Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1528.256ON1220122060100.0
YLR084C (RAX2)8.256ON1220122147960.0
Smik_12.1438.256ON1220122147920.0
Suva_10.1688.256ON1220122147490.0
NDAI0B023808.256ON1219122725880.0
NCAS0B049808.256ON1204121024960.0
TDEL0F038308.256ON1195120524370.0
ZYRO0C01804g8.256ON1209121723440.0
KAFR0B026908.256ON1210122723110.0
Kpol_392.108.256ON1226122322770.0
SAKL0H17204g8.256ON1211123722570.0
TPHA0B032508.256ON1215121621440.0
TBLA0E043908.256ON1278126519870.0
KNAG0G020008.256ON1202124019610.0
KLTH0G13838g8.256ON1214122818130.0
Kwal_56.235898.256ON1213123117890.0
CAGL0L12144g8.256ON1156118417720.0
KLLA0F18975g8.256ON1200124717670.0
Ecym_43158.256ON1212125217390.0
AGR095W8.256ON1201125317220.0
Kpol_1010.683.183ON50082791.4
ZYRO0G12276g5.164ON53266762.9
KAFR0J025506.325ON906189763.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.152
         (1220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...  2319   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...  1852   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...  1850   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...  1833   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...  1001   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   966   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   943   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   907   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   894   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   881   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   874   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   830   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   769   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   759   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   702   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   693   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   687   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   685   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   674   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   667   0.0  
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    35   1.4  
ZYRO0G12276g Chr7 complement(969552..971150) [1599 bp, 532 aa] {...    34   2.9  
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    34   3.0  

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 2319 bits (6010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1158/1220 (94%), Positives = 1158/1220 (94%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
            LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG
Sbjct: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
            TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL
Sbjct: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
            IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAG       
Sbjct: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNS 240

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300
              LLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY
Sbjct: 241  TSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300

Query: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360
            EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL
Sbjct: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360

Query: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420
            LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG
Sbjct: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420

Query: 421  LELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPT 480
            LELYQDTFSTYANNSLNEYGC                WYNGLGGESYIATEYVPNQDEPT
Sbjct: 421  LELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPT 480

Query: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540
            PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN
Sbjct: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540

Query: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600
            LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE
Sbjct: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600

Query: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660
            YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN
Sbjct: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660

Query: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENV 720
            HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGD              GSFENV
Sbjct: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENV 720

Query: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780
            FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF
Sbjct: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780

Query: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840
            SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF
Sbjct: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840

Query: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900
            SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI
Sbjct: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900

Query: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960
            NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ
Sbjct: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960

Query: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020
            LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR
Sbjct: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020

Query: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080
            DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ
Sbjct: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080

Query: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGXXXXXXXX 1140
            GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETG        
Sbjct: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGPQSASSQF 1140

Query: 1141 XXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200
                           RIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP
Sbjct: 1141 PSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score = 1852 bits (4796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1221 (75%), Positives = 1042/1221 (85%), Gaps = 2/1221 (0%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            MFVHRLWTL FPFL + SKASQL+NIKSLLDIEDNVLPNLNISQ+NSNAVQILGGVDALS
Sbjct: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
             YEYTGQQNFTKEI P T+S GLVYYSNNTYIQ+EDASDDTRIDKITPFG DSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
            TINN+ +GNQILYNLSTLSM PIF+Q LG+V++VL + +S+YFGGNFSYNNGSMTG+SAL
Sbjct: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
            IWDSISN TQLLPFGGFGENS+VNSI+KLN+DNILFAG+FYTLDD SALI++        
Sbjct: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNST 240

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300
              L NAT LELGQRIPLRYA+WD QGSTTF S+SLVCPN NEDAW+YP TSG+LVC LPY
Sbjct: 241  SSL-NATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPY 299

Query: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360
            EVSPTK+RLYNSQ SD EISVFQILT+PS+SIMNLTYLDPLSG+LKNC EFCPLYSRATL
Sbjct: 300  EVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATL 359

Query: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420
            LSASQNVSS MDMI+F+DNN TDVKW+SDFQDFAF NELPV+ LKF A+NSYG SVGLSG
Sbjct: 360  LSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSG 419

Query: 421  LELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPT 480
            LELYQDTFSTYAN+SLNEYGC                WYNGL GESYIA +YVP+Q+EP 
Sbjct: 420  LELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPI 479

Query: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540
            PRV FYPNI+HPGHY IN YTPGC+QD+TCS+RGIVNVTMWN QN T+MKTY IYQNNDN
Sbjct: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539

Query: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600
            LKYDQIYSGYLDFSPEI+LEYVSGI+T+NTATVVVADQVNVITV LDAF+TLS+S+N K+
Sbjct: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKK 599

Query: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660
               LNG+LQYQKSNFTST  NETK+GNTTLN+F V NYP NSSL+AD   ++L++GG +N
Sbjct: 600  ETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSN 659

Query: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENV 720
             ISI+ LND+ EV  S+ Q IQGDVHG+T+T+QGLLIFGD              GSFENV
Sbjct: 660  RISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENV 719

Query: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780
            FN SRTVNSA+NISLANND IV DNDY+VN SS+A I NS+SFSLSLW+AG+NG+ DVLF
Sbjct: 720  FNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLF 779

Query: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840
            SGAVS MQ+G LNGS RFL+E++++ LNL+  +VPYL AYLNES TAYAYE + LNKIYF
Sbjct: 780  SGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYF 839

Query: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900
            SN V PSWNWS+ IT+MLYA+NQ+LL V + SSTTAELSIF+L+N TMIANET+GSNA+I
Sbjct: 840  SNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARI 899

Query: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960
            NALVNFEKN S+LVGG+FQM++PNC+GLCLYNYESK+WSTF NNT FGEITQLSF+ +S+
Sbjct: 900  NALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSE 959

Query: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020
            L+ISGLF+T+EYQS+RL SFNLTNSTMIPLL+G+EGK+NSF VTE+SIVAWNDTSL IYR
Sbjct: 960  LIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYR 1019

Query: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080
            +QEWNITS+PGN SSI SVS I T+    TLN+R  NN  NG+ILLL+GNF+I  YG LQ
Sbjct: 1020 NQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQ 1079

Query: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTET-GXXXXXXX 1139
             LLFDF+ W+PYF+SE++NTSN NP IFINRDVSTEFNSQ PL+N+N+T T         
Sbjct: 1080 SLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQP 1139

Query: 1140 XXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199
                            +I RGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK
Sbjct: 1140 PSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PRIDENEMLDTVPPEKLMKFV
Sbjct: 1200 PRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1850 bits (4792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/1221 (74%), Positives = 1034/1221 (84%), Gaps = 2/1221 (0%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            MFVHRLWTL F FLAQASKASQLQNIKSLLDIEDNVLPNLNISQ+NSNAVQILGGVDA+S
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
             Y+YTGQQNFTK ISPGTNS GLVYYSNNTYIQ+EDASDDTRIDKITPFG DSFILSGSG
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
            TINN+ +GNQILYNLSTLSMAPIF+Q LG VE+VL+N TSVYFGGNFSYNNGSM GHSAL
Sbjct: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
            +WD++S+  QLLPFGGFGENSNVNSI+KLNDDNI+FAGKFYTLDDSS LIT+        
Sbjct: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNST 240

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300
              L NATKLELGQRI LRYA+WD QGSTT  SNSLVCPN N +AW+YPATSG+LVC LPY
Sbjct: 241  FSL-NATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPY 299

Query: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360
            EVSPTK+RLYNSQD+  EI++FQILTNPS+SIMNLTYLDPLSG+LKNCDEFCPLYSRATL
Sbjct: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359

Query: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420
            L+ASQN SS MDMI+F+D NNTDVKWSSDFQDFAFANELPVT LK  A+NSYG S+GLSG
Sbjct: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419

Query: 421  LELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPT 480
            LELYQ+TFSTYANNSLNEYGC                WYNGL GESYIAT Y+P+Q+EP 
Sbjct: 420  LELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPI 479

Query: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540
            PRV FYPNI+H GHY INTYTPGCVQD+TCSSRGIVNVT+WNPQN TMMKTYTIYQNNDN
Sbjct: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539

Query: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600
            LKYDQI+SGYLDFSPEI+LEY+SGI++SNTATVVVAD+VNVITV LD F+ LSE  N K 
Sbjct: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599

Query: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660
              PLNG+ QYQKSNFT TTSN+TK+GNTTLN+F V+NYP N+SL  +   D+LI+GG +N
Sbjct: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSN 659

Query: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENV 720
             IS I LN+N E+  SE + IQGDV+G+T+T QGLLI+GD               SF  V
Sbjct: 660  RISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKV 719

Query: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780
             NYS+ VNSA NIS+A+N+L VFDN+YI+N SS+AQI NSTSFSLSLW+AG+NGN DVLF
Sbjct: 720  PNYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLF 779

Query: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840
            SG VS M+F  LNGSA F +ED+VQALN+   +VPY  AYLNES +AYAYET+ LNKIYF
Sbjct: 780  SGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYF 839

Query: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900
            SN V+PSWNWS +ITRMLYANNQ++L V SESS+TA+L+IFNL+N T IANET+GSNAK+
Sbjct: 840  SNKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKV 899

Query: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960
            +ALVNFEKNSS+LVGG+FQ++KPNCSGLCLYNYE+KSWSTFFNNT FGE+TQLS + +S+
Sbjct: 900  SALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSE 959

Query: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020
            L+ISGLF+T E+QS+RL SFNL N TM+PLL+G+EGK+NSFVVT+ S+VAWNDTSL IY 
Sbjct: 960  LIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYG 1019

Query: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080
            +Q+WNITS+P +DS IGSVSTI+TN    TLN+RATNNA +G+ILLL+GNF++P YGNLQ
Sbjct: 1020 NQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQ 1079

Query: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETG-XXXXXXX 1139
             LLFDF+ W+PYF+SE SN+SN NPT FINRDVSTEFNSQI L NLN+T T         
Sbjct: 1080 SLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQS 1139

Query: 1140 XXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199
                            +IDRGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDYKPIK
Sbjct: 1140 PSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIK 1199

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PRIDENEMLDTVPPEKLMKFV
Sbjct: 1200 PRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1833 bits (4749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 910/1221 (74%), Positives = 1034/1221 (84%), Gaps = 2/1221 (0%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            MFVHRLWTL  P L   SKASQLQ+IK+LLDIEDNVLP+LNISQDN NA+QILGGVDALS
Sbjct: 1    MFVHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
             YEYTGQQNFTKEI   TNSRGLVYYSNNTYI +E+A +DTRIDKITPFGADSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
            +IN +P+GNQ+LYNLSTLSMA IF Q LGSVE+VL+N TSVYFGGNFSYNNGSMTGH AL
Sbjct: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
            +WDS SN TQLLPFGGFGE+SNVNSI+KLNDDNILFAGKFYTLDDSS L T+        
Sbjct: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTS-STNTTNA 239

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300
               LNAT LELGQRIPLRYA+WD QGSTTFES+ LVCP+ ++DAW+YP TSG+LVC LPY
Sbjct: 240  SSTLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPY 299

Query: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360
            EV+PTK+RLYNS +SD +IS+FQILTNPS SIMNLTYLDP+SG+L++CDEFCPLYSR TL
Sbjct: 300  EVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTL 359

Query: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420
            LSASQNVSS +DMISF+DNNNTDVKWSSDFQDFAFANEL VT LKFTA+NSYG  VGLSG
Sbjct: 360  LSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSG 419

