Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1518.254ON66466430920.0
YLR083C (EMP70)8.254ON66766427280.0
Suva_10.1678.254ON68468427200.0
Smik_12.1428.254ON66365226690.0
NDAI0B023708.254ON72266424710.0
NCAS0B049708.254ON66666423990.0
YDR107C (TMN2)8.254ON67266623320.0
Suva_2.2678.254ON67266623180.0
KAFR0B026808.254ON66465023020.0
Smik_4.3538.254ON69066622920.0
Skud_4.3688.254ON67266622740.0
KNAG0G019908.254ON66766022650.0
ZYRO0C01848g8.254ON64766022070.0
TBLA0E043708.254ON67666421410.0
Kpol_543.358.254ON65865721320.0
SAKL0H17248g8.254ON66064920960.0
CAGL0B01683g8.254ON69168920880.0
KLLA0F18931g8.254ON66565220530.0
Kwal_56.235778.254ON68367120470.0
KLTH0G13882g8.254ON68768820370.0
NCAS0B038908.254ON66366420140.0
TBLA0H014508.254ON67366420050.0
TPHA0A018408.254ON68568419680.0
TDEL0F038108.254ON65665118860.0
AGR097W8.254ON65366118410.0
NDAI0J014208.254ON61961917750.0
Ecym_43178.254ON60564714580.0
NCAS0A145207.411ON6706833293e-31
NDAI0A015107.411ON6797143125e-29
YER113C (TMN3)7.411ON7067163116e-29
ZYRO0B03784g7.411ON6586383027e-28
Smik_5.2587.411ON7067242903e-26
Skud_5.2667.411ON7077222796e-25
SAKL0F12914g7.411ON7077372771e-24
TDEL0C027107.411ON6786912707e-24
Suva_5.2347.411ON7067232502e-21
CAGL0G03487g7.411ON7047132403e-20
KNAG0C034307.411ON6803142243e-18
Kwal_27.107467.411ON6902761959e-15
KLTH0C06226g7.411ON6942731878e-14
KLLA0E20835g7.411ON6762601878e-14
KAFR0K019507.411ON6642791797e-13
AGL295C7.411ON6572541592e-10
Ecym_71437.411ON6762831281e-06
TPHA0K007307.411ON7332781243e-06
TBLA0I003307.411ON7132751073e-04
Kpol_1045.287.411ON681156990.003
Skud_13.4665.35ON13887750.59
KNAG0D022908.116ON43587698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.151
         (664 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...  1195   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...  1055   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...  1052   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...  1032   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   956   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   928   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   902   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   897   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   891   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   887   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   880   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   877   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   854   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   829   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   825   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   811   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   808   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   795   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   793   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   789   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    780   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   776   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   762   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   731   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   713   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   688   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   566   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   131   3e-31
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   124   5e-29
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   124   6e-29
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   120   7e-28
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   116   3e-26
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   112   6e-25
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   111   1e-24
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   108   7e-24
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   100   2e-21
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...    97   3e-20
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    91   3e-18
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    80   9e-15
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    77   8e-14
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    77   8e-14
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    74   7e-13
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    66   2e-10
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    54   1e-06
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    52   3e-06
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    46   3e-04
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    43   0.003
Skud_13.466 Chr13 (828310..828331,828415..828809) [417 bp, 138 a...    33   0.59 
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    31   8.5  

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score = 1195 bits (3092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/664 (89%), Positives = 591/664 (89%)

Query: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60
           MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG
Sbjct: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60

Query: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120
           DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN
Sbjct: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120

Query: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180
           TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR
Sbjct: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180

Query: 181 SKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXX 240
           SKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYH              
Sbjct: 181 SKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIV 240

Query: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300
           NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI
Sbjct: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300

Query: 301 QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360
           QW                      RALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP
Sbjct: 301 QWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360

Query: 361 XXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420
                         QLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM
Sbjct: 361 SHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420

Query: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480
           GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL
Sbjct: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480

Query: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540
           FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE
Sbjct: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540

Query: 541 LYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGV 600
           LYFIYTSLWFNKIFYM                       YHSLCLENWKWQWRGFIVGGV
Sbjct: 541 LYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGV 600

Query: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS
Sbjct: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660

Query: 661 IKVD 664
           IKVD
Sbjct: 661 IKVD 664

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/664 (78%), Positives = 550/664 (82%), Gaps = 1/664 (0%)

