/443 (21%), Positives = 179/443 (40%), Gaps = 87/443 (19%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISS--------IT 56
           P+V+DNGS  +K   S +E P      +A        ++  +++   + +        + 
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGLLA 72

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            RRP   G++T W+    +W + F++  +    + + G  H L+ +E+ +   +  +   
Sbjct: 73  LRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGD-HPLLITEAPLNSTKNRETMC 131

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGS 176
           ++++E + FD+L+ +  AV   +                        +G TT    ECG 
Sbjct: 132 EILYETFNFDALYVAHPAVLSLYA-----------------------TGQTTGCVLECGE 168

Query: 177 AQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLL----KETLS 232
             ++ +                   PV +G     +++++DIGGR +T  L    +++  
Sbjct: 169 GYSAST-------------------PVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTG 209

Query: 233 FRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPRE 292
              ++  ++ I V  +KEK  +V               AL+Y   + +  FI    + RE
Sbjct: 210 LSLFSNSEQEI-VRTIKEKANYV---------------ALDYKFEE-EKFFI----HERE 248

Query: 293 ENS--PLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
             S   LP D Q +      +   E  F P++       + E +LES++ +   +R  ++
Sbjct: 249 NTSTVKLP-DGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLL 307

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCA---LFGWEVMSQFAKTE 407
            NIV +GG   L  F QR  +E ++ LP     H  V I   A      W   S  +   
Sbjct: 308 ENIVLSGGTTMLKGFDQRTMSETKKMLPK----HTKVKIRSLAERSYIAWIGGSILSGLY 363

Query: 408 SYRRARVTRDEYYEHGPDWCTKQ 430
            +R   +TR E YE  P    ++
Sbjct: 364 GFRNLWLTR-EMYEEDPSMVHRK 385

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 81/349 (23%), Positives = 133/349 (38%), Gaps = 82/349 (23%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPF----------RALNALAKDKFGTSYLSNHIKNIKD 51
           E + +VIDNGS   K   + ++ P           R    +       SY+ +  ++ + 
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  ISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPEL 111
           I  +T R P E G +T W+    IW + F+N  E R       + H ++ +E+ M     
Sbjct: 64  I--LTLRYPIEHGIVTNWDDMEKIWHHTFYN--ELR----VAPEEHPVLLTEAPMNPKSN 115

Query: 112 SKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS 171
            +   Q++FE +   + + S  AV   ++                       SG TT   
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYS-----------------------SGRTT--- 149

Query: 172 RECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                            +V+DSG   T ++P+  G      + ++D+ GR LT  L + L
Sbjct: 150 ----------------GIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKIL 193

Query: 232 SFRHYNM--MDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
           S R Y+     E  +V ++KEK                    L YV  DF+       ++
Sbjct: 194 SERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQS 233

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESL 338
              E S    D Q I + +E F  PE  FHP +  +   GI +    S+
Sbjct: 234 SSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 13/163 (7%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSM----- 340
           ++R PR  +S    +   + L  E   +PE  F P I  + + GIVE + E+L +     
Sbjct: 586 FLRGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGS 644

Query: 341 ----LPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFG 396
               L EI + +M  NI  TGGN  LP   +R+  E    LP     +V +   D ++  
Sbjct: 645 NRRELSEISK-MMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLA-EDPSMSA 702

Query: 397 WEVMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFGYQNWI 438
           W  M++FA   S Y  + +T+ EY E GP++  +   G   ++
Sbjct: 703 WRGMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 79/165 (47%), Gaps = 10/165 (6%)

Query: 278 DFQTSFIG-YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S +  ++R PR  +S    +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPI 389
            +L+     P  +      MV N++ TGGN  +P   +R+  E    LPT     V++  
Sbjct: 645 ILLKKFGSQPGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMS- 703

Query: 390 GDCALFGWEVMSQFAKT-ESYRRARVTRDEYYEHGPDWCTKQRFG 433
            D +L  W+ M+  A+  E YR+  +++ EY E+GP++  + + G
Sbjct: 704 SDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 9/156 (5%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S        I L  E   +PE  F P +  + + GI E     +L      
Sbjct: 593 FLRGPRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSE 652

Query: 342 PEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWE 398
           P+ +  L   M  NI  TGGN  +P   +R+  E +  LP +   +V++   D     W 
Sbjct: 653 PKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNM-TSDPTFDAWN 711

Query: 399 VMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
            M++ A+ E+ Y++  +++ EY E+GP++  + + G
Sbjct: 712 GMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 77/164 (46%), Gaps = 9/164 (5%)

Query: 278 DFQTSFIG-YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE---- 332
           D++ S +  ++R PR  +S    +   + L  E   +PE  F P +    + G+ E    
Sbjct: 581 DWRNSILHLFLRGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCET 640

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPI 389
            +L+     P  +      M  NI  +GGN  +P    R+  E    LP      V++  
Sbjct: 641 ILLKKFGSSPNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMS- 699

Query: 390 GDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRFG 433
            D  L  W+ M+++AK+E Y ++ +T+ EY E+GP++  + + G
Sbjct: 700 SDPLLDSWKGMAKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 82/430 (19%), Positives = 166/430 (38%), Gaps = 82/430 (19%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP--FRALNALAKDKFG---------TSYLSNHIKNIKDIS 53
           P+VIDNG+  +K     ++ P  F+  N +   KF            Y+ N  +  + + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQH-NIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL- 67

Query: 54  SITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P E G++  W+    +W +   +       +++  + H ++ +E+ +   +  +
Sbjct: 68  -LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNRE 121

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRE 173
           H  +++FE +   ++     AV   ++                        G TT    +
Sbjct: 122 HMCEILFESFNIPAIHVENPAVLALYS-----------------------GGRTTGCVID 158

Query: 174 CGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
           CG    S                    +P+ +G     +++++DIGGR +T    E L F
Sbjct: 159 CGEGYCS-------------------AVPIYEGFALTPSIRRIDIGGREIT----EQLQF 195

Query: 234 RHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREE 293
           +    +  ++  +N KE    +             K    YV  D       Y+ +    
Sbjct: 196 QIRKSVGMSLFSSNEKEIVRTI-------------KERACYVADDISKEEHKYILDSESN 242

Query: 294 NSP--LPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
           +S   LP D +++++ +  F   E  F+P +       + E + ++LS +   +RP++  
Sbjct: 243 SSKFKLP-DGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYK 301

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRR 411
           ++V  GG   LP F  R+  ELQ     D    + +   +     W   S  A   ++++
Sbjct: 302 SLVLNGGTTVLPGFGNRILKELQILTKQDTKLRI-IASPERKYTTWIGGSILAGLSTFQK 360

Query: 412 ARVTRDEYYE 421
             VT+  + E
Sbjct: 361 ILVTKSNWNE 370

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 72/156 (46%), Gaps = 9/156 (5%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S    +   + L  E   +PE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQ 653

Query: 342 PEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWE 398
           P  +      M  N+  TGGN  +P   +R+  E    LP     ++++   D +L  W+
Sbjct: 654 PGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMS-SDPSLDAWK 712

Query: 399 VMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
            M+  A+ E  Y+R  ++R EY E+GPD+  + + G
Sbjct: 713 GMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/384 (22%), Positives = 151/384 (39%), Gaps = 81/384 (21%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFR---ALNALAK-DKFGTS--------YLSNHIKNIKDI 52
           PIVIDNGS  IK   S  + P      L  + K DK   +        Y+ N  ++I+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112
             +  + P   G +  W+    +W +  FN +     +++  + H L+ +E+ +T+ +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFNDT----LNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
               + +FE +   SL+ +  +V   +                        SG TT    
Sbjct: 124 HIMCERLFETFNIPSLYVANPSVLSLYA-----------------------SGNTTGCVV 160