Query: 421  LELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPT 480
            LELYQDTFSTYANNSLNEYGC                WY+GL G+SYIA +YVPNQ +PT
Sbjct: 420  LELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPT 479

Query: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540
            P V FYP+I+HPGHY INTYTPGCVQD+TCSSRGIVNVTMWNPQN TMM+TY IYQNN+N
Sbjct: 480  PTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNN 539

Query: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600
            LKYD+IYSGYLDFSPEI+++YVSGI+ SNTAT++VADQVN+IT  LD+FS+LSE+ + K 
Sbjct: 540  LKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKR 599

Query: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660
            + PLNG+LQYQ+SNFT+TTSN TKI NTTLN+F+VDNYP NSS+FAD    +LILGG +N
Sbjct: 600  HTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDN 659

Query: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENV 720
            HIS+I  NDNLEV  SE + IQGDV+GMTQT+QGLLIFGD              GSFE+V
Sbjct: 660  HISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESV 719

Query: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780
             NYS+ V +AINI+LANNDLIVF+NDYI N SS++QI NSTSFSLSLWSAG+N NDDVLF
Sbjct: 720  SNYSKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLF 779

Query: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840
            SGAVS+MQF  L+GSARFL+E  V+ALNL+  +VPYL AYLNEST AYAY+TN L+KIYF
Sbjct: 780  SGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYF 839

Query: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900
            SNNV PSWNWS +IT+M+YANNQ+LL +GSESSTTAELSI NL+NFT IANET+GSNAKI
Sbjct: 840  SNNVSPSWNWSNNITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKI 899

Query: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960
            NA VNFEKNSSLLVGG+FQMSKPNC+GLC+YNYESKSWSTFFNNT  GEITQL+F+  S+
Sbjct: 900  NAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESE 959

Query: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020
            L+ISGLF TE+ QS+RL SFNLTNSTM+PLLTG+ GK+NSF VTEESIVAWNDTSLLIY+
Sbjct: 960  LIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYK 1019

Query: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080
            DQ+WN TS+PGN SS+ SV+TI+TN     L +RAT +AE G+ILLL+GNFSIP YGNLQ
Sbjct: 1020 DQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQ 1079

Query: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGXXXXXXXX 1140
            GLLFD + W+PYF SE+   S+ NPTIFINRDVS +FNSQIPLSN N+T T         
Sbjct: 1080 GLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLS 1139

Query: 1141 XXXXXXXXXXXXXXXR-IDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199
                           + +DRGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDY+PIK
Sbjct: 1140 PSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIK 1199

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PRIDENEMLDTVPPEKLMKFV
Sbjct: 1200 PRIDENEMLDTVPPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1227 (43%), Positives = 788/1227 (64%), Gaps = 25/1227 (2%)

Query: 7    WTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTG 66
            W   F  L    +ASQL NIK++L++ +  +P LN++  N +  Q+LG +D LS Y Y G
Sbjct: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64

Query: 67   QQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMP 126
            QQNFT  I PG+NS GL+YYSNNT IQ+E+ S+DT I KITPFG+DSFILSG+G+++   
Sbjct: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYS 124

Query: 127  IGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSIS 186
            + NQ+LYNL+TLS+ PIF+  +  V+++LI+ + VYFGGNF+  NG+   HS ++WDS S
Sbjct: 125  LTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184

Query: 187  NKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXXXLLNA 246
            + T+ L FGGFGENS +NSI+KLNDDNILFAG+FYTLD+   LI            + N+
Sbjct: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLI---QNTTSSQNNIFNS 241

Query: 247  TKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTK 306
            T +++GQ +PL  +TWD  G +TF+S++ VCP+  E++W+   T+G+L CKLP+EV+PTK
Sbjct: 242  TTVDIGQLVPLSASTWD-TGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTK 300

Query: 307  VRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQN 366
            +R+YNS + D ++S+F+ILTN +  IMNLTY+DP+S +LK+CD FCPLYS+A L  A  N
Sbjct: 301  IRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYAN 360

Query: 367  VSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQD 426
             +SP D I  L +N TD+KW+ +FQ+FAF N++ V+ ++F A++SYG +V LS  +LYQ+
Sbjct: 361  TTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQN 420

Query: 427  TFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNFY 486
             ++ +AN++LNE  C                W  GL G++YI+T Y PNQD P P V+F 
Sbjct: 421  AYAVFANDTLNEPNC-NSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQD-PVPYVSFS 478

Query: 487  PNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQI 546
            P I +PG Y IN YTPGC QD TCSSR IVNVT+W+    +++ T  IYQNN  LKYD++
Sbjct: 479  PQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDEL 538

Query: 547  YSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNG 606
            YSGYL  SP + +EYVSG++ SNT   VVAD++NV+   L+     S   N  E + LNG
Sbjct: 539  YSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNG 598

Query: 607  VLQYQKSNFTSTTSNET--KIGNTTLNVFAVDNYPNNSSLFADTNGDR-LILGGTNNHIS 663
            +LQYQ SNF++++S  T  KI NT+LN  +++ +  N+S++AD   D  L+LG +N  I 
Sbjct: 599  LLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIK 658

Query: 664  IIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENV--F 721
            ++ LN+N+++  S +  + G+  G +  S G+L +G+              G+F  +  F
Sbjct: 659  VVKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNF 718

Query: 722  NYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFS 781
            N + ++ + +N+++ + +L+V DN  I N SSS+ I NS++  LSLWS+GSN N D +FS
Sbjct: 719  NKNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFS 778

Query: 782  GAVSRMQFGGLNGSARFLSEDKVQAL--NLDNAVVPYLAAYLNESTTAYAYETNLLNKIY 839
            GA++ + +  LNGS    +   V  +  N+ +    Y   +LN+S + YA +T+  +++ 
Sbjct: 779  GAIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELL 838

Query: 840  FSNNVDPSWNWSTSITRMLYANNQSLLTVGSES-STTAELSIFNLKNFTMIANETMGSNA 898
            FSN     W++   I  M+Y+++Q++L V S   +  +ELSI NL  F  IANET+  N+
Sbjct: 839  FSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNS 898

Query: 899  KINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAA 958
            KIN L+NFE NS+L+VGGNF + + NCSGLCLYNY+S  W TF N++  G I Q+     
Sbjct: 899  KINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELING 958

Query: 959  SQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLI 1018
            +QL++SGLF+ +   SV LA  +L+   +  +  G    + SF    + I+ WN   L  
Sbjct: 959  TQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLES 1018

Query: 1019 YRDQEWN-ITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYG 1077
            Y +  W+ I S   + ++I S+  I    GP TL +R    + +G   +++GN    +YG
Sbjct: 1019 YENGAWSTIQSNFNSSTTIRSIEPI--GFGP-TLQKRDGTGSADG--FIINGNIYDTEYG 1073

Query: 1078 NLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLN----VTETGX 1133
             +Q ++++F+ W PY++  S+N S     IF+NRD S  +NSQ  L N N     T +  
Sbjct: 1074 TIQAMIYNFKEWRPYYIISSTN-SQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSST 1132

Query: 1134 XXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEG 1193
                                  +IDRGFVVLIGLALALGTVS+LGI G++LAY+FKD +G
Sbjct: 1133 SSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDG 1192

Query: 1194 DYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             +  + PR +E+EML+TVPPEKLMKF+
Sbjct: 1193 SHDALNPRTNEDEMLETVPPEKLMKFL 1219

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1210 (44%), Positives = 785/1210 (64%), Gaps = 32/1210 (2%)

Query: 20   ASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTN 79
            ASQL +++  L+I    +PNLN++ D+ N+ ++LGG+D+LS Y YTGQQNFT  I P +N
Sbjct: 18   ASQLSSLQENLNITHINIPNLNLTTDD-NSFELLGGIDSLSFYRYTGQQNFTSGILPNSN 76

Query: 80   SRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLS 139
            S GL YYSNNT+IQ+ + S D+RI++I PFG+DSFILSG G++    + NQ+L+NLS+ S
Sbjct: 77   SNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFS 136

Query: 140  MAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGE 199
            +  IF+Q L SV S+L++GT V FGGNF+ +  S+ GHS  +W+  +N T LLPF GFGE
Sbjct: 137  LKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGE 196

Query: 200  NSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXXXLLNATKLELGQRIPLRY 259
            NS +NSI KLNDDNILFAGKFYTLD+S+ L             + N + + LGQ IPL  
Sbjct: 197  NSLINSITKLNDDNILFAGKFYTLDNSTLL-------NVVNDTMRNISDINLGQLIPLSA 249

Query: 260  ATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDGEI 319
            ATW   GS  F+  + VCP+   +AW    TSGTL C LP++V+PTK+R+YNS D D EI
Sbjct: 250  ATWSSTGS-FFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEI 308

Query: 320  SVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDN 379
            S+F+I ++PS SIMNLTY+DP+ G+LK+CD FCPLY++  L SAS+NV+   +MI  L++
Sbjct: 309  SLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLND 368

Query: 380  NNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEY 439
            N +D++WS DFQ+FAF N+L  + L+F A+NSYG +VGLS  ++YQD ++ +ANNSLNE 
Sbjct: 369  NTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEP 428

Query: 440  GCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYIINT 499
             C                W  G+  ++Y+ T Y+P+Q    P V F+P++ + G Y I  
Sbjct: 429  SC-NSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDLKYSGQYSIEL 486

Query: 500  YTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEIIL 559
            YTPGC QD+TCSSRGIVNVT+WN  N +++ T  IYQNND LKYD++YSGYL++SP+I +
Sbjct: 487  YTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITV 546

Query: 560  EYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTSTT 619
             Y SGI++  TA  VV D++N++   LD  + +  S N+ E   LNG+ QYQ SNF++++
Sbjct: 547  TYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE---LNGLFQYQLSNFSTSS 603

Query: 620  SNET--KIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLNDNLEVVLSE 677
             + +  ++ NT++N   +  + +N SL A    D L++G  ++ +SI  LN +L +  S 
Sbjct: 604  KDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSS 663

Query: 678  KQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVFNYSRTVNSAINISLAN 737
            +Q I+G + G+   S G+L++GD              GSF+++ N +  + +  NI++ +
Sbjct: 664  QQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITIDD 723

Query: 738  NDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSAR 797
            ++L+VFDN+ I N SSS+QI N++SFSLSLWS+GSN N D LFSGA+S++QF  L+GS  
Sbjct: 724  SELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVS 783

Query: 798  FLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETN-LLNKIYFSNNVDPSWNWSTSITR 856
                + + A +L +   PY A +LN+S T Y  + +   +++ FS+     W W+  +  
Sbjct: 784  I--ANNLSATSLRSIGSPYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDS 841

Query: 857  MLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGG 916
            MLY  NQS+L VGS SS   ELSI NL +F ++ANET+  N+ +  +V+FE+NSS+LVGG
Sbjct: 842  MLYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGG 901

Query: 917  NFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVR 976
            NF +S   C GLCLYNY    W TF N T  G IT+L     SQL+I+G+FDT+   SV 
Sbjct: 902  NFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVN 961

Query: 977  LASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDS-- 1034
            LA  NLT++ ++ +  G +  +  F+  +++I AWN+TSL  Y    W    +  ++S  
Sbjct: 962  LALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSST 1021

Query: 1035 ---SIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSP 1091
               SIG  +T + N       ++  N+  +  +L++ G      YG++Q ++++FE W P
Sbjct: 1022 TIDSIGWTTTTDNNL------KKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIP 1075

Query: 1092 YF-VSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGXXXXXXXXXXXXXXXXXX 1150
            Y  ++   +++N+   +FI+RDVS  F+SQ+ L   N T +                   
Sbjct: 1076 YLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNTTAS-ITASSSTPTPTSSPKKKL 1134