Query: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60
           MA++QLLLLYFFVS  KAFYLPGVAPTTY+END IPLLVNHLTPSM YQH+DE GN+VSG
Sbjct: 5   MAHVQLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSG 64

Query: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120
           DKENFLYSYDYYY+RFHFC+P+ VEKQPESLGSVIFGDRIYNSPF+LNMLQEKEC  LC 
Sbjct: 65  DKENFLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCK 124

Query: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180
           T IPG+DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKT+FYGAGF LG V+V+QGT 
Sbjct: 125 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTD 184

Query: 181 SKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXX 240
            +  PK AETT++ +EL TR  D ++V+T+E PYFANHFDIMIEYH              
Sbjct: 185 IEATPKGAETTDKDVELETR-NDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIV 243

Query: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300
            P+SIKRS  GTCET  SPL+LDE  DNEV FTYSVKF ESATSWATRWDKYLHVYDPSI
Sbjct: 244 EPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSI 303

Query: 301 QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360
           QW                      RALKSDFARYNELNL+DDFQEDSGWKLNHGDVFR P
Sbjct: 304 QWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSP 363

Query: 361 XXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420
                         QLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM
Sbjct: 364 SQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 423

Query: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480
           GIYKFFNGPYWKANL+LTPLLVPGAILLII+ALNFFLM VHSSGVIPA TLFFMVFLWFL
Sbjct: 424 GIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFL 483

Query: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540
           FSIPLSF GSLIARK+C WDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE
Sbjct: 484 FSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 543

Query: 541 LYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGV 600
           LYFIYTSLWFNKIFYM                       YHSLCLENWKWQWRGFI+GG 
Sbjct: 544 LYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGA 603

Query: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           GCALYVFIHSILFTKFKLGGF TIVLYVGYS VISLLCCLVTGSIGFISSM F+R+IYSS
Sbjct: 604 GCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSS 663

Query: 661 IKVD 664
           IKVD
Sbjct: 664 IKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/684 (75%), Positives = 555/684 (81%), Gaps = 20/684 (2%)

Query: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60
           MAYIQL LLYF VSA +AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQH+DE GN+VSG
Sbjct: 1   MAYIQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSG 60

Query: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120
           DKE+FLYSYDYYYD+FHFC+P+HVEKQPESLGS+IFGDRIYNSPFELNMLQEKECV LC 
Sbjct: 61  DKEHFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCK 120

Query: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180
           T IPG+DAKFINKLIKNGFFQNWLIDGLPAAREV+DGRTKT+FYGAGF LG VEV+Q   
Sbjct: 121 TVIPGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD 180

Query: 181 S--------------------KTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFD 220
           S                    KT P++ +++NEG+EL  R +  ++V+T E PYFANHFD
Sbjct: 181 SETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFD 240

Query: 221 IMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKE 280
           I IEYH              NPLSIKRS  GTCET+ SPL+LDE  DNEV FTYSVKF+E
Sbjct: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300

Query: 281 SATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLE 340
           S TSWATRWDKYLHVYDPSIQW                      RALKSDFARYNELNL+
Sbjct: 301 SPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLD 360

Query: 341 DDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSL 400
           DDFQEDSGWKLNHGDVFRPP              Q+FLMVTCSIFFAALGFLSPSSRGSL
Sbjct: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420

Query: 401 ATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVV 460
           ATVMFILYALFGFVGSYTSMGIYKFF+GPYWKAN+++TPLL+PGAILL+I+ALNFFLM V
Sbjct: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480

Query: 461 HSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYL 520
           HSSGVIPA TLFFMVFLWFLFSIPLSF GSL+ARKKC WDEHPTKTNQIARQIPFQPWYL
Sbjct: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540

Query: 521 KTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXY 580
           KT+PATLIAGIFPFGSIAVELYFIYTSLWFNKIFYM                       Y
Sbjct: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITY 600

Query: 581 HSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCL 640
           HSLCLENWKWQWRGF VGGVGCALYVFIHSILFTKFKLGGF TIVLY+GYS VISLLCCL
Sbjct: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660

Query: 641 VTGSIGFISSMFFLRRIYSSIKVD 664
           VTGSIGFISSMFF+R+IYSSIKVD
Sbjct: 661 VTGSIGFISSMFFIRKIYSSIKVD 684

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score = 1032 bits (2669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/652 (77%), Positives = 538/652 (82%), Gaps = 1/652 (0%)