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
           +CG    S +                   P+ +G     +++K+++GGR +T    E L 
Sbjct: 161 DCGDGYCSST-------------------PIYEGFVLPASIRKMEVGGRDIT----EHLQ 197

Query: 233 FRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPRE 292
           F+       ++  +N KE    +             K  + Y+  DF  S   Y     E
Sbjct: 198 FQIRKSSGISLYSSNEKEIVRTI-------------KEKVCYISEDFNKSEESYYLRQDE 244

Query: 293 ENS--PLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350
            +    LP D + + L  E F  PE  F+P++  +    +     ES+S +   +RP + 
Sbjct: 245 MSCKFKLP-DGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLF 303

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQ 374
            NI+ TGG+     F  RL  +LQ
Sbjct: 304 SNILLTGGSTLFKGFGSRLLGDLQ 327

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 76/158 (48%), Gaps = 13/158 (8%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S    +   + L  E   +PE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQ 653

Query: 342 PEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLP--TDWTCHVSVPIGDCALFG 396
           P  +      MV N+  TGGN  +P   +R+  E    LP  T+++ ++S    D +L  
Sbjct: 654 PGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS---SDPSLDA 710

Query: 397 WEVMSQFAKT-ESYRRARVTRDEYYEHGPDWCTKQRFG 433
           W+ M+  A+  E Y++  +++ EY E+GPD+  + + G
Sbjct: 711 WKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 83/180 (46%), Gaps = 14/180 (7%)

Query: 263 SFKAKDKHALEYVLPDFQTSFIG-YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPE 321
           SF  +D    +Y   D++ S +  ++R PR  N         + L  E    PE  F P 
Sbjct: 567 SFTEEDTLDAQY---DWRNSVLHLFLRGPRPHNGEDVHQQHQLHLNIERIRAPEVIFQPS 623

Query: 322 ISQITKPGIVE---AIL-----ESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373
           +  + + GI E    IL        S L +     M  NI  TGGN  +PN  +R+  E 
Sbjct: 624 MGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD-MASNIFITGGNTKIPNLRERIVNEF 682

Query: 374 QRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRFG 433
              LP +   +V+    + +L  W+ M++FA++++Y    VT+ EY E GP++  + + G
Sbjct: 683 TGFLPVNTPLNVNY-AQNVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 88/238 (36%), Gaps = 51/238 (21%)

Query: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNAL------AKDKFGTSYLSNHIKNIKDISSITF 57
           +PI +D GSYE++   ++ + P              K +   +++ N       + S + 
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS- 98

Query: 58  RRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
           R P++   +T WE    +  Y F +     G    +G  + ++ +E   T+     +  Q
Sbjct: 99  RSPYDGSLITNWEYMEDMLSYTFHH----LGVQPNDGISNPMILTEKMATVQAQRSNWYQ 154

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSA 177
           ++FE Y        P   F                            GI    S    ++
Sbjct: 155 LLFECYGI------PQVTF----------------------------GIDGLFSFYANNS 180

Query: 178 QNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
            +S        L+I+SG   T IIPV+KG       K++D GG      LK  LS ++
Sbjct: 181 PDSTG------LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 71/156 (45%), Gaps = 9/156 (5%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S  P     I +  E   +PE  F P I    + GI E      L   +  
Sbjct: 599 FLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSS 658

Query: 342 PEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWE 398
           P  +  +   M+ N+  TGG+  LP   +R+  E    LP      +++   D +L  W+
Sbjct: 659 PRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINIS-NDPSLDTWK 717

Query: 399 VMSQFAKTESY-RRARVTRDEYYEHGPDWCTKQRFG 433
            M++ A    Y ++ +VT+ +Y E+GP++  +   G
Sbjct: 718 GMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 86/239 (35%), Gaps = 52/239 (21%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRAL-NALAKDK----FGTSYLSNHIKNIKDISSITFRR 59
           PI ID GSY +K   +   +P     N L + +      T     +  N+     I  +R
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPLRIQAKR 97

Query: 60  PHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGK-GHHLVASESCMTLPELSKHADQV 118
           P++   +  WE    I+DY   +     G     G   + ++ +E    L     +  Q+
Sbjct: 98  PYDGLFIANWEYAEEIFDYTLHH----LGVQTTNGSISNPIILTEKMACLQSQRANWYQL 153

Query: 119 IFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTS--RECGS 176
           +FE       F  P A F                            G+ +  +    C +
Sbjct: 154 LFE------TFDVPSATF----------------------------GLDSLYAFYNNCAN 179

Query: 177 AQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
              SD       LVI+ G   T I+P+++G       K+++ GGR  T  L   L+ ++
Sbjct: 180 PFESDG------LVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 79/166 (47%), Gaps = 12/166 (7%)

Query: 278 DFQTSFIG-YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILE 336
           D++ S +  ++R PR  +S    +   + L  E   +PE  F P +    + GI E + E
Sbjct: 585 DWRNSLLHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSE 643

Query: 337 SLSMLP--------EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           ++ M                MV NI+ TGGN  +P   +R+  E    LP      V++ 
Sbjct: 644 TILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS 703

Query: 389 IGDCALFGWEVMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
             + +L  W  M+  A+ ++ Y++  ++++EY E+GPD+  + + G
Sbjct: 704 -SNPSLDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 80/387 (20%), Positives = 150/387 (38%), Gaps = 89/387 (22%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK   S  E P    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  W+    IW Y      + +  +      H L+ +E+ M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIE-----EHPLLITEAPMNPLKNREM 126

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             QV+FE +   +++ S  AV   +                        SG TT    +C
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYA-----------------------SGRTTGCVVDC 163

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
           G    S                    +P+  G     ++ ++DIGG    G + E L F+
Sbjct: 164 GEGYCSS-------------------VPIYDGFALPASIMRMDIGG----GDITEQLQFQ 200

Query: 235 HYNMMDETI-------LVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYV 287
                  ++       +V  +KEK  +++     D+ K +DK+       D  ++F    
Sbjct: 201 IRKSAGVSLFSSSEREIVRTIKEKVCYLAK----DAKKEEDKYL--QGTQDLISAF---- 250

Query: 288 RNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
                    LP D ++I + ++ +  PE  F P+I      G+    ++S+  +   +R 
Sbjct: 251 --------KLP-DGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRK 301

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQ 374
            ++ +++ +GG   L  F  R+  +L+
Sbjct: 302 NLLSSVILSGGTTTLKGFGDRMLHDLE 328

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 74/157 (47%), Gaps = 11/157 (7%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILES--LSMLPE 343
           ++R PR  +S    +   + +  E   +PE  F P I  + + G+VE + E+  L     
Sbjct: 591 FLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVE-LCETVLLKKFDS 649

Query: 344 IVRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGW 397
             R L      M  N+  TGGN  LP   +R+  E    LP      V++   D +L  W
Sbjct: 650 SRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTL-AKDPSLSAW 708

Query: 398 EVMSQFAKT-ESYRRARVTRDEYYEHGPDWCTKQRFG 433
           + M++FA    SY+ + +T+ EY E+GP++  +   G
Sbjct: 709 KGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 70/157 (44%), Gaps = 11/157 (7%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE--------AILES 337
           ++R PR  +S    +   + L  E   +PE  F P ++ + + G+ E            +
Sbjct: 586 FLRGPRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGST 645

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGW 397
            S L E  + L   N+  TGGN  LP   +R+  E    LP     +V +   D A+  W
Sbjct: 646 RSQLSEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMA-SDSAVDAW 703

Query: 398 EVMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
             M++ ++  S Y+ + +TR EY E G D+  +   G
Sbjct: 704 RGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETLSFRHYNMMDETIL 244
           LVI+SG   T +IPV+ G       K+++ GGR    +L+ LL   L + ++ +   T  
Sbjct: 183 LVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 245 VNNVKEKCLFVSPVSYFDSFK 265
             ++ E   +VS V Y D  +
Sbjct: 241 FQSLYEDFCYVS-VDYQDEIR 260