Query: 1151 XXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDT 1210
                 +IDRGFVVLIGLALALGT++VLGI GVILAY F+D +GDY  I PR++E+EML T
Sbjct: 1135 HQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKT 1194

Query: 1211 VPPEKLMKFV 1220
            VPPEKLM+F+
Sbjct: 1195 VPPEKLMEFI 1204

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1205 (43%), Positives = 754/1205 (62%), Gaps = 26/1205 (2%)

Query: 18   SKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPG 77
            S ASQL+N+K+   I +   P L+   +   A+Q+ GG +AL+  +Y GQ+NFT  I+  
Sbjct: 15   SLASQLENLKNKHGIVNIGTPRLDFPGE---ALQLFGGFNALTFPQYEGQENFTGTINNN 71

Query: 78   TNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLST 137
            T+SRG+VYYSN+T+I++ + S D+ ++KI PFG++SFIL GSG++    +G Q+LYNLS 
Sbjct: 72   TDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSD 131

Query: 138  LSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGF 197
            LS+ PIF+  L  V  +L +    YFGGNFS++NGS  GHS   W+S SN T LLPFGGF
Sbjct: 132  LSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGF 191

Query: 198  GENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXXXLLNATKLELGQRIPL 257
            GE S VNSIIKL+ DNILF G+FYTLDD + LIT             ++  +E+ + +PL
Sbjct: 192  GEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN-----HSQSIEINELLPL 246

Query: 258  RYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDG 317
            R ATW+    ++F+S++ +CPN+ ++AW  P+TSG+L   LPYE  P KVR+YNS +   
Sbjct: 247  RAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHN 306

Query: 318  EISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFL 377
             +S+F+I+T PSN IMNLTY+DPLSG+L NCD FCPL  + +L +A  N ++    +  L
Sbjct: 307  AVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNT--SQVVRL 364

Query: 378  DNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLN 437
            DNN TD++WS D+QDFAF N++ VT L+F A++SYG +VGLS  +LYQDT +TYANNSLN
Sbjct: 365  DNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLN 424

Query: 438  EYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYII 497
            E GC                W  GL G+SY+  ++   Q E  P+V FYP I + G Y +
Sbjct: 425  EVGCESNDIASTSALSDSE-WQQGLFGQSYLVADFRTGQ-ETLPKVTFYPAINYAGQYTM 482

Query: 498  NTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEI 557
            N YTPGC  D TC+SR IVNVTMW+    +++ +  ++QNN+ +KYDQ+YSG+L+ +P +
Sbjct: 483  NLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVL 542

Query: 558  ILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTS 617
             LEY S I  +N + VVVAD++ VI   +D          T E IPLNG+ QYQ SNFT+
Sbjct: 543  TLEYYSPISPNNPSNVVVADRLEVIVESVDILKN-----QTDETIPLNGMFQYQLSNFTN 597

Query: 618  TTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLNDNLEVVLSE 677
            +T ++  I NTTLN + V N+P N+SLF+    + L +GG+ + ++ + L+++L V  + 
Sbjct: 598  STDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTA 657

Query: 678  KQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVFNYSRTVNSAINISLAN 737
            K    G V G++  S G+++FG               G F +  N   T+ +  N+S   
Sbjct: 658  KYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQ 717

Query: 738  NDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSAR 797
            ++L+VF+N+Y+ N SS++ I NS++F LSLWSAG N  DD LFSGAV++ QF GL GSA 
Sbjct: 718  DELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSAS 777

Query: 798  FLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWSTSITRM 857
              S   V   +L N   PY A +LN+S TAYAY    ++++YF N  +  W W  +I  M
Sbjct: 778  IYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSM 837

Query: 858  LYANNQSLLTVGSESSTTAE-LSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGG 916
             Y+ N ++L +G++ ST    LS+FNL +F ++AN T+  N  I+++V F++NSSLLVGG
Sbjct: 838  RYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGG 897

Query: 917  NFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVR 976
            ++ +S  +CSGLCLYNY+ K W+ F NN+  G IT++  S +  L+ISG  +     SV 
Sbjct: 898  DYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVN 957

Query: 977  LASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSSI 1036
            L SFN++N  + PL+  + G I SF+  +  I+ WN+TSL  Y D +W       N S I
Sbjct: 958  LLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEF-DNSSLI 1016

Query: 1037 GSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSE 1096
              V  I     P  L++R T ++    IL+   N++  +Y   Q  +++F+ W PY+V+ 
Sbjct: 1017 SIVDVIAVKTEPA-LDKRQTFSSTFDAILVAGQNYA--EYP--QASIYNFQRWLPYYVAN 1071

Query: 1097 SSNTSN-RNPTIFINRDVSTEFNSQIPLSNLNVTETGXXXXXXXXXXXXXXXXXXXXXXX 1155
             ++  +    T F N+D S  ++SQ  LS+   T T                        
Sbjct: 1072 KADDEDPSRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVRKSG 1131

Query: 1156 RIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEK 1215
            +I+RGFVVLIGLALALGTV ++GI GV+LA VF    G Y+ + PR DE+EM+DTVPPEK
Sbjct: 1132 KINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVPPEK 1190

Query: 1216 LMKFV 1220
            L+KF+
Sbjct: 1191 LLKFL 1195

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1217 (41%), Positives = 734/1217 (60%), Gaps = 19/1217 (1%)

Query: 9    LIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQ 68
            L F FL   +  SQL +++ LL+  +  +P L+++   + A+++LG    L+ Y+YTGQ+
Sbjct: 7    LSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQE 66

Query: 69   NFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIG 128
            NFT  ++  T+S GL+YYSN+T++Q+ + S+DT I +I P G DSFILSGSG I+   + 
Sbjct: 67   NFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQ 126

Query: 129  NQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNK 188
             Q+ YNL+ LS  PIF + L  V S+L++   VYFGGNF+++NGS TGHS ++W+S  N 
Sbjct: 127  RQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNS 186

Query: 189  TQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXXXLLNATK 248
            T LLPF GFG+NS VNSII+L+ DNILFAG FY LDD   L+              N T 
Sbjct: 187  TSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDD-VKLLENHILGSNNSSSKSNWTD 245

Query: 249  LELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVR 308
            +ELG  IPL+ A W    S+ F+++  +CP+   ++W+   TSG+L C LP E +P K+R
Sbjct: 246  VELGLAIPLQNANWT-SSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIR 304

Query: 309  LYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVS 368
            +YNS   D E+S+F+IL  P+  I+NL+Y+DP  G+L+ CD FCPLY+R  L  AS N S
Sbjct: 305  IYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSS 364

Query: 369  SPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTF 428
            S  +M +F DNN TD+KW  DFQ+FAF N +P++ ++F A++SYG +VGLS  + +Q   
Sbjct: 365  SVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRA 424

Query: 429  STYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNFYPN 488
            S YANNSLN+  C                W  GL G++Y++T YV +Q    PRV F+P 
Sbjct: 425  SIYANNSLNQPAC-GKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQ 482

Query: 489  IVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYS 548
            I +PG+Y I  YTPGC+ D TC+ R IVNVT+W+  +   + +  IY+NN+ LKYD+++ 
Sbjct: 483  IQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWD 542

Query: 549  GYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVL 608
            G+L  SP++ LEY S I+ +N  +VVVAD +++     D F         K+ I LNG+ 
Sbjct: 543  GHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFE------KHKKDITLNGIF 596

Query: 609  QYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADT-NGDRLILGGTNNHISIIGL 667
            QYQ SNFT   + E+ IGNT+L+VF +  + NNSSLFA     D L+L  + +  + I L
Sbjct: 597  QYQISNFTKNITKES-IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKL 655

Query: 668  NDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVFNYSRTV 727
            + N  V  S+   +   V G+   S GL++FGD              GSF +    +R+V
Sbjct: 656  DKNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSV 715

Query: 728  NSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRM 787
                NI L   +L+VFDN++  N SS + + N+T FSLS+WSAG N N D++FSGAVS  
Sbjct: 716  ERFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDN 775

Query: 788  QFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPS 847
             +  L G           + N+ + + PY+ AYLN++ TAYAY+    ++I FSN  +  
Sbjct: 776  DYENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGP 835

Query: 848  WNWSTSITRMLYANNQSLLTVGS-ESSTTAELSIFNLKNFTMIANETMGSNAKINALVNF 906
            W W+ SI  M+Y N  +LL +G+  S +  +LS+ NL    ++ANET+   A++N+++ F
Sbjct: 836  WRWTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILF 895

Query: 907  EKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGL 966
             KNS+LL+GGNF  S  +C+GLCLYNY++K WSTF N++  G++TQ+    +S+L+I+G 
Sbjct: 896  GKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGS 955

Query: 967  FDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNI 1026
                    V L S N+T   M  LL G EG + SFVV+E+ +V WNDTSL+ Y +  W  
Sbjct: 956  LRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRH 1015

Query: 1027 TSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTI--LLLSGNFSIPDYGNLQGLLF 1084
             S   N +S   +  I+  +   +L +RA N++ N  +  LL+ GN       + Q  ++
Sbjct: 1016 IST-SNSTSFTKLQDIHQVSLEHSLEKRA-NSSSNSNLDGLLVYGNDKTQG-DSYQASIY 1072

Query: 1085 DFETWSPYFVSES-SNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETGXXXXXXXXXXX 1143
            D+ +W+P F++ S S  SN  P IF+N+DVS  F S+  L N     +            
Sbjct: 1073 DYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTSSRSSSSSSSAVT 1132

Query: 1144 XXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRID 1203
                        ++DRG+VVLIGLALA+GTV V+G+ G+++AY+F +  G Y+ + P  +
Sbjct: 1133 SNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAE 1192

Query: 1204 ENEMLDTVPPEKLMKFV 1220
              +  +T PP K  KF+
Sbjct: 1193 GTKAAETAPPAKSSKFL 1209

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1227 (42%), Positives = 758/1227 (61%), Gaps = 24/1227 (1%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            M  H             S ASQL  +++ L I+    P L  S +N +++Q+LG  DALS
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
            LY YTGQQNF+ +I+P TNS GLVYYSNNT IQ+    DDTRI+ I P G+DSFILSGSG
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
            ++N   + NQ+ YNLS+LS+ PIF+  L  VES+L++   VYFGGNF+++NG+  GHS  
Sbjct: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
            +W+  SN T LLPF GFGENS++N+I++LNDDNILFAG+FYTLDD+S L +         
Sbjct: 181  VWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTS------NTS 234

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300
                N   LEL   +PL  ATW     + F+++S +C N + DAW    T+GTL C LPY
Sbjct: 235  NATTNIYDLELSPLLPLNEATWS-SDVSDFDASSFICVNPDSDAWFVSGTTGTLACSLPY 293

Query: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360
            + + TK+R+YNS DS  +IS F+++++PS SIMN+TY+DP +G L++CD +CPL SR TL
Sbjct: 294  DSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTL 353

Query: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420
             SAS   +S  +M   L +N T +KWS+++Q+F F N +  TLL+F A+NSYG +V L+G
Sbjct: 354  SSASD-AASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAG 412

Query: 421  LELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPT 480
              LYQD ++ +ANNSLN   C                W  G  G++Y+ T Y    D+P 
Sbjct: 413  YSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEG-DDPI 471

Query: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540
            P+V F  N+ + G Y+IN YTPGC  D TCS+RG+VNVT+++  + +++ T  IYQNN+ 
Sbjct: 472  PQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEA 531

Query: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600
            LKYD+++SGYL  S  I+LEYVSGI + +T T VVAD+ N+    LD    +S S N   
Sbjct: 532  LKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGST 591