Query: 13  VSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYY 72
           VS  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQH+DE+GN+VSGDKENFLYSYDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 73  YDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFIN 132
             RFHFC+P+ VEKQPESLGS+IFGDRIYNSPF+L ML+EKECV LC  TIPGNDAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTN 192
           KLIKNGFFQNWLIDGLPAAR V D RTKT+FYGAGFELG VEV+QGT S+  P  AETTN
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192

Query: 193 EGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGT 252
           +G+EL TR + +++V+T+EHPYF NH+DI IEYH              NP+SIKRS   T
Sbjct: 193 QGVELDTR-DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPET 251

Query: 253 CETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXX 312
           CETD SPL+LDEE DNEV FTYSVKF ES TSWATRWDKYLHVYDPSIQW          
Sbjct: 252 CETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVV 311

Query: 313 XXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXX 372
                       RALKSDFARYNELNL+DDFQEDSGWKL+HGDVFR P            
Sbjct: 312 VLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGS 371

Query: 373 XXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWK 432
             QLF MVTCSIFFAALGFLSPSSRGSLATVMF+LYALFGFVGSYTSMGIYKFF+GPYWK
Sbjct: 372 GVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWK 431

Query: 433 ANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLI 492
           ANL+LTPLLVPG IL+II+ALNFFLM VHSSGVIPA TLFFMVFLWFLFSIPLSF GSL+
Sbjct: 432 ANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLV 491

Query: 493 ARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNK 552
           ARKKC WDEHPTKTNQIARQIPFQPWYLKT+PATLIAG+FPFGSIAVELYFIYTSLWFNK
Sbjct: 492 ARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK 551

Query: 553 IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSIL 612
           IFYM                       YHSLCLENWKWQWRGFIVGG GCALYVFIHSIL
Sbjct: 552 IFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSIL 611

Query: 613 FTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           FTKFKLGGF TIVLYVGYS VISLLCCLVTGSIGFISSMFF+R+IYSSIKVD
Sbjct: 612 FTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/664 (70%), Positives = 522/664 (78%), Gaps = 6/664 (0%)

Query: 6   LLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENF 65
           +LL  F +S T+AFYLPGVAPTTY  +DEIPLLVNHLTPSMY+QH++E G ++  DKE F
Sbjct: 60  VLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERF 119

Query: 66  LYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPG 125
           LYSYDYYYDRFHFC+P+H+EKQPESLGS+IFGDRIYNSPF++NMLQ+K CV LC TTIPG
Sbjct: 120 LYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPG 179

Query: 126 NDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGT----RS 181
            DAKFINKLIKNGFFQNWLIDGLPAAR+VYD RTKT FYG GFELG V+V QGT     +
Sbjct: 180 KDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNA 239

Query: 182 KTAPKQAETTNEGLELGTR-AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXX 240
            T  K+  TTNEGLEL TR A++  +++ FE PYFANHFDI +EYH              
Sbjct: 240 NTVAKKP-TTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIV 298

Query: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300
           NP+SIKRS  GTCET  +PL+L E++DN+V FTYSVKF  S T WATRWDKYLH+YDP+I
Sbjct: 299 NPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAI 358

Query: 301 QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360
           QW                      +ALKSDFARYNELNL+DDFQE++GWKL HGDVFR P
Sbjct: 359 QWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIP 418

Query: 361 XXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420
                         QLFLM+ CSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM
Sbjct: 419 HRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 478

Query: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480
           G+YKFF GPYWK N+LLTP+LVPG I   IVALN FL+ VHSSGVIPA TLFFM+ LWF+
Sbjct: 479 GVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFV 538

Query: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540
           FSIPL+  GSLIA KKC WDEHPTKTNQIARQIPFQPWYLKT PATLIAGIFPFGSIAVE
Sbjct: 539 FSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVE 598

Query: 541 LYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGV 600
           LYFIY+SLWFNKIFYM                       YHSLCLENW WQWRGFI+GGV
Sbjct: 599 LYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGV 658

Query: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           GCA+YVFIHSILFTKFKLGGF TIVLYVGYS +ISLL C+VTG+IGF+SSMFF+R+IYSS
Sbjct: 659 GCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSS 718

Query: 661 IKVD 664
           IKV+
Sbjct: 719 IKVE 722

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/664 (68%), Positives = 507/664 (76%), Gaps = 9/664 (1%)

Query: 6   LLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENF 65
           +L   FF+S T+AFYLPGVAPTTY E DEIPLLVNHLTPS+Y+Q  D  G S   +KE+F
Sbjct: 7   VLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHF 64