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 114/258 (44%), Gaps = 46/258 (17%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     +
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F    +   ++++ + + +                   + + +
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKERT-----------------TKKVVDV 312

Query: 307 TDELFTIPETFFHPEISQ---ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
             E F  PE FF+PEI+    +T   +V  + E++   P  VR  +  NIV +GG+    
Sbjct: 313 GYERFLAPEIFFNPEIASSDFLTPLPVV--VDETIQACPIDVRKGLYNNIVLSGGSTMFK 370

Query: 364 NFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKTE 407
           +F +RL  +L+           +L    +  V V +       +   FG  +++Q  + +
Sbjct: 371 DFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSLLAQTGEFK 430

Query: 408 SYRRARVTRDEYYEHGPD 425
           SY     T+ +Y E+GPD
Sbjct: 431 SYCH---TKQDYEEYGPD 445

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/401 (21%), Positives = 157/401 (39%), Gaps = 93/401 (23%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRAL-----------NALAKDKFGTSYLSNHIKNIKDIS 53
           PIVIDNGS  IK   S  E P +AL             + +   G +++ N  + ++ + 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  SITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y      + +  +      H L+ +E+ M   +  +
Sbjct: 72  -LRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIE-----EHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRE 173
              QV+FE +   +L+ S  AV   +                        SG TT    +
Sbjct: 126 VMAQVLFETFNLPALYISNPAVLSLYA-----------------------SGRTTGCVVD 162

Query: 174 CGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
           CG                  G+  T  +P+  G     ++ ++DIGGR +T    E L F
Sbjct: 163 CG-----------------EGYCST--VPIYDGFALPASIMRMDIGGRDIT----EQLQF 199

Query: 234 RHYNMM-------DETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGY 286
           +             E  +V  +KEK  +++     +  K +D++   +   D  + F   
Sbjct: 200 QLRKSAGISLFSSSELEVVRMIKEKVCYLAK----NIKKEEDRYLQGH--HDLGSVF--- 250

Query: 287 VRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                     LP D + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R
Sbjct: 251 ---------KLP-DGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
             ++ +I+ +GG   L  F +R+  +L+    +  TC + +
Sbjct: 301 KTLLSSIILSGGTTTLRGFGERMLHDLEAL--SKGTCKIKI 339

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/388 (20%), Positives = 156/388 (40%), Gaps = 91/388 (23%)

Query: 5   PIVIDNGSYEIKFAPSTNEMPFRALN--ALAKDKF---------GTSYLSNHIKNIKDIS 53
           P+VIDNGS  IK   S  E P +AL    +   K+         G +++ N+ + ++ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL- 71

Query: 54  SITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W+    IW Y      + +         H L+ +E+ M   +  +
Sbjct: 72  -LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIG-----EHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRE 173
              QV+FE ++  +L+ S  AV   +                        SG TT    +
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYA-----------------------SGRTTGCVVD 162

Query: 174 CGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
           CG                  G+  T  +P+  G     ++ ++DIGG  +T    E L F
Sbjct: 163 CGE-----------------GYCST--VPIYDGFALPASMMRMDIGGADIT----EQLQF 199

Query: 234 RHYNMMDETI-------LVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGY 286
           +       ++       +V  +KEK  +++      + K +++  L+    D  ++F   
Sbjct: 200 QLRKSAGVSLFSSSEREIVRTMKEKVCYLAK-----NIKKEEEKYLQGT-QDLISTF--- 250

Query: 287 VRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                     LP D + I + ++ +  PE  F P+I  +   G+ +  ++S+  +   +R
Sbjct: 251 ---------KLP-DGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQ 374
             ++ +I+ +GG   L  F  R+  +L+
Sbjct: 301 KPLLSSIILSGGTTTLKGFGDRMLWDLE 328

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 113/259 (43%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     +
Sbjct: 209 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERI 266

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F    +   +YV+ + + +                   + + +
Sbjct: 267 KQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKT-----------------QKKVVDV 309

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+   +++   P  VR  +  NIV +GG+   
Sbjct: 310 GYERFLAPEIFFNPEIASSDFLTPLPTIVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 366

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+            L    +  V V +       +   FG  +++Q A+ 
Sbjct: 367 KDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 426

Query: 407 ESYRRARVTRDEYYEHGPD 425
           +SY     T+ +Y E+GP+
Sbjct: 427 KSYCH---TKKDYEEYGPE 442

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 116/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  +++ L  R     D ++     +
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F   D+ A         + F  +V   +E+        + + +
Sbjct: 268 KQEYCYVCPDIVKEFNKF---DRDA---------SKFAQFVVESQEKTR-----KKIVDV 310

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   E++   P  VR  +  NIV +GG+   
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---ETIQACPIDVRKGLYNNIVLSGGSTMF 367

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +++            L    +  V V +       +   FG  +++Q A+ 
Sbjct: 368 KDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 427

Query: 407 ESYRRARVTRDEYYEHGPD 425
           +SY     T+ +Y E+GP+
Sbjct: 428 KSYCH---TKKDYDEYGPE 443

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/430 (19%), Positives = 166/430 (38%), Gaps = 92/430 (21%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP-----FRALNALAKDKFGT-----SYLSNHIKNIKDISS 54
           P+++DNGS  IK   + ++ P         N LA+    T     +Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +    P+    +  W+    +WDY   N       ++++ + H +V + S  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNK-----LEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 115 ADQVIFEEYEFDSLF--KSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172
             +V+FE++   +++  + P+                               G TT  S 
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGL-------------------------GRTTGCSV 159

Query: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232
            CG                        I  V+ G+    + +  + GG  +T  + + L 
Sbjct: 160 SCG-------------------HRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLR 200

Query: 233 FRH---YNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRN 289
             H    N  +   L+ ++KE+C  +S   +++  +A       Y L   +TS   Y   
Sbjct: 201 HNHPKLENGQNGIELIRSIKERCCVLSK-DFYNEIRA-------YELITSKTSNNKY--- 249

Query: 290 PREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349
                  LP D   I +  E F  PE  F+P+    ++  + + I+ S+S    + R  +
Sbjct: 250 ------RLP-DGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQL 302

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP--------IGDCALFGWEVMS 401
           + +IV +GG+  +  F +RL  E+++++  +    ++ P        IG   L G   M 
Sbjct: 303 LESIVLSGGSSLIKGFGERLTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMK 362

Query: 402 QFAKTESYRR 411
              K++S  R
Sbjct: 363 LLWKSKSAYR 372

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 114/262 (43%), Gaps = 54/262 (20%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     +
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F  + +   ++++ +                    +D  T  +
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN--------------------QDKTTKKV 311

Query: 307 TD---ELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGN 359
            D   E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+
Sbjct: 312 IDIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGS 368

Query: 360 FNLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQF 403
               +F++RL  +++            L    +  V V +       +   FG  +++Q 
Sbjct: 369 TMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQT 428

Query: 404 AKTESYRRARVTRDEYYEHGPD 425
           A+ + Y     T+ +Y EHGP+
Sbjct: 429 AEFKGYCH---TKKDYEEHGPE 447

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 115/258 (44%), Gaps = 48/258 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     +
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F   D+ A         T F  ++   +E+        + + +
Sbjct: 269 KQEYCYVCPDIVKEFNKF---DRDA---------TKFAQFIVENKEKT-----QKKVVDV 311

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 312 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 368

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+            L    +  V V +       +   FG  +++Q A+ 
Sbjct: 369 KDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAEF 428