Query: 601  YIPLNGVLQYQ-KSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTN 659
             + LNG+ QYQ  +  ++  S+  K+G T LN + +D +  NSSLFA T  + L++GG  
Sbjct: 592  -VALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAE 650

Query: 660  NHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFEN 719
              +  +  +++L    S+   ++G    M   S+G+ ++G+              GSF  
Sbjct: 651  QSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNP 710

Query: 720  VFNY-SRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDV 778
               Y + ++++  N++  N++++VF+N Y+ N SSS  + NS+S SLSLWSAG+N N D+
Sbjct: 711  FTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDL 770

Query: 779  LFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKI 838
            LF+GA S+M +   N S    + + VQ LN + ++ PYL  Y+N S  AY Y+ +   ++
Sbjct: 771  LFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRV 830

Query: 839  YFSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAE--LSIFNLKNFTMIANE-TMG 895
            YF+N   PSW W   +   +Y++NQSLL  G+ SS  +   L++ N   + +IANE    
Sbjct: 831  YFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSS 890

Query: 896  SNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSF 955
              ++I+ +VNF  N++ ++GGNF M   NC GLCL+NY + +WS+F + +  G +  +  
Sbjct: 891  QQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQL 950

Query: 956  SAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTS 1015
               S+L++SGLF T+   S+ +AS NL N+ +  L +G      SF V ++ IVAWN+T+
Sbjct: 951  FNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTA 1010

Query: 1016 LLIYRDQEWNITSVPG-NDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIP 1074
            L IY D  W +  +   N SS+  V  +N       L++R T++++    +L+SG     
Sbjct: 1011 LSIYEDNVWTVERISNINSSSV--VDNLNYVTLASALSKRDTSSSD---AILVSGQLYDN 1065

Query: 1075 DYGNLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIP-LSNLNVTETGX 1133
             YG++Q +++DF +W PY +  S + S+ N   FI+RD+S+  N+Q+  L+N        
Sbjct: 1066 SYGHIQAMVYDFSSWVPYLLINSESDSSINA--FIDRDMSSFTNTQVALLTNSGTVSNSS 1123

Query: 1134 XXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEG 1193
                                  +IDRGFVVL+GLALALGTV+VLGIAGVI+AYVF+D  G
Sbjct: 1124 SSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNG 1183

Query: 1194 DYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             Y+PI PRIDENEM++TVPPEKLMK++
Sbjct: 1184 AYEPINPRIDENEMIETVPPEKLMKYI 1210

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1223 (40%), Positives = 749/1223 (61%), Gaps = 31/1223 (2%)

Query: 17   ASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISP 76
             S+ASQL N+K  L I    +P +N    N N +QIL  ++ L+ Y+Y GQQNFT  I  
Sbjct: 16   VSQASQLTNVKDSLGINTVNIPQINFGNTN-NEIQILSNIEGLTFYQYQGQQNFTGSIDT 74

Query: 77   GTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLS 136
             +N+ GL+YYSN+T I++ + SD+T+ID+I P   D+FILSGSGT+    + NQ+LYNLS
Sbjct: 75   NSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLS 134

Query: 137  TLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGG 196
             LS+ P+F+  L +++S+L++   VYFGGNFSY + + T +S + W+ ++    +LPF G
Sbjct: 135  DLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIG 194

Query: 197  FGENSNVNSIIKLNDDNILFAGKFYTLDDSSALIT--AGXXXXXXXXXLLNATKLELGQR 254
            FG+NS VNSI+KL++DN+LF G F TLDD S L++                 T LEL Q+
Sbjct: 195  FGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQQ 254

Query: 255  IPLRYATW----DFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLY 310
            I L+YA+W    D + ST F     +CPN   +AW    T+G + C L +E S +K+R++
Sbjct: 255  ISLKYASWASLGDLKSSTQF-----ICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIF 309

Query: 311  NSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSP 370
            NS     +I+ F+I+T PSN IMNLTYLDPL+ ++K CD FCPLYS   L ++S+N ++ 
Sbjct: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTS 369

Query: 371  MDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFST 430
                +F++ N T++ WS+D+Q+FAF N++PVT L+  A+ SYG +VGLSG +LYQ+++S 
Sbjct: 370  ASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429

Query: 431  YANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIV 490
            +ANNSLNE  C                WY GL  +SYIAT+Y P  D+P+P VNFYP+I 
Sbjct: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG-DDPSPLVNFYPSIN 488

Query: 491  HPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGY 550
              G+Y +N YTPGC  D TCS RGIVNVT+W+     ++ T  IYQNN+ +KYDQ++ G+
Sbjct: 489  RIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGF 548

Query: 551  LDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE--YIPLNGVL 608
            LD++P++ LEY SGI+  N+  VVVAD V+++ + ++   T+    ++ E   +PLNG+ 
Sbjct: 549  LDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMF 608

Query: 609  QYQ-KSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGL 667
            QYQ  +  +S  ++  K+ NT+LN+F V  + ++ SL+     + L+LGG+   +  + L
Sbjct: 609  QYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSL 668

Query: 668  NDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVFNYSRTV 727
            ++   +  +      G+V G    + G+++FG+              G+F++  N +  +
Sbjct: 669  SNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSNI 728

Query: 728  NSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRM 787
             +  N++   ++++ F+N+Y  NTS+S+ I N+++ SLS+WSAGSN   D LFSG ++R 
Sbjct: 729  ATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRN 788

Query: 788  QFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPS 847
            +F  LN SA        Q+L L N + PYL  YLN+S TAY Y+++  + I FSN +  +
Sbjct: 789  EFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGN 848

Query: 848  WNWSTSITRMLYANNQSLLTVGSESS---TTAELSIFNLKNFTMIANETMGSNAKINALV 904
            WN   S++   Y++N+++  VGS  S   + AEL + N     ++ NET   N+ IN++V
Sbjct: 849  WNLPRSVSSAYYSDNETMF-VGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIV 907

Query: 905  NFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVIS 964
            +F +NSSLLVGG+F     NCS LCL N  +  WS+ F+N F G IT L F+  S+L+IS
Sbjct: 908  SFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSS-FSNKFDGTITGLEFANDSRLLIS 966

Query: 965  GLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEW 1024
            G +  E    + L   +L N     LL+ ++ K+NSF     +IVAW+ +++  YR   W
Sbjct: 967  GSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGDSW 1025

Query: 1025 NITSVPGNDS--SIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGL 1082
            +   +P  +S  SI +V  ++      + N  + N  +   ++L+ G     DYG +Q +
Sbjct: 1026 SNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDE--LILVFGELYSEDYGFVQAM 1083

Query: 1083 LFDFETWSPYFVSESSNTSNRNP-TIFINRDVSTEFNSQIPLSNLNVTETGXXXXXXXXX 1141
             +DF+ W PY++++  ++ N +  ++F+N+D+S  + SQ+ L N N T +          
Sbjct: 1084 FYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSAT 1143

Query: 1142 XXXXXXXXXXXX----XXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKP 1197
                              +I RG+VVLIGLALA+GTV++LGI GV +AY+F D +G+Y  
Sbjct: 1144 TRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVR 1203

Query: 1198 IKPRIDENEMLDTVPPEKLMKFV 1220
            IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1204 IKPRIDEHEMLDTVPPEKLMKFI 1226

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1237 (40%), Positives = 740/1237 (59%), Gaps = 69/1237 (5%)

Query: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKE 73
            L Q    SQL ++K  L+I+D  +P +++S   ++ + +LG  + L+ Y YTGQ+NFT  
Sbjct: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73

Query: 74   ISPGTNSRGLVYYSNNTYIQVEDASDD---TRIDKITPFGADSFILSGSGTINNMPIGN- 129
            I+     + L+YYSN T+I+++  SD+     I+ I PFG DSFILSG+GT   +P G+ 
Sbjct: 74   ITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGT---LPGGHN 128

Query: 130  ---QILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSIS 186
               Q+LYNLS+L    IF+Q + +V  +L +   VYFGG F Y  G+ TGHS ++W+S +
Sbjct: 129  LEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTT 188

Query: 187  NKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXXXLLNA 246
            N+ QLLPF GFG +S VNSI++L++DNI+FAGKF TLDD++ L               NA
Sbjct: 189  NEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSK-----NA 243

Query: 247  TKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATS-GTLVCKLPYEVSPT 305
            T +E  Q IPL++A W  QGS   E +SL+CP+ + D W    T+ G     L  ++ P+
Sbjct: 244  TDIEFDQLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPS 301

Query: 306  KVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQ 365
            K+R+YN+ DSD ++S+F+I+T+P+N IMNLTYLDP +G+L  CD +CPL S   L  A  
Sbjct: 302  KLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEA 361

Query: 366  NVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQ 425
            NV+   D ++++ NNNT++KW+S +Q+FAF NE+ V  L F A++SYG SVGL G E+YQ
Sbjct: 362  NVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQ 421

Query: 426  DTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNF 485
            + + T+AN++LN+  C                W  G    SYI + Y    D   P VNF
Sbjct: 422  NGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGD--LPSVNF 479

Query: 486  YPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQ 545
            YPNI + G Y +N  TPGC  D +CSSRGIVNVT+W+  N T++ T  IYQNN++ KYD 
Sbjct: 480  YPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDL 539

Query: 546  IYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLD----AFSTLSESANTKEY 601
            +YSGYL+ +P+I L++   I+T ++ +++VAD+V+VI   +D       T++E+      
Sbjct: 540  LYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET------ 593

Query: 602  IPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNH 661
              LNG+ QYQ SNFT+ +++  KIGNTT+N ++++N P+NS LFA    + L++ G  N 
Sbjct: 594  --LNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNG 651

Query: 662  ISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVF 721
            I+++ LND+L ++  ++    G   G+   S GLL  GD              G+F +  
Sbjct: 652  IAVLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFG 711

Query: 722  NYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFS 781
            N    +    NI++ +++L+VF+N YI N SS+  I N++SF+LSLWSAGSN  +D +  
Sbjct: 712  NLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILV 771

Query: 782  GAVSRMQFGGLNGSARFLSEDKVQALNL---DNAVVPYLAAYLNESTTAYAYETN----- 833
            GAVS+ Q+  LNG+      + +  + L   D   V Y A Y+N+S+TAYAY +      
Sbjct: 772  GAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRV-YTATYINDSSTAYAYSSKNDSTH 830

Query: 834  --LLNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTT--AELSIFNLKNFTMI 889
              L+ +   S ++  S  WS ++  M+Y  + SLL VG+ +  T    LS+FN+ N  MI
Sbjct: 831  HVLIARGNRSEDLPVS--WSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMI 888

Query: 890  ANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPN--CSGLCLYNYESKSWSTFFNNTFF 947
              E +G+ + +NA+V F KNSSLLVGG+F + K +  CSGLCLYNY +  WS F+NN+  
Sbjct: 889  GEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSIS 948

Query: 948  GEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVV---T 1004
            G IT L F   +QL+ISG   TE    + LA  N+  S  + +L      + SFV    T
Sbjct: 949  GNITDLQFFNGTQLLISGNLYTENETGINLAKLNMA-SNEVTILRHGSTMVQSFVTFDHT 1007

Query: 1005 EESIVAWNDTSLLIYRDQEW-NITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGT 1063
             + ++  +D  +  Y + EW N+TS   NDS       I        L + ++    +  
Sbjct: 1008 TDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLI-------PLKQTSSKRDVSNR 1060

Query: 1064 ILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPL 1123
             LL++G+     YG++  +L+DFE W PYF+ +  N + R   IF+N+D+S+ + +Q  L
Sbjct: 1061 ALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGEN-AGRASNIFMNKDLSSLYTTQTIL 1119