Query: 66  LYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPG 125
           LYS+DYY+DR HFC+P+H+EKQPESLGS+IFGDRIYNSPFEL ML+EK CV LC +TIPG
Sbjct: 65  LYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPG 124

Query: 126 NDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSK--- 182
            DAKFINKLIKNGFFQNWLIDGLPAA +VYD +TK+ FYG GFELG VE  Q    +   
Sbjct: 125 KDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPA 184

Query: 183 -TAPKQAETTNEGLELGTR-AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXX 240
            T PKQ  TTNEGLEL TR A++  +V+  E  YF NH+DI +EYH              
Sbjct: 185 TTKPKQ--TTNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIV 242

Query: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300
           NP+SIKRS  GTCET   PL+L E+ DN+V FTYSVKF  S T WATRWDKYLH YDP+I
Sbjct: 243 NPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTI 302

Query: 301 QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360
           QW                      +ALKSDFARYNE NLEDDFQED+GWKL HGDVFR P
Sbjct: 303 QWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIP 362

Query: 361 XXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420
                         QLFLM++CSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM
Sbjct: 363 HKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 422

Query: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480
            +YKFF GPYWK N+LLTP ++PG I L IV LNFFLM  HSSGV+PA TLFFM+ LWF+
Sbjct: 423 AVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFI 482

Query: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540
           FSIPL+F GSLIA KKC WDEHPTKTNQIARQIPFQPWYLKT PAT+IAGIFPFGSIAVE
Sbjct: 483 FSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVE 542

Query: 541 LYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGV 600
           LYFIYTSLWFNKIFYM                       YHSLCLENW+WQWRGFIVGGV
Sbjct: 543 LYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGV 602

Query: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           GCA+YVF+HSILFTKFKLGGF TIVLYVGYS +ISLL C+VTG+IGF+SS+ F+R+IYS+
Sbjct: 603 GCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSA 662

Query: 661 IKVD 664
           IKVD
Sbjct: 663 IKVD 666

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/666 (64%), Positives = 500/666 (75%), Gaps = 8/666 (1%)

Query: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66
           LL+Y + + TK F LPG++PTTY   DEIPLLVN LTPS+Y+QH+DE+GN VSGDKE+FL
Sbjct: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66

Query: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           YSYDYY  RFHFCRP+HVEKQPESLGSVIFGDRIYNSPF+LNML+EKECV LC +TIPG 
Sbjct: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186
           DAKFIN LIK+GFFQNWL+DGLPAAR+ YD RTKTN+YG GFELG  +V Q    K  P 
Sbjct: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186

Query: 187 Q-----AETTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXX 238
                 +E +NE + L  R       ++V+T E PYF NHFDI +E+H            
Sbjct: 187 TMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGV 246

Query: 239 XXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298
             NP+SI+RS  G C T   PLILDE++DNEV FTYSVKF  S T WATRWDKYLH+YDP
Sbjct: 247 IVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDP 306

Query: 299 SIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358
            IQW                      RALKSD ARYNELNL+++F EDSGWKL HGDVFR
Sbjct: 307 QIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR 366

Query: 359 PPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418
            P              QLFLMV CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY 
Sbjct: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYA 426

Query: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478
           SMG+YKFF GPYWKAN++LTP+L+PGAI L+IV +NFFL+  HSSGVIPAR+LFF++ LW
Sbjct: 427 SMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLW 486

Query: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538
           FL S+PLSF GS++A K+C WDEHPTKTNQIARQIP+QPWYL+T  ATLIAGIF FGSIA
Sbjct: 487 FLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIA 546

Query: 539 VELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVG 598
           VELYFIY+SLWFNKIFYM                       Y+SLCLENW WQWR FI+G
Sbjct: 547 VELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIG 606

Query: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
           G+GC++Y FIHSILFTKFKLGG +T+VLY+GYS +IS LCC+VTG+IGF SSMFF+R+IY
Sbjct: 607 GLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666

Query: 659 SSIKVD 664
           S+IKV+
Sbjct: 667 SAIKVE 672

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/666 (64%), Positives = 499/666 (74%), Gaps = 8/666 (1%)

Query: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66
           L L+ +++  KAF LPGV+PTTY+ NDEIPLLVN LTPS+Y+QH+DE G  VS DKE+FL
Sbjct: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66

Query: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           YSYDYY D+FHFC+P+HVEKQPESLGSVIFGDRIYNSPF+L ML++KECV LC +TIPG 
Sbjct: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186
           DAKFIN LIKNGFFQNWL+DGLPAAR VYD RTKTN+YG GFELG  +V Q    KT P 
Sbjct: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPS 186