Query: 407 ESYRRARVTRDEYYEHGP 424
           +SY     T+ +Y E+GP
Sbjct: 429 KSYCH---TKKDYEEYGP 443

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 95/431 (22%), Positives = 155/431 (35%), Gaps = 100/431 (23%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----FRALNALAKDKF-------GTSYLSNHIKNIKDIS 53
           PIVIDNG+  IK   +    P    +  +     DK          S++ N  +  + I 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 54  SITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y F +        L+    H ++ +E  +      +
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQYVFDDT-----LYLENLNEHPILITEPPLNNMANRQ 126

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRE 173
              + +FE + F +++ S   V   +                        SG TT  + +
Sbjct: 127 KMCEALFEIFGFPAVYISVSPVLSLYA-----------------------SGQTTGCAVD 163

Query: 174 CGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLT-----GLLK 228
           CG                     CT  IPV  G     +VKK+DIGG  +T      +LK
Sbjct: 164 CGDGY------------------CT-SIPVYNGFSLASSVKKIDIGGCDITEQLQFSILK 204

Query: 229 ETLSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFK---AKDKHALEYVLPDFQTSFIG 285
            T  F + +   E  +V  +KEK  +++     ++ K    ++K A ++ LP        
Sbjct: 205 NTGLFMYSS--SEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLP-------- 254

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345
                         D + + ++   +T  E  F PE+       + E   +S+  +   +
Sbjct: 255 --------------DGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDL 300

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP--------IGDCALFGW 397
           R  +  NIV +GG    P F  RL  ELQ     D    +  P        IG   L G 
Sbjct: 301 RLPLYSNIVLSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAPPERKYTSWIGGSILSGL 360

Query: 398 EVMSQFAKTES 408
              S+   T+S
Sbjct: 361 STFSKIWVTKS 371

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 82/383 (21%), Positives = 148/383 (38%), Gaps = 81/383 (21%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK   S  E P    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           + +  P E G +  W+    IW +      + +  +      H L+ +E+ M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILNEVLQLQNIE-----EHPLLITEAPMNPLKNREV 126

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             QV+FE +   +L+ S  AV   +                        SG TT    +C
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYA-----------------------SGRTTGCVIDC 163

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
           G                  G+  T  +P+  G     ++ ++DIGGR +T  L+  L   
Sbjct: 164 G-----------------EGYCST--VPIYDGFALPASMMRMDIGGRDITKQLQFQLRKS 204

Query: 235 HYNMM---DETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
               +    E  +V  +KEK      V Y  +   K+++       D  + F        
Sbjct: 205 AGVSLFSSSEREIVRTIKEK------VCYLATDIKKEENTYMQESQDLTSVF-------- 250

Query: 292 EENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
                LP D + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R  ++ 
Sbjct: 251 ----KLP-DGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLS 305

Query: 352 NIVCTGGNFNLPNFAQRLAAELQ 374
           +I+ +GG   L  F  R+  +L+
Sbjct: 306 SIILSGGTTTLRGFGDRMLHDLE 328

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 114/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     +
Sbjct: 218 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 275

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F        ++++ + + +                   + + +
Sbjct: 276 KQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQEQT-----------------RKKVVDV 318

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+  +++    P  VR  +  NIV +GG+   
Sbjct: 319 GYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQA---CPIDVRKGLYNNIVLSGGSTMF 375

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+           +L    +  V V +       +   FG  +++Q A+ 
Sbjct: 376 KDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 435

Query: 407 ESYRRARVTRDEYYEHGPD 425
           +SY     T+ +Y E+GP+
Sbjct: 436 KSYCH---TKKDYEEYGPE 451

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 114/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     +
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 269

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F        ++++ + +++                   + + +
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST-----------------KKKIVDV 312

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 313 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 369

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+            L    +  V V +       +   FG  +++Q A+ 
Sbjct: 370 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEF 429

Query: 407 ESYRRARVTRDEYYEHGPD 425
           +SY     T+ +Y E+GP+
Sbjct: 430 KSYCH---TKQDYEEYGPE 445

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 100/446 (22%), Positives = 169/446 (37%), Gaps = 92/446 (20%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP------------FRALNA--LAKDKFGTSYLSNHIKNIK 50
           P+V+DNGS  IK   S  E P            +  + A  LA D   +  + N  + ++
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKMR 67

Query: 51  DISSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPE 110
            +  + +  P E G +  W     +W + F+N        L   + H ++ +E+ +   +
Sbjct: 68  GLLKLHY--PLEHGVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLNPMK 120

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFT 170
                 +++FE       F SP AV+V                  +A +     G TT  
Sbjct: 121 NRNKMCEMLFET------FGSP-AVYVSI----------------QAVLALYAGGRTT-- 155

Query: 171 SRECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGL 226
                              VID G  C   +PV  G     A++++D+ GR    FL  L
Sbjct: 156 -----------------GCVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLL 198

Query: 227 LKETLSFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGY 286
           L+++      +  +  I V  +KEK  FV          A D       + + + ++ G 
Sbjct: 199 LRKSSGVTLSSSSEREI-VRMIKEKACFV----------ATD-------VGNEEQNYEGA 240

Query: 287 VRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
                E    LP D + + L  E F  PE  F P +       I E   +S+S +   +R
Sbjct: 241 NSAELETRFKLP-DGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLR 299

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKT 406
             +  +IV +GG+     F  RL +E+++    +    +  P  +     W   S  A  
Sbjct: 300 SSLYSSIVLSGGSTMFSGFGDRLLSEIRKTSEPNTKIKIFAP-PERKYSTWIGGSILAGL 358

Query: 407 ESYRRARVTRDEYYEHGPDWCTKQRF 432
            ++ +  VTR E+ E+    C   RF
Sbjct: 359 STFEKLWVTRAEWQEN--PQCIHSRF 382

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 109/261 (41%), Gaps = 52/261 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNVK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R      ET       
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER-----GETDTSLRTA 259

Query: 250 EKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ-----TI 304
           E+                 K    YV PD    F  + RNP +    + E+ +      +
Sbjct: 260 ERI----------------KQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIV 303

Query: 305 ALTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            +  E F  PE FF+PEI+        P IV+  +++    P  VR  +  NIV +GG+ 
Sbjct: 304 DVGYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYNNIVLSGGST 360

Query: 361 NLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFA 404
              +F +RL  +++            L    +  V V +       +   FG  +++Q A
Sbjct: 361 MFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTA 420

Query: 405 KTESYRRARVTRDEYYEHGPD 425
           + +SY     T+ +Y E+GP+
Sbjct: 421 EFKSYCH---TKKDYEEYGPE 438

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 108/261 (41%), Gaps = 52/261 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNVK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++      
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRT---- 258

Query: 250 EKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ-----TI 304
                            K K    YV PD    F  + R+P +    + E+ +      +
Sbjct: 259 ---------------AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAV 303

Query: 305 ALTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGST 360

Query: 361 NLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFA 404
              +F +RL  +L+            L    +  V V +       +   FG  +++Q A
Sbjct: 361 MFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA 420

Query: 405 KTESYRRARVTRDEYYEHGPD 425
           + + Y     T+ +Y E+GP+
Sbjct: 421 EFKGYCH---TKKDYEEYGPE 438

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 114/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     +
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F    +   ++V+ + +++                   + + +
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST-----------------RKKIVDV 310

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 367

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+            L    +  V+V +       +   FG  +++Q A+ 
Sbjct: 368 KDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEF 427

Query: 407 ESYRRARVTRDEYYEHGPD 425
           + Y     T+ +Y E+GP+
Sbjct: 428 KGYCH---TKKDYDEYGPE 443

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 108/261 (41%), Gaps = 52/261 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNVK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++      
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRT---- 258

Query: 250 EKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ-----TI 304
                            K K    YV PD    F  + R+P +    + E+ +      +
Sbjct: 259 ---------------AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 305 ALTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGST 360

Query: 361 NLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFA 404
              +F +RL  +L+            L    +  V V +       +   FG  +++Q A
Sbjct: 361 MFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA 420