Query: 1124 SNLNVTETGXXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVI 1183
               N + +                        +IDRGFVVLIGLALA+GTV+VLG AG I
Sbjct: 1120 QGSNTSTS-----TTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAI 1174

Query: 1184 LAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            +AY F   +G Y+P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1175 IAYFFAGNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1216 (39%), Positives = 717/1216 (58%), Gaps = 25/1216 (2%)

Query: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKE 73
            LA  + AS L NI  LL+I++  LPNLN + + SN++Q+LG V+ L  Y Y GQQNFT +
Sbjct: 16   LANNATASSLSNILKLLNIQEFELPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDD 74

Query: 74   ISPGTNS-RGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQIL 132
             + G +S   L+YYS++  IQ+E  S+DT I KI P G DSF+LSGSG +N   +G Q+L
Sbjct: 75   GNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLL 134

Query: 133  YNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLL 192
            YNL+TLS+ PIFDQ LG++ S+L++   VYFGG F+Y   S    S + W+  S++   L
Sbjct: 135  YNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIEL 194

Query: 193  PFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALI-TAGXXXXXXXXXLLNATKLEL 251
            PF GFG +S VNSI+KLNDDNILF G F TL +SS L                N++ ++L
Sbjct: 195  PFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQL 254

Query: 252  GQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYN 311
             Q+I L+YATWD  G+  F+ N+ VC   + +AW+    SG L    P  VSP+K+R+YN
Sbjct: 255  EQQISLKYATWD-AGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYN 313

Query: 312  SQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPM 371
            +  ++  +S+F+I+T+PSN IMNLTY+DPL+G+LK CD FCPL + + L +AS N +S  
Sbjct: 314  ANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSET 373

Query: 372  DMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTY 431
                F++NN T V WS  +Q+FAF N + V+ L   A +SYG    LSG+EL+QD+ + Y
Sbjct: 374  RQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAY 433

Query: 432  ANNSLNEYGCXXXXXXXXXXXXXXXX-WYNGLGGESYIATEYVPNQDEPTPRVNFYPNIV 490
            ANN+LN+ GC                 WY GL  +SYIA  Y  +   P P V FYPNI 
Sbjct: 434  ANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANY-QSDSSPLPTVQFYPNIQ 492

Query: 491  HPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGY 550
              G + I  YTPGC+ D TC SR IVNVT+ +P + T++ T  IYQNN+ +KYD+I++G 
Sbjct: 493  AVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGK 552

Query: 551  LDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQY 610
            L  SPEI L + S I     + ++VAD+V++    ++    L +S      + LNG+ QY
Sbjct: 553  LTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQY 612

Query: 611  QKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLNDN 670
            Q SNFTS T  +TK+GN +++  A+  +P++ SL  +T  + + L G+ ++I  + LN +
Sbjct: 613  QLSNFTSDT--KTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSD 670

Query: 671  LEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXX-XGSFENVFNYSRTVNS 729
            LE+  +      G+   +   SQGLL FG                G+F +       V +
Sbjct: 671  LELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTT 730

Query: 730  AINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQF 789
              N +   ++L+ F+NDY+ N SS + I N+T F+ S+ + G+N N+D L  G + R ++
Sbjct: 731  FANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEY 790

Query: 790  GGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPSWN 849
               N   +      +++L   +++VPY A +LN++   YAY+    +KI + NN+  S +
Sbjct: 791  SNFNEPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLD 850

Query: 850  WSTSITRMLYANNQSLLTVGSESST-TAELSIFNLKNFTMIANETMGSNAKINALVNFEK 908
            +S ++ ++ ++NN SLL   + ++  ++ L I N+ +   +A+E + +   I ++++F  
Sbjct: 851  FSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNS 910

Query: 909  NSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFD 968
            N+++LV GNF +   +C G+CLYNY +K WS F N+T  G I ++    + Q++ISGLF 
Sbjct: 911  NNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFS 970

Query: 969  TEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITS 1028
             + Y S+ LAS ++    +  L   ++ +I+SF+   +SI  W++ +++ Y+ ++WN  S
Sbjct: 971  AQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEIS 1030

Query: 1029 VPGNDSS-IGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFE 1087
             P   S  I SV  ++ +    T N           IL   G F+   YG L  +LF   
Sbjct: 1031 FPNTTSKYIESVEAVSIDLQNSTSNVSK--------ILFAYGEFNSTLYGRLNAMLFRAG 1082

Query: 1088 TWSPYFVSESSNTSNRNP--TIFINRDVSTEFNSQIPL-SNLNVTETGXXXXXXXXXXXX 1144
             W PYF S ++   N +P  T+F NRD+S+ FNS+  L +N+   ET             
Sbjct: 1083 DWKPYF-SINNFQVNEDPAITLFENRDLSSLFNSKNSLPANITSAETS-SRSTVSSATAT 1140

Query: 1145 XXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDE 1204
                       +IDRGFVVLI LALA+GTV++LG+ GV +AY+F+D E  Y+ IKPRID 
Sbjct: 1141 TVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRD-EQKYESIKPRIDG 1199

Query: 1205 NEMLDTVPPEKLMKFV 1220
             EMLDTVPPEKLMKF+
Sbjct: 1200 QEMLDTVPPEKLMKFI 1215

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1265 (37%), Positives = 704/1265 (55%), Gaps = 74/1265 (5%)

Query: 20   ASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQIL--GGVDALSLYEYTGQQNFTKEISPG 77
            A+QL ++K +L+IE+   P  N+    + ++Q+L   G D L+   Y GQQNFT+ I   
Sbjct: 23   ANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIISS 82

Query: 78   TNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLST 137
            + +  L+YYSN+TYI++ D    TRI  I P+G D+FILSG+G++N   + NQ++YNL+ 
Sbjct: 83   SQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTD 141

Query: 138  LSMAPIFDQPL-GSVESVLINGTS--VYFGGNFSYN-NGSMTGHSALIWDSISNKTQLLP 193
            LS+ PIF+  L   V ++  +  +  VYFGGNFSY    S   +  +IWDS SN T    
Sbjct: 142  LSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYE 201

Query: 194  FGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSAL-ITAGXXXXXXXXXLL---NATKL 249
            FGGFG NS +N+I+KLN +++LF+G+FYTLDD S L I            LL   N +  
Sbjct: 202  FGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTF 261

Query: 250  ELGQRIPLRYATWDFQGSTTF-ESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVR 308
            EL QRIPL +  +    +  +   N L+CP +  +AW   + +G+L   LP+ + P+K+R
Sbjct: 262  ELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIR 321

Query: 309  LYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVS 368
            ++NS D D E++ F+I     NSIM+L YLDPL G+LK C EFCPLY+R  L   + N +
Sbjct: 322  IFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDN 381

Query: 369  SPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTF 428
                +I+ LDNN TD+KWS+ +Q+FAF N+  +T L+F A++SYG  VGLSGL L+Q   
Sbjct: 382  LKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDI 441

Query: 429  STYANNSLNEYGCXXXXXXXXXXXXXXXX---------------WYNGLGGESYIATEYV 473
            + +AN S N+  C                               WY  L    Y+A  Y+
Sbjct: 442  AVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYL 501

Query: 474  PNQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYT 533
             +  +  P V FYPN+++ G+Y ++  TPGC  D++C SRGIVNVTMWN  + ++++T  
Sbjct: 502  -SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSL 560

Query: 534  IYQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLS 593
            IYQ N+N K+DQI++GYLD   +I + + SG++++     +VAD++N+I   LD  +T S
Sbjct: 561  IYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTS 620

Query: 594  ESANTKEYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADT-NGDR 652
             +      + LNG+ QY + N  S  +      N+T+N +A  NYP N SL A   + D 
Sbjct: 621  SNEIDIYNVTLNGLFQYPEYN--SVNNLNENYTNSTINQYAYSNYPANVSLIAAAYDKDT 678

Query: 653  LILGGTNNHISIIGLNDNLE-VVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXX-XXXXX 710
            L++GG+ N +    +  N + + L         V G+   S GL+ +GD           
Sbjct: 679  LLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAI 738

Query: 711  XXXXGSFENVFNYSRTVNSAINISLANN-DLIVFDNDYIVNTSSSAQILNSTSFSLSLWS 769
                  F  + N++  + S  NISL  + +++ F+N Y  N S+     N+++F LSLWS
Sbjct: 739  TFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWS 798

Query: 770  AGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYA 829
            AG N  +D++FSG VS  +   L G     + ++++ LNL N + PY A +LN+S+T YA
Sbjct: 799  AGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYA 858

Query: 830  Y-ETNL-LNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVG--SESSTTAELSIFNLKN 885
            Y E N  LN++  SN    SW+W   I+ M +  N+SLL+VG  S+       SI NL +
Sbjct: 859  YMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTS 918

Query: 886  FTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNT 945
              +IANET+  N++I++L+ F KNSS+LVGGNF  S   CSGLCL+NYE+K+WSTF NNT
Sbjct: 919  NKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNT 978

Query: 946  FFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTE 1005
              G +++L     S ++ISG   T +  ++ LA  NL    +  LL      + SF  T 
Sbjct: 979  LEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILLQNT--NLTSFEFTG 1036

Query: 1006 ESIVAWNDTSLLIYRDQEWNITSVPGNDSSIG----SVSTINTNAGPGTLNRRATNNAEN 1061
              I AWN ++L  Y ++ W+   +P    S+     S+  I        L +RA  +   
Sbjct: 1037 NQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTN- 1095

Query: 1062 GTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSN---TSNRNPTIFINRDVSTEFN 1118
              I++ +G F     G +Q L +  +TW PYF    +N   TSN +  IF N+D+S++  
Sbjct: 1096 --IMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSN-SINIFPNKDISSKII 1152

Query: 1119 SQIPLSN--LNVTETGXXXXXXXXXXXXXXXX---------------------XXXXXXX 1155
            S   L N   N+++ G                                            
Sbjct: 1153 SDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKKH 1212

Query: 1156 RIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEK 1215
            +I RGFVVLIGLAL+L TV++LGI G++L+++F+D  GDY+ +KPR  E+EM D VPPEK
Sbjct: 1213 KIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVPPEK 1272

Query: 1216 LMKFV 1220
            LM FV
Sbjct: 1273 LMPFV 1277

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1240 (37%), Positives = 719/1240 (57%), Gaps = 73/1240 (5%)

Query: 3    VHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLY 62
            V+ LW     F    ++AS L+N++ +L+  +  +P  ++   N N  QIL  ++ +S Y
Sbjct: 6    VYCLW-----FAVAITRASNLENVRRILNATEVTVPTFDVGNKN-NQFQILDDINGISFY 59

Query: 63   EYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDA-SDDTRIDKITPFGADSFILSGSGT 121
            EY GQQNFT + +  T+ + L+YYSN T++ + D+ + + +I  I P G DSFILSG G 
Sbjct: 60   EYLGQQNFTTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118

Query: 122  INNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALI 181
            INN+ + +Q+++N++ LS+  IFD PL S+E V ++G  VYF GNF++NN +     A++
Sbjct: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIM 174

Query: 182  WDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXX 241
            WDS      LLPF GFG  +N+NSI+KLNDDNILFAG F T+ +SS L+ +         
Sbjct: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEES--- 231

Query: 242  XLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYE 301
             + N T L L   +PL+Y+ W   G    +S+ L+CP+ ++D+W   AT+G   C+LP++
Sbjct: 232  -VRNTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQ 288