Query: 187 -----QAETTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXX 238
                 +E +  G  L  R       ++V+T E  +F NHF+I +EYH            
Sbjct: 187 TMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGV 246

Query: 239 XXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298
             NPLSI+RS  G C T   PL L E++DN+V FTYSVKF  S T WATRWDKYLHVYDP
Sbjct: 247 TVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDP 306

Query: 299 SIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358
            IQW                      RA++SDFARYNELNL+++F ED+GWKL HGDVFR
Sbjct: 307 QIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFR 366

Query: 359 PPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418
            P              QLFLM+ CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYT
Sbjct: 367 IPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYT 426

Query: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478
           SMG+YKFF+GPYWKANL++TP+L+PGAI L+IVA+NFFL+  HSSGVIPARTLFF++FLW
Sbjct: 427 SMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLW 486

Query: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538
           F  SIPLSF GS IA K+C WDEHPTKTNQIARQ P QPWYL+TI ATLIAGIF FGSIA
Sbjct: 487 FSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIA 546

Query: 539 VELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVG 598
           VELYFIY+SLWFNKIFYM                       YHSLCLENW WQWR FI+G
Sbjct: 547 VELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIG 606

Query: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
           G+GC++Y+FIH+ILFTKFKLGGFVT+VLYVGYS++IS LCC+VTG+IGF SSM F+R+IY
Sbjct: 607 GLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIY 666

Query: 659 SSIKVD 664
           S IKV+
Sbjct: 667 SRIKVE 672

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/650 (66%), Positives = 501/650 (77%), Gaps = 1/650 (0%)

Query: 16  TKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDR 75
           T+AFYLPGVAPTTY E DEIPLLVNHL+PSMY+QH++++G  VS DK  +LYSYDYYYDR
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 76  FHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLI 135
           FHFC+P+ +EKQPESLGS++FGDRIYNSPF+LNML+EK+C  LC +TIPGNDAKFINKLI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 136 KNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGL 195
           KNGFFQNWLIDGLPAA E +D RT T+FYG+GFELG V+V Q      A  +    N+G 
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194

Query: 196 ELGTR-AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCE 254
           EL  R A++   ++  E  YF NH+DI IEYH              NP+SI+RS  G+CE
Sbjct: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254

Query: 255 TDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXX 314
           +   PL L E+ DN+V FTYSV F  S TSWATRWDKYLHVYDP+IQW            
Sbjct: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLL 314

Query: 315 XXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXX 374
                     +ALK+DFARYNE NL+D+FQED+GWKL HGDVFR P              
Sbjct: 315 LSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGV 374

Query: 375 QLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKAN 434
           QLF+M++ +IFFAALGFLSPSSRG L TVMF+LYALFGFVGSYTSMG+YKFF GPYWKAN
Sbjct: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434

Query: 435 LLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIAR 494
           ++LTP+LVPG+I + I+A+NFFLM VHSSGVIPA+TLFFMV LWF+FSIP +F GSL+A 
Sbjct: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494

Query: 495 KKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIF 554
           KKC W+EHPTKT QIARQIPFQPWYLKTIPAT IAGIFPFGSIAVE+YFIYTSLW+NKIF
Sbjct: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554

Query: 555 YMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFT 614
           YM                       YHSLCLENW WQWR FIVGGVGCA+YVFIHSILFT
Sbjct: 555 YMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614

Query: 615 KFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           KFKLGGF T+VLY+GYS +ISLLCC+VTGSIGF+SSMFF+R+I+SSIKVD
Sbjct: 615 KFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/666 (63%), Positives = 496/666 (74%), Gaps = 8/666 (1%)

Query: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66
           LLL+F++  TKAF LPG++PTTY +NDEIPLLVN LTPS+Y+QH+DE G  +S DKE++L
Sbjct: 25  LLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYL 84

Query: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           YSYDYY +RFHFCRP+HVE+QPESLGS+IFGDRIYNSPF+L ML+ KECV LC  TIPG 
Sbjct: 85  YSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGK 144

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186
           DAKFINKLIK+GFFQNWL+DGLPAAR+V+D RTKTN+YG GFELG   V      K  P 
Sbjct: 145 DAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPS 204

Query: 187 -----QAETTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXX 238
                 +ET+N G  L  R       ++V+T E PYF NHFDI +E+H            
Sbjct: 205 TMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGV 264