Query: 405 KTESYRRARVTRDEYYEHGPD 425
           + + Y     T+ +Y E+GP+
Sbjct: 421 EFKGYCH---TKKDYEEYGPE 438

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 94/441 (21%), Positives = 164/441 (37%), Gaps = 82/441 (18%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----FRALNALAKDKFGTSYLSNHIKNI-----KDISSI 55
           P+V+DNGS  IK   S  E P    +  +     DK     LS+  + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHA 115
             + P E G +  W     +W + F++        L     H ++ +E+ +   E     
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYS-----SLKLNNIGDHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECG 175
            ++++E +   +++ S  AV   +                         G TT       
Sbjct: 126 CEMLYETFNVPAVYVSIQAVLALYA-----------------------GGRTT------- 155

Query: 176 SAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGR----FLTGLLKETL 231
                         VID G  C   +PV  G     A++++D+ GR    FL  LL++++
Sbjct: 156 ------------GCVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSI 203

Query: 232 SFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
                +  +  I V  +KEK  +V+P    +  K       E +     T F        
Sbjct: 204 GVTLLSSSEREI-VRMIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKF-------- 249

Query: 292 EENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVG 351
                LP D + ++L  E F  PE  F P++       I +   +S+S +   +R  +  
Sbjct: 250 ----KLP-DGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYS 304

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRR 411
           ++V +GG+     F  RL  EL+ +   +    +  P  +     W   S  A   ++ +
Sbjct: 305 SLVLSGGSTLFAGFGDRLLNELRSRCEPNVKIKIFAP-PERKYSVWIGGSILAGLSTFEK 363

Query: 412 ARVTRDEYYEHGPDWCTKQRF 432
             VTR E+ E+    C   RF
Sbjct: 364 IWVTRSEWQEN--PQCVHSRF 382

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 108/261 (41%), Gaps = 52/261 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNVK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++      
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRT---- 258

Query: 250 EKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ-----TI 304
                            K K    YV PD    F  + R+P +    + E+ +      +
Sbjct: 259 ---------------AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 305 ALTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPMVVD---QTIQACPIDVRKGLYNNIVLSGGST 360

Query: 361 NLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFA 404
              +F +RL  +L+            L    +  V V +       +   FG  +++Q A
Sbjct: 361 MFKDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA 420

Query: 405 KTESYRRARVTRDEYYEHGPD 425
           + + Y     T+ +Y E+GP+
Sbjct: 421 EFKGYCH---TKKDYEEYGPE 438

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 73/156 (46%), Gaps = 9/156 (5%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE----AILESLSML 341
           ++R PR  +S    +   + +  E   +PE  F P +    + GI+E     +L+     
Sbjct: 595 FLRGPRPFDSENSHEQHQMHMNIERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSK 654

Query: 342 PEIVR---PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWE 398
           P  +      M  N+  TGG+  LP    R+  E    LP D    V++     +L  W+
Sbjct: 655 PSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVKEFTSFLPNDAKFSVNIS-KHPSLDAWK 713

Query: 399 VMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
            M++F+  ++ ++ + +++ EY E+GP++  + R G
Sbjct: 714 GMAKFSSDDADFKSSLISKKEYEEYGPEYIKEHRLG 749

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 112/260 (43%), Gaps = 50/260 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     +
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F        ++++                EN    +  + + +
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFII----------------ENQGKTQK-KIVDV 314

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+  +++    P  VR  +  NIV +GG+   
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYSNIVLSGGSTMF 371

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSVPIG-----------------DCALFGWEVMSQFAK 405
            +F +RL  +L R +  D      +  G                 +   FG  +++Q A+
Sbjct: 372 KDFGRRLQRDL-RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAE 430

Query: 406 TESYRRARVTRDEYYEHGPD 425
            +SY     T+ +Y E+GP+
Sbjct: 431 FKSYCH---TKRDYEEYGPE 447

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 111/256 (43%), Gaps = 42/256 (16%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R    +D ++     +
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERGEVDTSLRTAERI 274

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F    +   +YV+ +   +                   + + +
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDAEKFAQYVVENQDKT-----------------RQKVVDI 317

Query: 307 TDELFTIPETFFHPEISQITKPGIVEAIL-ESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365
             E F  PE FF+PEI+       +  +L +++   P  VR  +  NIV +GG+    +F
Sbjct: 318 GYERFLAPEIFFNPEIASSDFLTPLPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 377

Query: 366 AQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKTESY 409
            +RL  +L+           +L    +  V V +       +   FG  +++Q  + + Y
Sbjct: 378 GRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGY 437

Query: 410 RRARVTRDEYYEHGPD 425
                T+ +Y E+GP+
Sbjct: 438 CH---TKKDYEEYGPE 450

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 109/261 (41%), Gaps = 52/261 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNVK 249
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D T+      
Sbjct: 207 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRT---- 260

Query: 250 EKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ-----TI 304
                            + K    YV  D    F  + R+P++    + E+++      I
Sbjct: 261 ---------------AERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRKVI 305

Query: 305 ALTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            +  E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+ 
Sbjct: 306 DVGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGST 362

Query: 361 NLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFA 404
              +F +RL  +L+            L    +  V V +       +   FG  +++Q A
Sbjct: 363 MFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTA 422

Query: 405 KTESYRRARVTRDEYYEHGPD 425
           + +SY     T+ +Y E GP+
Sbjct: 423 EFKSYCH---TKQDYEEIGPE 440

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 116/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  +++ L  R     D ++     +
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERI 274

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F    +   ++V+   + +                   + + +
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDSEKFAQFVVESQEKT-----------------RRKVVDV 317

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+  +++    P  VR  +  NIV +GG+   
Sbjct: 318 GCERFMAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYNNIVLSGGSTMF 374

Query: 363 PNFAQRLAAELQ-----RQLPTDW-----TCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+     R + +++     +  V V +       +   FG  +++Q A+ 
Sbjct: 375 KDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 434

Query: 407 ESYRRARVTRDEYYEHGPD 425
           +SY     T+ +Y E GP+
Sbjct: 435 KSYCH---TKKDYEEIGPE 450

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 114/259 (44%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     +
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F  + +   ++++ +   +                   + + +
Sbjct: 274 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKT-----------------KQKVVDI 316

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+  +++    P  VR  +  NIV +GG+   
Sbjct: 317 GYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQA---CPIDVRKGLYNNIVLSGGSTMF 373

Query: 363 PNFAQRLAAELQ-----RQLPTDWTCHVSVPIGDCAL-----------FGWEVMSQFAKT 406
            +F++RL  +++     R +  +    V     D  +           FG  +++Q A+ 
Sbjct: 374 KDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 433

Query: 407 ESYRRARVTRDEYYEHGPD 425
           +SY     T+ +Y E+GP+
Sbjct: 434 KSYCH---TKKDYEEYGPE 449

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 111/259 (42%), Gaps = 48/259 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D ++     +
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V P  V  F+ F        ++V+ + + +                   + + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKT-----------------RRKVVDI 305

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDCALFGWEVMSQFAKT 406
            +F +RL  +L+            L    +  V V +       +   FG  +++Q A+ 
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 407 ESYRRARVTRDEYYEHGPD 425
           + Y     T+ +Y E+GP+
Sbjct: 423 KGYCH---TKKDYEEYGPE 438

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 87/435 (20%), Positives = 162/435 (37%), Gaps = 96/435 (22%)

Query: 5   PIVIDNGSYEIKFAPSTNEMP----FRALNALAKDKFGTS------YLSNHIKNIKDISS 54
           PIV+DNGS  +K     ++ P    +  +     DK          ++ N  +  + +  
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL-- 70

Query: 55  ITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  WE    +WD+ F +    +  +L E   H LV +E+ +      + 
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDHIFKDC--LKVSNLGE---HPLVVTEAPLNPKPNREK 125