Query: 302  VSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLL 361
            ++P+K+R+YNS D D ++S+F+ LT P+ SIMNLTYLDPLSG + +CD FCPLYS+  L 
Sbjct: 289  ITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQ 348

Query: 362  SASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGL 421
            S   N ++  + ++ ++NN+T+++W+ ++Q+FA  + +  T L+F A+ SYG ++GL+G 
Sbjct: 349  SQWDN-TAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGF 407

Query: 422  ELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLG--GESYIATEYVPNQDEP 479
            ++YQ +FS + NNS N   C                  N     GE Y+   Y PN++ P
Sbjct: 408  QIYQASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVGE-YLTVGYTPNEN-P 465

Query: 480  TPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNND 539
             P+V +  +I H G Y IN +TPGC  D+TCS+RGIVN T+++     M+ T  IYQNND
Sbjct: 466  VPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNND 525

Query: 540  NLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTK 599
             +KYD +YSG L+ S EI + Y SG++ SNT T +VAD+V++  + +D    LS      
Sbjct: 526  EIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVS 581

Query: 600  EYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFA-DTNGDRLILGGT 658
            + + LNG+ QYQ SNFT+  S   KI NT+LN FA++N+  + SL A   +   ++L GT
Sbjct: 582  K-LALNGLFQYQISNFTND-SIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGT 639

Query: 659  NNHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFE 718
              ++  I LN +L V  S + I   +       S GL++                    +
Sbjct: 640  EGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFK---------D 690

Query: 719  NVFNYSRTVNSAI-----NISLANNDLIVFDNDYIVNTSSSAQIL-NSTSFSLSLWSAGS 772
            N  N + T++ ++     NI+L  ++L+VF+N YI N +S  Q   NS+ F+L++ SAG+
Sbjct: 691  NFKNLNTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGA 750

Query: 773  NGNDDVLFSGAVSRMQFGGLNGSARFLSE--DKVQALNLDNAVVPYLAAYLNESTTAYAY 830
            N  +D +F G V + Q+   N SA+  ++  D ++ ++L +  VP    +LN+ +T Y Y
Sbjct: 751  NSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFY 810

Query: 831  ETNLLNKIYFSN-NVDPSWNWSTSITRMLYANNQSLLTVG--SESSTTAELSIFNLKNFT 887
            + +  +K+Y +N N      W      ++Y  N +LL VG  ++++ ++ LS+ NL +F 
Sbjct: 811  KESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFD 870

Query: 888  MIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFF 947
            +I  E +   + I++L+ F KN +LLV G+F+ S  NCS LCLYNY+S  W +  NN+  
Sbjct: 871  VIKEENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVS 930

Query: 948  GEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKIN--SFVVTE 1005
            G +  L       +++ G     +   V +A  NL+N+ +  L+   +  +N  S +V+ 
Sbjct: 931  GSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSN 990

Query: 1006 ESIVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTIL 1065
              IVAWNDT L  +    W   SVPG DSS  S+S++        ++   T++A     L
Sbjct: 991  SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQF------ISMEGTDDA-----L 1039

Query: 1066 LLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPL-- 1123
            LL G F   ++G+++ ++++F  W PY +            +F+NRD+S    +QIPL  
Sbjct: 1040 LLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTG-HLFMNRDISLHNIAQIPLLN 1098

Query: 1124 -----SNLNVTETGXXXXXXXXXXXXXXXXXXXXXXXRI-DRGFVVLIGLALALGTVSVL 1177
                 +N +   +                        RI DRGFVVLIGLALAL TVSV+
Sbjct: 1099 STRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVM 1158

Query: 1178 GIAGVILAYVFKDPEGD-YKPIKPRIDENEMLDTVPPEKL 1216
            G+AGV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1159 GVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1228 (35%), Positives = 681/1228 (55%), Gaps = 48/1228 (3%)

Query: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKE 73
            LA+    S L  ++S L +E   +PNL++S+  +N VQ+LG    +++ +Y+GQ+NFT E
Sbjct: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73

Query: 74   ISPGTNSRGLVYYSNNTYIQVEDASDDTRI---DKITPFGADSFILSGSGTINNMPIGNQ 130
            +S G     L+YYSN T++++  +SD + +   D I PF  D+FILSG+G+I+   +  Q
Sbjct: 74   VS-GNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQ 132

Query: 131  ILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQ 190
            +L+NLS+L    IF Q L  V ++  NG  V+FGG+F Y   + T HS L+WDSI +  +
Sbjct: 133  LLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVE 192

Query: 191  LLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXXXXLLNATKLE 250
            +LPFGGFG+NS VNSI+ L++ NILFAG F  +D++  L               N +  E
Sbjct: 193  VLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTS------NTSVPE 246

Query: 251  LGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYP-ATSGTLVCKLPYEVSPTKVRL 309
            LG +I L+ A W   G  T + +++ CP+     W+   +T G     +P E  P+K+R+
Sbjct: 247  LGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRV 304

Query: 310  YNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSS 369
            +N++DSD ++S+F+I+T PSN IMNLTYLDP +G+L +CD +CPL S   L   S   S 
Sbjct: 305  FNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SY 363

Query: 370  PMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFS 429
            P D + + +N  T ++WS  FQDFAF N +PV+ L F A++SYG SVGL+G+ELY+  +S
Sbjct: 364  PGDQVQYFENRTT-LQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYS 422

Query: 430  TYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQD-EPTPRVNFYPN 488
             YANN+LN   C                W +G    +Y++T     QD E  P V FYP+
Sbjct: 423  VYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSV---QDSETNPFVIFYPS 479

Query: 489  IVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYS 548
            I++PG Y I+  TPGC++D +C +RGI+N T+ + QN T++ +  IYQNND  K+D +YS
Sbjct: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539

Query: 549  GYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVL 608
            G+LD   ++ LE+   I++     V+VA +   I V ++ F       NT  +I  NG+L
Sbjct: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTSGFI--NGLL 594

Query: 609  QYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLN 668
             Y  SN +S  S       T L  ++V   P +S++FA+   D L+L  T+  ++ + L 
Sbjct: 595  HYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLA 654

Query: 669  DNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVFNYSRTVN 728
            +NL +     + I  D+  +++ S GL+I G               G+F N+  ++ TV 
Sbjct: 655  NNLSIEEYTFETIGKDISTISEYSGGLIIVG-TFNGSSEPAARGFNGTFFNLTEFNSTVR 713

Query: 729  SAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQ 788
            +  N++L   ++++FD + I+N ++  +I +++  +L + SAG N  +D LF G V +  
Sbjct: 714  TFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQND 773

Query: 789  FGGLNGSARFL---SEDKVQALNLDNAVVPYLAAYLNESTTAYAY--ETNLLNKIYFSNN 843
            +  LNGS  F+   SE+  Q        +PY AA+++ STTAYAY    N  N    S  
Sbjct: 774  YTNLNGSF-FISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVM 832

Query: 844  VDPSWN-----WSTSITRMLYANNQSLLTV-GSESSTTAELSIFNLKNFTMIANETMGSN 897
             D         WS  +  M  + N SLL + G +  T ++L + N  +   +A+    S 
Sbjct: 833  NDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSE 892

Query: 898  AKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSA 957
              +N+++ F +N+S+LVGG+F+++   CSGLCL+NY+ K WS F NN+  G I ++    
Sbjct: 893  ISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFN 952

Query: 958  ASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEES---IVAWNDT 1014
             S L+I+G F   E   V LAS  L +S+   +L      +N FV  + S   +VA++DT
Sbjct: 953  NSNLLIAGSFRLNETDGVSLASICLKDSSS-EILHEGNITLNGFVSMDGSSNNVVAFSDT 1011

Query: 1015 SLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIP 1074
            SLL     +W   S    ++S         +  P     R      +  +LL++G+    
Sbjct: 1012 SLLQLESGKWQQISTNFTENS----KFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHA 1067

Query: 1075 DYGNLQGLLFDFETWSPYFVSESSNTSNRNPT--IFINRDVSTEFNSQIPLSNLNVTETG 1132
             +G++    +D   W+P+  S  + +S+   T  +F+NRD+S   + +  L     + T 
Sbjct: 1068 KFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNT- 1126

Query: 1133 XXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPE 1192
                                   +IDRGF+VLI LALALGT++VLG+ GVI +Y F D  
Sbjct: 1127 SSGTSGTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSG 1186

Query: 1193 GDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
              Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1187 DGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1231 (35%), Positives = 671/1231 (54%), Gaps = 49/1231 (3%)

Query: 11   FPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNF 70
            F  +A+    + L  I+S L +++  +P+L++S  N+  +Q+LG    L+ Y YTGQ NF
Sbjct: 11   FLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNF 70

Query: 71   TKEISPGTNSRGLVYYSNNTYIQVED---ASDDTRIDKITPFGADSFILSGSGTINNMPI 127
            T  IS       L+Y+SN T +++     +++   +D + P   DSFILSG+G I+   +
Sbjct: 71   TG-ISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVL 129

Query: 128  GNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISN 187
             +Q+++NLS LS   IF+Q L  V ++ +NG   YFGG+F +       H  ++WD + N
Sbjct: 130  DHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKN 189

Query: 188  KTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSAL-ITAGXXXXXXXXXLLNA 246
            + + LPFGG G++SNVNSI+ L+D+NILFAG F T+D+ SAL  T G             
Sbjct: 190  EVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSD------- 242

Query: 247  TKLELGQRIPLRYATWDFQGSTTFESNSLVCP-NANEDAWVYPATSGTLVCKLPYEVSPT 305
            +  EL  +IPL+ A W   GS   + + LVCP N+   AW+   T+G     + + + P+
Sbjct: 243  SAPELSHKIPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPS 300

Query: 306  KVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQ 365
            K+RL+N++  D E+S+F+++T PSN IMNLTYLDP SG+L+ CD +CPL S   L +A  
Sbjct: 301  KLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKS 360

Query: 366  NVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQ 425
              +S  D + FL NN T V+WS  +QDFAF N +PVT + F A++SYG SVG++G ELY+
Sbjct: 361  KAAS-TDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYE 418

Query: 426  DTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEPTPRVNF 485
            D FS YAN+S N   C                W  G   E Y+ T  V N  E  P V F
Sbjct: 419  DDFSVYANDSFNVPDC-SSTSNYSKASLSASQWDQGSSDEDYVYT-LVENSQEA-PSVTF 475

Query: 486  YPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQ 545
            YP IV+ G Y IN  TPGC+ D +C SR +VN ++W+  N T++ + TIYQNND  KYD 
Sbjct: 476  YPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDN 535

Query: 546  IYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLN 605
            +YSGYL+   +++LEY   I  +  + ++VA Q++V T   D+ S  ++   T +   LN
Sbjct: 536  LYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS-SVFTDKYKTGK---LN 591

Query: 606  GVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISII 665
            G+L Y  SN +S   N     +T L  ++V N+  NS+ F D   + ++L  ++  +S +
Sbjct: 592  GLLHYSLSNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKL 651

Query: 666  GLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXXXXXXXGSFENVFNYSR 725
             ++   +V     + +  +V G+   S+GL + G               GSF ++     
Sbjct: 652  EIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIG--TFDGSTKGAKFYNGSFFDIPLSHS 709

Query: 726  TVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVS 785
             V +  N +L   +L+   N Y +NT++     NS+  +L+  SAG N   + +F G+++
Sbjct: 710  NVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLT 769

Query: 786  RMQFGGLNGSARFLSEDKVQA-LNLDNAVVPYLAAYLNESTTAYA-YETNLLNKIY---- 839
            R ++  LNGS    S  +  + L      + Y A Y++ STT YA Y+ +  N  Y    
Sbjct: 770  RNEYTDLNGSFFISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVSI 829