Query: 239 XXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298
             NP+SI+RS   +C     PLILDEE DNE+ FTYSVKF  S T WATRWDKYLH+YDP
Sbjct: 265 TVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDP 324

Query: 299 SIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358
            IQW                      RAL SD +RYNELNL+++F EDSGWKL HGDVFR
Sbjct: 325 QIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFR 384

Query: 359 PPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418
            P              QLFLM+ CSIF AALG +SP SRGSL TVMF+ YALFGFVGSYT
Sbjct: 385 TPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYT 444

Query: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478
           SMG+YKFF+GPYWKANL+LTP+L+PG I ++IVA+NFFL+  HSSGVIPA TLFF++FLW
Sbjct: 445 SMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLW 504

Query: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538
           F  SIPLSF GS+IA K C WDEHPTKTNQIARQ+P+QPWYL+TI ATLIAGIF FGSIA
Sbjct: 505 FAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIA 564

Query: 539 VELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVG 598
           VELYFIY+SLWFNKIFYM                       YHSLCLENW+WQWR FI+G
Sbjct: 565 VELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIG 624

Query: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
           G+GC++Y+FIHSILFTKFKLGGF+TIVLY GYS++IS LCC+VTG+IGF S M F+R+IY
Sbjct: 625 GLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIY 684

Query: 659 SSIKVD 664
           S++K++
Sbjct: 685 SAVKIE 690

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/666 (62%), Positives = 498/666 (74%), Gaps = 8/666 (1%)

Query: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66
           L L  ++   KAF LPG++PTTY  NDEIPLLVN LTPS+Y+QH+DE GN +S DKE+FL
Sbjct: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66

Query: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           YSYDYY +RFHFCRP+HVEKQPESLGSVIFGDRIYNSPF+L ML+EKECV LC  TIPG 
Sbjct: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186
           DA+FIN+LI +GFFQNWL+DGLPAAR VYD RTKTN+YG GFELG  +V Q    +T P 
Sbjct: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186

Query: 187 QAE-----TTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXX 238
             E      +N G  L  R+      + V+T E PYF NHF+I++E+H            
Sbjct: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246

Query: 239 XXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298
             NP+SI+RS  G+C     PL L E+RDNEV FTYSVKF  SAT WATRWDKYLH+YDP
Sbjct: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306

Query: 299 SIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358
            IQW                      RALKSD  RYNELNL ++F ED+GWKL+HGDVFR
Sbjct: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366

Query: 359 PPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418
            P              QLFLM+ CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYT
Sbjct: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426

Query: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478
           SMG+YKFF+GPYWKANL++TP+L+PGAILL+IVA+N FL+  HSSGVIPA++LFF++FLW
Sbjct: 427 SMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486

Query: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538
           F+ SIPLSF GS++A K+C W+EHPTKTNQIARQIP QPWYL+T  AT++AGIF FGSIA
Sbjct: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546

Query: 539 VELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVG 598
           VELYFIY+SLWFNKIFYM                       YHSLCLENW WQWR FI+G
Sbjct: 547 VELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIG 606

Query: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
           G+GC++Y+FIHSILFTKFKLGGF+T+VLY+GYS+++S+LCC+VTG+IGF SSM F+R+IY
Sbjct: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666

Query: 659 SSIKVD 664
            ++KV+
Sbjct: 667 YAVKVE 672

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/660 (66%), Positives = 504/660 (76%), Gaps = 4/660 (0%)

Query: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66
           L L +      AFYLPGVAPTTYK NDEIPLLVNHL+PSMY+QHE E G ++ GDK  +L
Sbjct: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYL 69

Query: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           YSYDYYYDRFHFC+P+ + K+PESLGS+IFGDRIYNSP+++ ML+EK CVPLCNT IPG 
Sbjct: 70  YSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQG-TRSKTAP 185
           DA+FINKLIKNGFFQNWLIDGLPAAR V+D  T ++FYG GFELG VEV Q   ++KT P
Sbjct: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHP 189

Query: 186 KQAETTNEGLELGTR-AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLS 244
           K+ ++ +   +L TR A++  +++  E PYFANH DI +EYH              +P+S
Sbjct: 190 KEDDSGSA--KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPIS 247

Query: 245 IKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXX 304
           IKRS  GTC+T   PL+LDE+ DNEV FTYSV+F  S T WATRWDKYLH YDP+IQW  
Sbjct: 248 IKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFS 307

Query: 305 XXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXX 364
                               +AL+SDFARYNELNL+++FQEDSGWKL HGDVFR P    
Sbjct: 308 LVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSM 367