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
             + +FE +   +L+ +  AV   +                        SG TT    E 
Sbjct: 126 MCETLFESFNIPALYIANPAVLSLYA-----------------------SGRTTGCVVEA 162

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR 234
           G    S                    +P+ +G     +++++DIGGR +T  L+  L  R
Sbjct: 163 GDGYCSS-------------------VPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLR 201

Query: 235 HYNMM-----DETILVNNVKEKCLFVSPVSYFDSFK---AKDKHALEYVLPDFQTSFIGY 286
               M      E  +V  +KE   ++      +  K    ++K ++ + LPD +   IG 
Sbjct: 202 KSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGP 261

Query: 287 VRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVR 346
            R                      F  PE  F+P +       + + I++S+S +   +R
Sbjct: 262 GR----------------------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLR 299

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGD--CALFGWEVMSQFA 404
             ++ NI  +GG+     F  RL  EL   +       +  P      A  G  +++  +
Sbjct: 300 SKLLNNITLSGGSTMFQGFCDRLITELDFSVDKTTKVRILAPPERKYSAFIGGSILANLS 359

Query: 405 KTESYRRARVTRDEY 419
              ++R   VT+D++
Sbjct: 360 ---TFRNMWVTKDQW 371

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 87/205 (42%), Gaps = 18/205 (8%)

Query: 241 ETILVNNVKEKCLFVSPVSYFD-SFKAKDKHALEYVLPDFQTSFIG-YVRNPREENSPLP 298
           E ++ +  KE       +  FD +F  +D    +Y   D++ S +  ++R PR  +    
Sbjct: 544 EELIEDQYKEIVALERVLLEFDPNFTEEDTLDAQY---DWRNSVLHLFLRGPRPHDGESI 600

Query: 299 EDAQTIALTDELFTIPETFFHPEIS---QITKPGIVEAILESLSMLPEIVRPL------M 349
                + +  E   +PE  F P +    Q   P + E +L  L       R L      M
Sbjct: 601 HHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSM 658

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAK-TES 408
             N+  TGGN  LP   +R+  E    LP+     +     D +L  W  M++ A+ TE 
Sbjct: 659 AQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRKS-QDPSLDAWRGMAKLAQNTED 717

Query: 409 YRRARVTRDEYYEHGPDWCTKQRFG 433
           ++   +T+ EY E+GP++  +   G
Sbjct: 718 FKHGYITKQEYLEYGPEYIKEHNLG 742

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 95/453 (20%), Positives = 173/453 (38%), Gaps = 105/453 (23%)

Query: 10  NGSYEIKFAPSTNEMPFRAL--------NALAKDKFGTSYLSNHIKNIKDIS----SITF 57
           NGS    F  ST+   F  L        N LA  K GT  L  +I N   ++    S + 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLA-GKRGTEDLDFYIGNEALVAAQSPSYSL 121

Query: 58  RRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
             P   GQ+  W+     W+   F       +   E + H+ + +E  +  PE  +   +
Sbjct: 122 SYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENREQVAE 175

Query: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKL--KTISGKDEEADVVTSNSGITTFTSRECG 175
           + FE +    L+ +  AV          K+  ++++G                       
Sbjct: 176 IFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT---------------------- 213

Query: 176 SAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
                         VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R 
Sbjct: 214 --------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RE 257

Query: 236 YNMMDETI-LVNNVKEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPRE 292
               D ++     +K++  +V P  V  F+ F  + +   ++++   + +          
Sbjct: 258 RGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKT---------- 307

Query: 293 ENSPLPEDAQTIALTDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPL 348
                    + + +  E F  PE FF+PEI+        P +V+   +++   P  VR  
Sbjct: 308 -------KQKVVDVGYERFLAPEIFFNPEIASSDYLTPLPTVVD---QTIQACPIDVRKG 357

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQ----------RQLPTDWTCHVSVPI------GDC 392
           +  NIV +GG+    +F++RL  +++           ++    +  V V +       + 
Sbjct: 358 LYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQRNA 417

Query: 393 ALFGWEVMSQFAKTESYRRARVTRDEYYEHGPD 425
             FG  +++Q A+   Y     T+ +Y E GP+
Sbjct: 418 VWFGGSLLAQTAEFRGYCH---TKRDYEEIGPE 447

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 86/192 (44%), Gaps = 29/192 (15%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI-LVNNV 248
           VIDSG   T +IPV +G     A+K + I GR +T  ++  L  R     D T+     +
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 258

Query: 249 KEKCLFVSP--VSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIAL 306
           K++  +V    V  F+ F    +   ++++                ENS      + I +
Sbjct: 259 KQEYCYVCSDIVKEFNKFDRDSEKFAQFIV----------------ENSEKTR-RKVIDV 301

Query: 307 TDELFTIPETFFHPEISQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEI+        P IV+   +++   P  VR  +  NIV +GG+   
Sbjct: 302 GYERFLAPEIFFNPEIASSDFLTPLPTIVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 358

Query: 363 PNFAQRLAAELQ 374
            +F +RL  +L+
Sbjct: 359 KDFGRRLQRDLK 370

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 78/184 (42%), Gaps = 13/184 (7%)

Query: 258 VSYFDSFKAKDKHALEYVLPDFQTS-FIGYVRNPREENSPLPEDAQTIALTDELFTIPET 316
           + Y  +F  +D    +Y   D++ S F  ++R PR  +S    +   + +  E   +PE 
Sbjct: 568 LEYDPNFTEEDTLDAQY---DWRNSVFHLFLRGPRPHDSENIHEQHQMHINVERIRVPEV 624

Query: 317 FFHPEISQITKPGIVEA----ILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRL 369
            F P +    + GI E     I +     P  +      M  N+   GGN  +P    R+
Sbjct: 625 MFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRV 684

Query: 370 AAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKT-ESYRRARVTRDEYYEHGPDWCT 428
             E    LP+D   +V++      L  W  M + A T E Y+R  VT +EY E G D+  
Sbjct: 685 VKEFTEFLPSDTKINVNISEA-PTLDVWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLK 743

Query: 429 KQRF 432
           + + 
Sbjct: 744 EHKL 747

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 68/156 (43%), Gaps = 9/156 (5%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLS-MLPEI 344
           ++R PR  +S    +   + L  E   +PE  F P I    + GI E     LS      
Sbjct: 591 FLRGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSK 650

Query: 345 VRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWE 398
            R L      M  NI  TGG+  LP   +R+  E    LP      V +   + +L  W 
Sbjct: 651 PRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMS-KNPSLDAWY 709

Query: 399 VMSQFAKTES-YRRARVTRDEYYEHGPDWCTKQRFG 433
            M + A+ E+ Y+ + +++ +Y E+G ++  + + G
Sbjct: 710 GMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           GIV+ I +S+      +R  +  N+V TGG   +P  + R+  EL + LP   +    S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            + +    GW   S  A   ++ +  V R+EY E GP+   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 60/143 (41%), Gaps = 15/143 (10%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH----YNMMDET-- 242
           LV+D G + + + PV+ G+   K+  +  + G++L  L+ + L  R     + ++ +   
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPD 215

Query: 243 ----ILVNNVKEKCL-FVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297
                L  +V E  + F +   +F  F    K  L ++ P   +SF   +    + +   
Sbjct: 216 FVKRTLSFDVNESVINFANERQFFQEF----KETLLHIAPKSLSSFKDELATQTKRSLEA 271

Query: 298 PEDAQTIALTDELFTIPETFFHP 320
           P   + I   D  ++  E  F P
Sbjct: 272 PWGEELIFDADTRYSFAEQLFRP 294

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG  +LP    R++AEL R LP   +    S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            + +    GW   S  A   ++ +  V + EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 54/268 (20%), Positives = 101/268 (37%), Gaps = 41/268 (15%)