Query: 840  ---FSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTA-ELSIFNLKNFTMIANETMG 895
                +   D S+ W+  +  MLY+ N SLL +G ++ T + +L + NL      A     
Sbjct: 830  YKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWK 889

Query: 896  SNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSF 955
            +N  IN+L+ F++N+S+LVGG+F  S+ NCSGLCL++YE K WS FF+N   G I  +  
Sbjct: 890  TNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKI 949

Query: 956  SAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTE---ESIVAWN 1012
               S LV+ G FD  + + V LAS +LT+ +   L  G E  I  F+  +   +++VA +
Sbjct: 950  FNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTE-TILDFIFVDGKVDNLVAVS 1008

Query: 1013 DTSLLIYRDQEWNITSVPGNDSSI-GSVSTINTNAGPGTLNRRATNNAENGTILLLSGNF 1071
               L    +  W   S   +DSS+ G +S      G     R    N+     LL++G+ 
Sbjct: 1009 ANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNS-----LLITGDL 1063

Query: 1072 SIPDYGNLQGLLFDFETWSPYFVSESSNTSN--RNPTIFINRDVSTEFNSQIPLSNLNVT 1129
                YG +   L+DF  W PYF +  + +++      I+ N+D+S+ FN Q  L + +  
Sbjct: 1064 LHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQS-SRG 1122

Query: 1130 ETGXXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFK 1189
                                      +I RGFVVLIGLALA+GT++V+G+ G+ L + F 
Sbjct: 1123 GNSSSVPSGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFG 1182

Query: 1190 DPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
                 Y+ ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1183 KSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1184 (35%), Positives = 657/1184 (55%), Gaps = 36/1184 (3%)

Query: 40   LNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASD 99
            LN S   +N +Q+LG ++  + Y Y GQQNFT   S   N   L+YYSNNT ++++    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPT 60

Query: 100  DTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGT 159
            D  +  I PF  D FILSG GTI+ + +  QIL NL+ LS  PIF++ LG V+S+ ++  
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 160  SVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGK 219
             VYFGG+ +YNN  ++G S + W+S +N + LLPFGGFG NS VNSII+L ++N+LF G+
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 220  FYTLDDSSALITAGXXXXXXXXXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPN 279
            F  L+++S +              ++    E+GQ+I LR ATW+   ++  + ++ +CPN
Sbjct: 181  FAKLENNSFVSKTNRTRNFS----ISMEDSEVGQQISLRQATWN--ANSNLDVDAFICPN 234

Query: 280  ANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLD 339
            +++ AW    + G + C  P  ++ +K+R+YN+  +D +IS+F+++  P N I+NLTYLD
Sbjct: 235  SDQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLD 294

Query: 340  PLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANEL 399
            P+S  +K+C E CPL++R TLL+A  NV+   D+I F++NN+T++KW+  +Q+FAF N+L
Sbjct: 295  PISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQL 354

Query: 400  PVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWY 459
            P+T L+F A NSY ++VGLSG ++YQD+F  + NNS NE  C                W+
Sbjct: 355  PITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWF 414

Query: 460  NGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVT 519
                  SY+A  Y+PNQ    P + ++  I  PG Y++N  TPGC +D+TCS+RGIVNVT
Sbjct: 415  TVANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVT 473

Query: 520  MWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQV 579
             ++  N  ++ +  IYQNN+NLKYDQI++G L+ S  + +EY SGI+T NT T  V   V
Sbjct: 474  TFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINT-NTGTATVVVGV 532

Query: 580  NVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTSTTSNET-KIGNTTLNVFAVDNY 638
              +  +  +   +S+  +    + LNG+ +Y  SNFT      T KI  T L+ F V N+
Sbjct: 533  VDVVRVSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNF 592

Query: 639  PNNSSLFADTNGDRLILGGTNNHISIIGLND-NLEVVLSEKQIIQGDVHGMTQTSQGLLI 697
               +S+FA      L LG TN   S+  LN  N   V S +  + G ++GM    +GL+I
Sbjct: 593  NKGASIFAVDQNQNLYLGSTNG--SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVI 650

Query: 698  FGDXXXXXXXXXXXXXXGSFENV-FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQ 756
            FG                S   +    + ++ ++ N +L  ++L+VFDN  I N +S   
Sbjct: 651  FGSIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMV 710

Query: 757  ILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPY 816
              N++  +L L +AG N NDD+L  G +        N S    S       +L +     
Sbjct: 711  FENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIE 770

Query: 817  LAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTA 876
             A YLN++   Y+  +  +N    S+     W W +++  + Y+N Q LL    E+S  +
Sbjct: 771  GAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKS 830

Query: 877  ELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESK 936
            ++ + +L +  +I +    +  KINA+VNF  N++ LVGG+F +S P C GLCLYNY + 
Sbjct: 831  QIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNS 890

Query: 937  SWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEG 996
            +WS+F NN+  G I+Q+ F+  +Q+++SG  +  +   + L S NLT++    LL     
Sbjct: 891  NWSSFLNNSITGNISQIKFN-DTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSV 949

Query: 997  KINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRAT 1056
             ++ F++    +V WN T + I    +W+  ++  +           TNA   T+NR   
Sbjct: 950  VLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDD----------GTNA---TINRIEN 996

Query: 1057 NNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYF-VSESSNTSNRNPTIFINRDVST 1115
              A++   L++ G F    YG +  +++DF +W PYF V   S T+   P  F +RD S+
Sbjct: 997  FGADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTA--TPLFFADRDQSS 1054

Query: 1116 EFNSQIPLSNLNVTETGXXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGTVS 1175
              N++  + +  +  +                        +I RGFVVLIGLALAL T+ 
Sbjct: 1055 YGNTRHVVPDHIIVSS----SHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALATLI 1110

Query: 1176 VLGIAGVILAYVFKDP-EGDYKPIKPRIDENEMLDTVPPEKLMK 1218
            VLGI GV++A +F     GDY  IK    +N     + PEKL++
Sbjct: 1111 VLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIR 1154

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1247 (35%), Positives = 692/1247 (55%), Gaps = 74/1247 (5%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            MF       +   LA   + SQL NI+ LL+I     PN +     S  +  +   + L+
Sbjct: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
            +  YTGQQNFT +     N   L+YYSN+T++++ + S +T +  I P   DSFILSG+G
Sbjct: 56   VISYTGQQNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTG 111

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
             IN + +  QIL NL++L+ +PIF   + +V  +L    +V F GNFS +  + TGH A+
Sbjct: 112  QINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAV 171

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
            +WD ++N T+L PF GFGENS VNS++KLN DNILFAG F  + ++S L   G       
Sbjct: 172  LWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSH 231

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAW-VYPATSGTLVCKLP 299
              L   T L+  Q +PL+ ++   +     +S+ L+CP+  ++ W    A   TL   L 
Sbjct: 232  EDL---TSLQFDQSVPLKLSSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLK 285

Query: 300  YEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRAT 359
             E+ P+KVR+YNS + + EIS+F+I+T PSN IMNLTYLDP SG+LK CD +CPL S   
Sbjct: 286  NEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIED 345

Query: 360  LLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLS 419
            L   SQN ++    +  ++NN+T++KWS  +Q+FAF N++PVT+L+F A+ SYG +  L 
Sbjct: 346  LTQISQNSTAAPKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALH 404

Query: 420  GLELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEP 479
             +E+++  F  YANNS NE  C                WY     ++YI+T    N D+ 
Sbjct: 405  SIEIFETEFMVYANNSYNEPNC-ESVTEYSKAELSSDNWYTTDESDTYIST----NIDDN 459

Query: 480  TPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNND 539
             P V F+PNI +PG Y  N YTPGC+QD++CS RGIVNVTM +     ++ +  IYQ N+
Sbjct: 460  IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNN 519

Query: 540  NLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTK 599
              K+D +Y+G L  +PEII+ +   I  S+  +V+V D++ VIT  +D   T+S S+N  
Sbjct: 520  EDKFDPLYTGSLGSAPEIIVTWDKAIGESD--SVMVVDRLGVITEYID---TISISSNDT 574

Query: 600  EYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTN 659
             +  LNG+ QY  +N T++  +     N T N +A+ N+P +++L+A +  + +++GG  
Sbjct: 575  TF-HLNGLFQYNTANVTASIFST----NDTFNDYALYNFPLDANLYAASLNNDILIGGNF 629

Query: 660  NHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFG--DXXXXXXXXXXXXXXGSF 717
            N I+ + LND   +  S+K    G   G+ + S GLL+ G                  +F
Sbjct: 630  NGIAKVELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAF 689

Query: 718  ENVFNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDD 777
             +       ++  +N ++  ++L++FDN YI N S++  + NS++F ++  SAG N  +D
Sbjct: 690  NSFGQLDEPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGND 749

Query: 778  VLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNA---VVPYLAAYLNESTTAYAYET-- 832
             L  G+  +   G LNG A   S+ +V +  L      V PY AAY+N+++ AYA +   
Sbjct: 750  SLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGS 809

Query: 833  --NLLNKIYFSNNVDPSW----NWSTSITRMLYANNQSLLTVGSESSTTA-----ELSIF 881
              N+ +++  +N    S      WS  I   LY N  ++L +G+  S ++     + SI 
Sbjct: 810  TDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSIL 869

Query: 882  NLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTF 941
            NL  +  +A     +N ++N++V+F  N+S+LVGG++++   NC+ LCLYNY++K W++F
Sbjct: 870  NLTGYENVARVNFSTNERVNSMVSFSSNNSILVGGSYEID--NCNDLCLYNYQTKEWTSF 927

Query: 942  FNNTFFGEITQLSFSAASQ-LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINS 1000
             N++  G+I Q+ F+   + L++ GL  T    +++L S  + ++    + +G E  + S
Sbjct: 928  LNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-S 986

Query: 1001 FVVTEES---IVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATN 1057
            FV  ++S   I+A  ++ +L      W+      N+ SI  VS     +G  +  R    
Sbjct: 987  FVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSI--VSGFKVLSGTESKKRD--- 1041

Query: 1058 NAENGTILLLSGNFSIPDYGNLQGLLFDFET--WSPYFVSESSNTSNRNPTIFINRDVST 1115
              E   I+LL G  +  ++GNL  +++D  T  W PYFV          P+    ++V+ 
Sbjct: 1042 --EGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVND 1099

Query: 1116 EF--NSQIPLSNLNVTETGXXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLALALGT 1173
             +  +SQ  L + N                            +IDRGF+VLIGLALAL T
Sbjct: 1100 LYLSSSQTVLQSNN-----SDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALAT 1154

Query: 1174 VSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            V+V+G+ G ++ Y F +  G Y+ +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1155 VAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1252 (35%), Positives = 696/1252 (55%), Gaps = 72/1252 (5%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            M++H+   L+  F+A  ++ SQ+  + +  +I     P+L++S   ++ + I        
Sbjct: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60

Query: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120
             Y Y GQQ FT       NS  L+YYSNNTY+Q+ +  D   I KI P+G DSFILSG G
Sbjct: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118

Query: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180
                  + +Q++YNLS+  +  I  +PL  V  +L +G  VYFGG F+YN+G+++GHS +
Sbjct: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178

Query: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXXX 240
             WD+    + LLPF GFG+ S VN+IIKL+D NILF GKF T+D+++ L           
Sbjct: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALL----PHRNVSS 234

Query: 241  XXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYP-ATSGTLVCKLP 299
              L N+T +E      LR+++    G  T  S++ VCP  + D+W  P +T G L  ++ 
Sbjct: 235  SFLSNSTNIETNALASLRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVI 292