Query: 365 XXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYK 424
                     QLFLM++ SIFFAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSMG+YK
Sbjct: 368 LLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYK 427

Query: 425 FFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIP 484
           FF GPYWKAN++LTPLLVPG +LL IV LN FL+  HSSG IPA+TLFF+V LWF+ S+P
Sbjct: 428 FFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVP 487

Query: 485 LSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFI 544
            +  GSLIA KKC WDEHPTKTNQ+ARQ+PFQPWYLKT+ AT IAGIFPFGSIAVELYFI
Sbjct: 488 SALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFI 547

Query: 545 YTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCAL 604
           YTSLW+NKIFYM                       YHSL LENW+WQWR FIVGGVGCA+
Sbjct: 548 YTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAI 607

Query: 605 YVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           Y+F+HSILFTK KLGGFVTIVLYVGYS VISLLCCLVTGSIGF+SSMFF+RRIYSSIKV+
Sbjct: 608 YMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/660 (63%), Positives = 487/660 (73%), Gaps = 17/660 (2%)

Query: 5   QLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKEN 64
            LL +    S  KAFYLPGVAPTTY  NDEI LLVNHLTPSM +QHEDE GN V GDKE+
Sbjct: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64

Query: 65  FLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP 124
           +LYSYDYYY +FHFC+P++V +QP SLGSVIFGDRI+NSPF+LNML+EKECVPLC++ IP
Sbjct: 65  YLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124

Query: 125 GNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTA 184
           G DAKF+NKLIKNGF QNWLIDGLPA RE++D RT +NFYG GF+LG V+V++G      
Sbjct: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSD--- 181

Query: 185 PKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLS 244
                         +  E+  I++T E PY ANH+DI IEYH              +P+S
Sbjct: 182 --------------SNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVS 227

Query: 245 IKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXX 304
           IKRS + +C+ ++  L L E  +NEV FTYSVKF +S T WATRWDKYLHVYDP+IQW  
Sbjct: 228 IKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFS 287

Query: 305 XXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXX 364
                               RALK+D +RYNE NL+++F EDSGWKL+HGDVFR P    
Sbjct: 288 LINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSL 347

Query: 365 XXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYK 424
                     QLFLM+ CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM IYK
Sbjct: 348 LLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYK 407

Query: 425 FFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIP 484
           FF GP WK NLLLTP+LVPG I + I+ LNFFL+ V SSG IPA TLF ++ LWF+FSIP
Sbjct: 408 FFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIP 467

Query: 485 LSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFI 544
           LSF GSLIA K+C  D HPTKTNQIARQIP QPWYLKTIP +LIAG+FPF SIAVELYFI
Sbjct: 468 LSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFI 527

Query: 545 YTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCAL 604
           YTSLWFNKIFYM                       YHSLCLENWKWQWR FI+GG GCA+
Sbjct: 528 YTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAI 587

Query: 605 YVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           YVFIHSILFTKFKLGGF T+VLY+GYS +IS+LCC+VTGSIGFISSMFF+R+IYSS+KVD
Sbjct: 588 YVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/664 (59%), Positives = 481/664 (72%), Gaps = 14/664 (2%)

Query: 13  VSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYY 72
           +S T  FYLPGVAPTTY E D IPLLVNHLTPSM+++H+D  GN +S DKENFLYSYDYY
Sbjct: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74

Query: 73  YDRFHFCRP--KHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKF 130
           Y + HFC+P  + ++KQPESLGS++FGDRIYNSPFEL ML ++ C  LC+T IPG+DAKF
Sbjct: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134

Query: 131 INKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR---SKTAPKQ 187
           IN LIK+GF QNWLIDGLPAAR++YD  TK++FYG+GFELG VE+ Q      S T PKQ
Sbjct: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194

Query: 188 -------AETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXX 240
                  ++  +E      RA    +V + E  YFANHFDI IEYH              
Sbjct: 195 PIVEDVLSQELDEEQATEKRANQM-LVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTV 253

Query: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300
           NP+S+KR  +  C+T+   L L E  D +V FTYSV F++S T WATRWDKYLH+YDP+I
Sbjct: 254 NPISMKRD-SAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTI 312

Query: 301 QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360
           QW                      +ALK+DF RYNE NL D F EDSGWKL HGDVFR P
Sbjct: 313 QWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIP 372

Query: 361 XXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420
                         QLF M++  +  AALGFLSPS+RGSL T+MFILYA+FGFVGSYTSM
Sbjct: 373 TKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSM 432