Query: 88  GFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKL 147
           G   K+ + H++V +   +   +  K  D  I  E  F++    P  +  P   S + + 
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 148 KTISGKDEEAD-----VVTSNSGITTFTSR-ECGSAQNSDSDYHDFQLVIDSGFNCTWII 201
           K++    E  D     +V + + ++    R  C              LV+D G + T + 
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPTC--------------LVVDIGHDVTSVC 167

Query: 202 PVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNV-KEKCL------- 253
           PV+ G+   K+  +  I G  L  L++  L+ R    + +      V  E+         
Sbjct: 168 PVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPS 227

Query: 254 ---FVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQTIALTDEL 310
              FV+   +F  F    K  +  V P   + F   +    + +   P   + +  + + 
Sbjct: 228 LQKFVNERQFFQEF----KETMLQVAPTSISKFKSEIETTSKRSIEAPWGEELVYDSLQR 283

Query: 311 FTIPETFFHPEISQ------ITKPGIVE 332
               E  F P++SQ      I+K G+VE
Sbjct: 284 LEFAEQLFTPDLSQFPEDWPISKDGVVE 311

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 6/146 (4%)

Query: 292 EENSPLP----EDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRP 347
           EE +P+P    E++     T++    P    +P  S +  PGIV+ I  S+      +R 
Sbjct: 356 EEPTPVPSKEGEESTPSDKTNDSGKRPMESENPTESSVI-PGIVDLIESSIMATDVDLRA 414

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPIGDCALFGWEVMSQFAKT 406
            +  NIV TGG   +P F+ RL  EL ++LP   +    +    +     W   S  +  
Sbjct: 415 SLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTTGQTRERQYQAWLGGSILSSL 474

Query: 407 ESYRRARVTRDEYYEHGPDWCTKQRF 432
            ++ +  V + EY E G D   K RF
Sbjct: 475 GTFHQLWVGKQEYEESGADRLLKDRF 500

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPIGDCALFGWEVMSQF 403
           +R  +  NIV TGG  ++P F+ RL +EL ++LP   +    +  + +     W   S  
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 404 AKTESYRRARVTRDEYYEHGPDWCTKQRF 432
               S+ +  V + EY E GPD     RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 2/125 (1%)

Query: 309 ELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQR 368
           E   +P+     +I  I  PGI + +  +++     +R  +  N++ TGG   +P  A R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 369 LAAELQRQLPT-DWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWC 427
           L  EL ++LP   +    S    +     W   S      ++ +  V + EY E GPD  
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 428 TKQRF 432
            K RF
Sbjct: 591 LKDRF 595

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 58/141 (41%), Gaps = 13/141 (9%)

Query: 286 YVRNPREENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVE---AIL------E 336
           ++R PR  +S        + L  E   +PE  F P +    + GI+E    IL      E
Sbjct: 591 FLRGPRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSE 650

Query: 337 SLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFG 396
              + P  +   M  N+  TGGN  LP   +R+  E    LP     +V     + +L  
Sbjct: 651 QRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVKQSY-NPSLDA 707

Query: 397 WEVMSQFA-KTESYRRARVTR 416
           W  M++    +E Y+   +++
Sbjct: 708 WNGMAKLTLNSEDYKNTIISK 728

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG+ ++P    R+ AEL + LP   +    S 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
              +     W   S  A   ++ +  V + EY E G D   K RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 65/167 (38%), Gaps = 33/167 (19%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNV 248
           LV+D G + T + PV+ G+   K+  +  I G  L  L++ +L  R      E + +  V
Sbjct: 156 LVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPR------EILPLFQV 209

Query: 249 KEK-----------------CLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
            +K                   FV+   +F  F    K  +  V P   T F   +    
Sbjct: 210 AKKRPEFVKRSFDYEIHPSLLNFVNERQFFQEF----KETMLQVAPTSLTKFKSELEQLS 265

Query: 292 EENSPLPEDAQTIALTDELFTIPETFFHPEISQ------ITKPGIVE 332
           + +   P     +  ++  F I E  F PE ++      I+K G+VE
Sbjct: 266 KRSIEAPWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVE 312

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 6/145 (4%)

Query: 290 PREENSPLPED-AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPL 348
           P  E +P  ED A T   T+E    P      E S++   GI + +  S++     +R  
Sbjct: 342 PNGEETPSGEDQASTSETTNEHGKRP--MEDSESSELA--GISDLVHSSITSADVDLRAT 397

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPIGDCALFGWEVMSQFAKTE 407
           +  NIV TGG+ ++P F+ RL  EL ++LP   +    +  + +     W   S      
Sbjct: 398 LAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRERQYQSWLGGSILTSLG 457

Query: 408 SYRRARVTRDEYYEHGPDWCTKQRF 432
           S+ +  V + EY E G +     RF
Sbjct: 458 SFHQLWVGKREYEEVGAERLLNDRF 482

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 86/242 (35%), Gaps = 55/242 (22%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKN-IKDISSITFRRP 60
           E + IVID GSY      S ++ P   + +       T+   N  K  +    SI   RP
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------ELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSK 113
                   E G++  W+     WD+   N        LK   G  ++ +E      E  K
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRE 173
            + +V+ E  +F++ + SPV+  V F                                  
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPN---------------------------- 157

Query: 174 CGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233
           C              LV+D G + T + PV+ G+   K+  +  I GR++  L++  L  
Sbjct: 158 C--------------LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKP 203

Query: 234 RH 235
           R 
Sbjct: 204 RE 205

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           GI + +  S+      +R  +  N+V TGG   +P    RL  EL ++LP   +    + 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            + +     W   S      ++ +  V ++EY E G D     RF
Sbjct: 470 HLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 328 PGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVS 386
           PGIV+ I  S++     +R  +  N+V TGG   +P  + R+  EL ++LP   +    +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 387 VPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
               +     W   S  +   ++ +  V + EY E G D     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 10/97 (10%)

Query: 292 EENSPLPEDAQTIALTDELF-----TIPETFFHP--EISQITK---PGIVEAILESLSML 341
           +E++P P+   T A T E       T+ E    P  +IS+ TK    G+ + +  ++   
Sbjct: 345 KESTPQPKAEDTSATTTETLDNISDTVNENGKRPVDDISEPTKNDIAGLADLVYSAIIKS 404

Query: 342 PEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
              +R  +  N+V TGG+ ++P  + RL  EL R+LP
Sbjct: 405 DVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLP 441

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + +  +++     +R  +  N+V TGG+ ++P    RL  EL ++LP   +    S 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            + +     W   S  +   ++ +  V R EY E G +   K RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 54/143 (37%), Gaps = 11/143 (7%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPFRALNA-----LAKDKFGTSYLSNHIKNIKDISSIT 56
           E S +VID GSY      S  + P   + +      A  K G    ++    I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFM-IMPRPDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W +   +  +F  F     KG     +E+     E  K + 
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAVFVPF 139
           +V+ E  EF++ + +P A    F
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSF 149

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG  ++P    R+ AEL + LP   +    S 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            + +     W   S  +   ++ +  V + EY E G     K RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 295 SPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIV 354
           +PLPE + T     +           +I +   PGIV+ I  S+S     +R  +  N+V
Sbjct: 361 TPLPESSSTTNENGKRTA-------EDIKREELPGIVDLISSSISSCDVDIRASLAHNLV 413

Query: 355 CTGGNFNLPNFAQRLAAELQRQLP 378
            TGG+  +P  + R+  EL  + P
Sbjct: 414 ITGGSSTIPGLSDRILNELNMKFP 437

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
           L++D G +   + PV+ G+   K+ +     GRFL  LL + L  R 
Sbjct: 168 LIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPIGDCALFGWEVMSQF 403
           +R  +  N+V TGG+ ++   A RL  EL ++LP   +    S  + +     W   S  
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALKFRILTSGHLRERQSRAWLGGSIL 451