Query: 300  YEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRAT 359
             +++P+K+R+YNS+DS+ ++++F+I+T+PS SIMN+TY+DP++G L  CD +CPL   + 
Sbjct: 293  NQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSV 352

Query: 360  LLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLS 419
            L + ++N +S + M +F +NNN  VKW++ +Q+FAF N +P+  L F AI+S+G +VGL 
Sbjct: 353  LSNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLL 411

Query: 420  GLELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVPNQDEP 479
            G+EL+Q  + TY NN+LN+  C                WY GL  +SY+AT +   +   
Sbjct: 412  GIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK--- 468

Query: 480  TPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNND 539
             P V   P+I +PG Y +N  TPGC+ D+TC+ RGIVNVT+   QN T +    IYQNN+
Sbjct: 469  -PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNE 526

Query: 540  NLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTK 599
            NLKYD ++ GYLD SP ++LE++  I  +    V+VAD+V   T ++D+   L     T 
Sbjct: 527  NLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRV---TSIIDSIEDLEMKNGTS 583

Query: 600  EYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTN 659
                LNG+ QY  SNFT+T  + T +G+T ++ + V N P++SSLF     D L +G   
Sbjct: 584  NSNLLNGLFQYAASNFTNTNLS-TLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSP- 641

Query: 660  NHISIIGL------NDNLEVVLSEKQII--QGDVHGMTQTSQGLLIFGDXXXXXXXXXXX 711
               SI GL       D+   ++ + Q+I  +G V G+   S GL +              
Sbjct: 642  ---SIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLAL-TVHSNQTNMASSL 697

Query: 712  XXXGSFENVFNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAG 771
               GS   +F  +    S +N+++  ++++VFDN Y+ N SS + I NS +  LSL SAG
Sbjct: 698  SFNGSISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAG 757

Query: 772  SNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQAL-----NLDNAVVPYLAAYLNESTT 826
            +N  DD++ +G V   +    NG A  +  D  + +     ++D+ ++ Y   ++N+S++
Sbjct: 758  ANLEDDLILAGNVQSTKHFVPNG-AIAIDADSNEVVTSGLPSVDDGII-YRGLFINDSSS 815

Query: 827  AYAYETNLLNK----IYFSNNVDPSW--NWSTSITRMLYANNQSLLTV--GSESSTTAEL 878
            AYAY +  L      I      +P +     +++  MLY  + +LL V     S   A L
Sbjct: 816  AYAYYSKSLGSSKGGIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASL 875

Query: 879  SIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSW 938
             I +L        ET      IN +V F +N +LLVGG F  ++  C  LCLYNY + +W
Sbjct: 876  YIHDLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNW 933

Query: 939  STFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKI 998
            + F +    G+I QL F   + L+++GL  + + + ++L   +L+N  +I  L G     
Sbjct: 934  TRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGT 993

Query: 999  NSFVVT----EESIVAWNDTSLLIYRDQEW-NITSVPGNDSSIGSVSTINTN-AGPGTLN 1052
               V+T       ++A +   +  + D +W NI+      + I  ++ ++T+ +   ++ 
Sbjct: 994  FQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIM 1053

Query: 1053 RRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYF--VSESSNTSNRNP--TIF 1108
            +R     E   +++++GNFS PDYG++  + +DF  W+PY+  V   SN+    P   +F
Sbjct: 1054 KRDRVGNE---LVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLF 1110

Query: 1109 INRDVSTEFNSQIPLSNLNVTETGXXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGLA 1168
            +N+DVS   +SQI LSN N  +                         ++ + FVVLI LA
Sbjct: 1111 LNKDVSFTSSSQIYLSNDNDND---------DTPAASEPATHEKHTKKLAKIFVVLIALA 1161

Query: 1169 LALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            LAL TV+VLG+ GV+ AY+F D    Y+P+KPRI+E EML TVPPEKLMKF+
Sbjct: 1162 LALATVAVLGVVGVLFAYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1253 (33%), Positives = 671/1253 (53%), Gaps = 85/1253 (6%)

Query: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60
            M +H         L    + S L+++    DI+    P L++S   +  + +     A  
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   LYEYTGQQNFT-KEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGS 119
             Y Y GQQ FT +E   G++   L+YYS  TY+Q+    DDT + +I PFG+DSFILSG+
Sbjct: 61   YYNYKGQQLFTGQEQHQGSS---LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGT 117

Query: 120  GTINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSA 179
            G + +  + +Q++YNLSTL +  I  Q L SV  +L++G  VYFGG F+Y++G+ +GHSA
Sbjct: 118  GKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSA 177

Query: 180  LIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGXXXXXX 239
            + W++ S  T LLPFGGFG  S+VN+I+KL+   +LF G+F  L+ +S   TA       
Sbjct: 178  VQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTE 237

Query: 240  XXXLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPAT-----SGTL 294
               L N T +E      LRY+T    G    +    +CP +N+D+W  P +      G L
Sbjct: 238  KPQL-NVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGEL 294

Query: 295  VCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPL 354
              K+ + + P+K+R+YNS+ +  EI +F+I+T+PS SIMN+TY+DP +G+L  CD +CPL
Sbjct: 295  NIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPL 354

Query: 355  YSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGK 414
              R+ L S +   S P D+   +++    +KW+ D+Q+FAF N++ +  +KF A++SYG 
Sbjct: 355  MPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGN 413

Query: 415  SVGLSGLELYQDTFSTYANNSLNEYGCXXXXXXXXXXXXXXXXWYNGLGGESYIATEYVP 474
            +VGL G+EL+Q  +  Y N++LN+  C                W+ G    SY++   V 
Sbjct: 414  NVGLVGVELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTANI--WHQGATDASYLSANVV- 470

Query: 475  NQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTI 534
               E  P VN  P I H G Y +N YTPGC  D TC  RGIVNVT+      T+M  + I
Sbjct: 471  ---ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRW-I 526

Query: 535  YQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSE 594
            YQNN  LKYD +Y+G+LD +P + +E+VS I+++    ++VAD+V+ I   +D+   L +
Sbjct: 527  YQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAI---IDSLDGLDD 583

Query: 595  SANTKEYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLI 654
              + +E   LNG+ QY  +   S+  N  +     +N     + P   SL       +LI
Sbjct: 584  IRHPREK-SLNGLFQYTPAG--SSLDNGIQ---KYINKDPQTDMPEGVSLVGQVYDGKLI 637

Query: 655  LG-GTNNHISIIGLN----DNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDXXXXXXXXX 709
            LG  +  HI+++       ++++V    +Q + G ++G++  S+GL+  G          
Sbjct: 638  LGVKSTGHIAVVTPKGTDWNDVDVT---RQDVPGSLNGISPYSKGLVFTGKFNLSSGPSS 694

Query: 710  XXXXXGSFENVFNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWS 769
                 G+F + F+ +   +S IN+++  ++L++F+N +I NTS+S Q+L S+ F LS  S
Sbjct: 695  ALHYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTS-QMLTSSMFQLSALS 753

Query: 770  AGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKV---QALNLDNAVVPYLAAYLNESTT 826
            A +N N+D+LF+G+++ ++ G  +G+    +E  +      ++  A V +   YLN++ T
Sbjct: 754  AAANSNNDLLFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARV-HRGVYLNDTAT 812

Query: 827  AYAYETNLLNKIYFSNNV---DPSWNWSTS-----ITRMLYANNQSLLTVGSES--STTA 876
            AYAY +   N    +  V    P  N++ S     +  M+Y    + L + +     T  
Sbjct: 813  AYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPG 872

Query: 877  ELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESK 936
             L +++L+    +A E +    +IN++V F ++++LLVGG+F+  K  C  LCLYN+  +
Sbjct: 873  ALILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKR 930

Query: 937  SWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEG 996
            SWS F +    GEI QL F     L+  G    +   ++   +F+L  S ++       G
Sbjct: 931  SWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNG 990

Query: 997  KINSFVVT----EESIVAWNDTSLLIYRDQEWN-ITSVPGNDSSIGSVSTINTNAGPGTL 1051
            +  + V+T     +  VA +   +  Y   EW  +T + G    I  +S +  N  P + 
Sbjct: 991  RAFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLN-NPRSQ 1049

Query: 1052 NRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNR----NPTI 1107
            N+R   N     ++++ G  +  +YG +  + ++FE W PY+ +  S+           I
Sbjct: 1050 NKR---NRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQI 1106

Query: 1108 FINRDVSTEFNSQIPLSNLNVTETGXXXXXXXXXXXXXXXXXXXXXXXRIDRGFVVLIGL 1167
            F+N+D+S +  + +PL                                ++ +G+VVLI L
Sbjct: 1107 FLNQDISRQTTTSLPLE-----------------VVVSDSPPTAEPKRKLAKGYVVLIAL 1149

Query: 1168 ALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             LAL T+++LGI GVILAY F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1150 GLALATIALLGIIGVILAYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa]
           {ON} complement(168093..169595) [1503 nt, 501 aa]
          Length = 500

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 18/82 (21%)

Query: 301 EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKL-----------KNCD 349
           +V PT   LYN +   G      +L +   + M + YLD ++G+L           ++ +
Sbjct: 162 DVKPTNF-LYNPELGRG------VLVDFGLAEMQVNYLDEINGQLNDDNTISVKERRHQE 214

Query: 350 EFCPLYSRATLLSASQNVSSPM 371
           +FCP   R   LSA   VS PM
Sbjct: 215 QFCPCIMREAGLSAPHGVSGPM 236

>ZYRO0G12276g Chr7 complement(969552..971150) [1599 bp, 532 aa] {ON}
           weakly similar to uniprot|P47072 Saccharomyces
           cerevisiae YJL016W
          Length = 532

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 866 LTVGSESSTTAELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNF----QMS 921
           L+ GS+SS T  L+   + +FT + NE +  N +  +  +F+K SS L  GN     Q+ 
Sbjct: 457 LSEGSDSSETTALA---MSHFTSLLNECIQRNPERESHFHFQKLSSTLGSGNHEKPSQIP 513

Query: 922 KPNCSG 927
           +PN +G
Sbjct: 514 QPNANG 519

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
            Anc_6.325 YCR057C
          Length = 906

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 81/189 (42%), Gaps = 30/189 (15%)

Query: 848  WNWSTSITRMLYANN-----------QSLLTVGSESSTTAELSIFNLKNFTMIANETMGS 896
            ++W  S     YAN             SLL VG    TT E  ++ L +FT+I   +MG 
Sbjct: 241  YSWRISQKHFFYANQAKVKCVTFHPASSLLVVGF---TTGEFRLYELPSFTLIQQLSMGQ 297

Query: 897  NAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFS 956
            N  IN+ V+  ++   L  G+ ++ +     L +Y ++S+S+        F     L++S
Sbjct: 298  NP-INS-VSINESGEWLAFGSSKLGQ-----LLVYEWQSESY-ILKQQGHFDSTNSLTYS 349

Query: 957  AASQLVISGLFDT-----EEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAW 1011
                 V++   D      +      LA+F    S++  +    +G++      + ++ AW
Sbjct: 350  PDGSRVVTAAEDGKIKVWDVVSGFCLATFEEHTSSVTQVQFAKKGQVLFSASLDGTVRAW 409

Query: 1012 NDTSLLIYR 1020
            +   L+ YR
Sbjct: 410  D---LIRYR 415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,165,162
Number of extensions: 6317279
Number of successful extensions: 16981
Number of sequences better than 10.0: 119
Number of HSP's gapped: 17335
Number of HSP's successfully gapped: 124
Length of query: 1220
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1099
Effective length of database: 39,606,813
Effective search space: 43527887487
Effective search space used: 43527887487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)