Query: 404 AKTESYRRARVTRDEYYEHGPDWCTKQRF 432
           +   ++ +  V R EY E G +   K RF
Sbjct: 452 SSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 47/239 (19%), Positives = 81/239 (33%), Gaps = 53/239 (22%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPFRALNA-----LAKDKFGTSYLSNHIKNIKDISSIT 56
           E S +VID GSY      S  + P   + +        +K G    ++    +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W +   +  +F  F     KG     +E+     E  K + 
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGS 176
           +V+ E  EF++ + +P A  V F                                  C  
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFAMGRP----------------------------TC-- 156

Query: 177 AQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRH 235
                       LV+D G +   + PV+ G+   K+  +  + G+ L  L+++ L  R 
Sbjct: 157 ------------LVVDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 49/113 (43%), Gaps = 1/113 (0%)

Query: 321 EISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT- 379
           EI++ +  G+ + +  S+      +R  +  N+V TGG   +P  + RL AEL  +LP  
Sbjct: 372 EITKGSLLGVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPAL 431

Query: 380 DWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            +    +    +     W   S      ++ +  V ++EY + G D     RF
Sbjct: 432 KFRMITTGHTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 3/113 (2%)

Query: 321 EISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT- 379
           +I +IT  G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+ 
Sbjct: 378 DIKEIT--GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSL 435

Query: 380 DWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
            +    +    +     W   S      ++ +  V + EY E G D     RF
Sbjct: 436 KFRILTTGHTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 84/237 (35%), Gaps = 58/237 (24%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E S +VID GSY      S ++ P   L ++    +G S      K I    SI   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N        L    G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
           + +V+ E  +F++ + +P +  V F                                  C
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPN----------------------------C 155

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  I G+F+  L+K+ +
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 87/237 (36%), Gaps = 58/237 (24%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E S +VID GSY      S ++ P   L ++    +G        KNI    SI   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N        L    G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
           + +V+ E  +F++ + +P +  V F           +G+                    C
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRP------------------NC 155

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  + G+F+  L+K+ L
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT 379
           G+   +  S+      +R  +  N+V TGG   +P  + RL  EL + LP+
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPS 434

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 102/290 (35%), Gaps = 69/290 (23%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL----------------- 231
           LV+D G +   + P++ G     AV +    G FL   + E L                 
Sbjct: 141 LVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPE 200

Query: 232 SFRHYNMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPR 291
           SF+++        +++ K   L VSP    +    +D  A  +   D +  F+    N  
Sbjct: 201 SFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFLYKKGN-- 256

Query: 292 EENSPLPEDAQTIALTD-ELFTIPETFFHPEISQ---ITKPGIVEAILESL--------- 338
                     +T+ L   E + + E  F P+++      K G+ E +++++         
Sbjct: 257 ----------KTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTT 306

Query: 339 -----------------------SMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
                                  +  PE +   ++ NIV TG    +P   QR+  EL  
Sbjct: 307 SNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSY 366

Query: 376 QLPTDWTCHVSVP-IGDCALFGWEVMSQFAKTESYRRAR-VTRDEYYEHG 423
           Q P       + P + D  L  W+     +   S+     +TR EY  +G
Sbjct: 367 QFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 1/89 (1%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPIGDCALFGWEVMSQF 403
           +R  +  N+V TGG  ++P  + RL  EL + LP+  +    +  I +     W   S  
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRERQYQSWLGGSIL 458

Query: 404 AKTESYRRARVTRDEYYEHGPDWCTKQRF 432
               ++ +  V + EY E G +     RF
Sbjct: 459 TSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 85/216 (39%), Gaps = 32/216 (14%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNV 248
           LV+D G   + + P++ G     AV +    G FL   + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 249 KEKCLFV--SPVSYFDSFKAKDKHALEYVLPDFQTSFIG-----YVRNPREENSPLPEDA 301
           K+  L +  +  ++   FK          L D  ++ +      Y++N       L +  
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNF------LLQKQ 251

Query: 302 QTIALTD-ELFTIPETFFHPE-ISQ--ITKPGIVEAILESLS---------------MLP 342
           +TI+LT  +   + E  F P  +SQ  +   G+ E + +S+                  P
Sbjct: 252 KTISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTP 311

Query: 343 EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
           E     ++ NI+ TG +  +    QR+  +L  Q P
Sbjct: 312 EQTHAALLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 86/237 (36%), Gaps = 58/237 (24%)

Query: 2   ERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITF-RRP 60
           E S +VID GSY      S ++ P   L ++    +G        K I    SI   R+ 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N        L    G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSREC 174
           + +V+ E  +F++ + +P +  V F           +G+                    C
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA----------AGRPN------------------C 155

Query: 175 GSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  I G+F+  L+K+ L
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT 379
           G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS 434

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 73/207 (35%), Gaps = 18/207 (8%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDE------- 241
           L++D G     + PV+ G     A+ +    G FL   + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 242 -------TILVNNVKEKCLFVSPVSYFD-SFKAKDKHALEYVLPDFQTSFIGYVRNPREE 293
                     + + K   L V+P    D    A D   L YV  +F       +   ++E
Sbjct: 154 LELWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYV-KNFLYRRQKTISLMQKE 212

Query: 294 NSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESL--SMLPEIVRPLMVG 351
              L E     +   + F   E         + K G   A   S   +  PE +   ++ 
Sbjct: 213 CCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIHAALLT 272

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLP 378
           NIV TG +  +P   QR+  +L  Q P
Sbjct: 273 NIVITGSSSLIPGLEQRIVNDLSYQFP 299

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 41/105 (39%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + +  S+      +R  +  N+  TGG   +P  + RL  EL  +LP   +    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 388 PIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHGPDWCTKQRF 432
              +     W   S      ++ +  V R EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {ON}
           similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
           ACR184Cp and weakly similar to uniprot|Q12406
           Saccharomyces cerevisiae YPR034W ARP7 Actin-related
           protein involved in transcriptional regulation subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 438

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 20/140 (14%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLT-----GLLKETLSFRHYNMMDETI 243
           +V+D G +   +  V+ G+ + +  K+  IGG FL        LK+          D T 
Sbjct: 146 IVVDIGHSGVKVDVVIDGVLFKQYRKENKIGGAFLNWQICDQYLKQDSGKSTKIWRDATE 205

Query: 244 LVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQT 303
            + N K   L VSP+    ++          V P +Q     ++ +P +       D +T
Sbjct: 206 WLPNFKNSMLQVSPIELDANYD---------VAPHYQ-----HMVSPMDLTKNFLLDKKT 251

Query: 304 IALTD-ELFTIPETFFHPEI 322
           +  T+ +L+TI E  F P I
Sbjct: 252 LTFTNKQLYTIGELLFKPVI 271

>KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {ON}
           Anc_6.373 YCR093W
          Length = 2091

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 247 NVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSP 296
           +V EK LF+      D+F  K +   + + P++ T F GY+ N R +  P
Sbjct: 786 DVTEKVLFIVNNLTMDNFDEKIQGLKQALTPNYATWFSGYLVNQRAKTEP 835

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 10/145 (6%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFL----TGLLKETL-SFRHYNMMDETI 243
           LVID G   T + P++ G      V K   GG FL      LL+E L S  H    +   
Sbjct: 148 LVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSAT 207

Query: 244 LVNNVKEKCLFV--SPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP--REENSPLPE 299
            +   K   L V    +S  + +        +        ++  Y+ NP  ++ N  L +
Sbjct: 208 WIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKK 267

Query: 300 DAQTIAL-TDELFTIPETFFHPEIS 323
           + +T+ L   + + + E  F P+++
Sbjct: 268 NNKTVTLELRDCYRVCEYLFQPQLA 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,612,774
Number of extensions: 2225853
Number of successful extensions: 5738
Number of sequences better than 10.0: 150
Number of HSP's gapped: 5673
Number of HSP's successfully gapped: 214
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)