Query: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480
           G+Y+FFNGPYWKAN++LTPL+VPG I + I+++N FL+ VHSS V+P  TL  MV LW +
Sbjct: 433 GVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIV 492

Query: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540
            S+PLSF GSLI+ K+C W +HPTKTN++ RQIPFQPWYLKT+PATLI GIFPFGSIAVE
Sbjct: 493 LSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVE 552

Query: 541 LYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGV 600
           LYFIY+SLWFNKIFYM                       YHSLCLENW+WQWR FI+GG+
Sbjct: 553 LYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGI 612

Query: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           GC++Y+FIHSILFT+FKLGGF+TIVLYVGYS +I++LC +VTG+IGFIS+MFF+++IYSS
Sbjct: 613 GCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSS 672

Query: 661 IKVD 664
           IKV+
Sbjct: 673 IKVE 676

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/657 (60%), Positives = 470/657 (71%), Gaps = 7/657 (1%)

Query: 8   LLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLY 67
           LL  +++ T AFYLPGVAPTTY + DEIPLLVNHLTPS+ +QH+D+QGN + G+KE+FLY
Sbjct: 9   LLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLY 68

Query: 68  SYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGND 127
           S+DYY+ + HFC+P+HVEKQPESLGS++FGDRIYNSPF + ML+ +EC  LC  TIP +D
Sbjct: 69  SFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128

Query: 128 AKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQ 187
           AKFINKLIKNGFFQNWLIDGLPAAR+++D +TK++FYG GF LG+V V Q      A  +
Sbjct: 129 AKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAV-GGLASSK 187

Query: 188 AETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR 247
               N   E        ++V   E P+  NH+DI +EYH              +P   K 
Sbjct: 188 LNLENPARE---AKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KS 241

Query: 248 SITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXX 307
           S    C   +  LIL E  DNEV F+YSV+F  S T WATRWDKYLHVYDP+IQW     
Sbjct: 242 STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLIN 301

Query: 308 XXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXX 367
                            RALKSDFARY E NL+D FQ+DSGWKL HGDVFR P       
Sbjct: 302 FSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLS 361

Query: 368 XXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFN 427
                  QLFLMV  SIFFAA+G LSPSSRGSL + MFILYALFGF GSY SMG+YKFFN
Sbjct: 362 ILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFN 421

Query: 428 GPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSF 487
           GPYWKAN++LTP+LVPG + + IV LNFFL+   SSG IP   L F++ LWF+ SIPLS 
Sbjct: 422 GPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSL 481

Query: 488 GGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTS 547
            GSLIA KKC W EHPTKTN+IARQIPFQPWYLKT+PATLIAG+FPFGSIAVELYFIY+S
Sbjct: 482 AGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSS 541

Query: 548 LWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVF 607
           LWFNKIFYM                       Y+SL LENW+WQWR FIVGGVGCA Y+F
Sbjct: 542 LWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIF 601

Query: 608 IHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           +HSI+FTKFKLGGF TIVLYVGYS +IS LC +VTG+IGFISSM F+++IYSS+KVD
Sbjct: 602 VHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/649 (60%), Positives = 463/649 (71%), Gaps = 1/649 (0%)

Query: 16  TKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDR 75
             AFYLPGVAPTTY + DEIPLLVNHLTPS Y+QH D++G+++SGDKE FLYSYDYYYD+
Sbjct: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72

Query: 76  FHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLI 135
           FHFCRP+++ KQPESLGS+IFGDRIYNSPFELNML+ K CVPLC + IP +DAKFINKLI
Sbjct: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132

Query: 136 KNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGL 195
           +NGFF NWL+DGLPAARE++DGRT + FYG GFELG V+V          K +E+    +
Sbjct: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEI 192

Query: 196 ELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCET 255
               +       +  E  YF NHFDI IEYH               P SIKR  + +C+T
Sbjct: 193 ADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDT 252

Query: 256 DASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXX 315
           +  PL+L E+ DN V FTYSV F  S T WATRWDKYLHVYDP IQW             
Sbjct: 253 EGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILL 312

Query: 316 XXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXXQ 375
                    RALK+D +RYNELNL+D+FQE++GWKL HGDVFR P              Q
Sbjct: 313 SSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQ 372

Query: 376 LFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANL 435
           LFLM   +I FA LG LSPSSRGSL TVMFILYALFG  GSYTSM +YKFFNG  WK N+
Sbjct: 373 LFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNM 432

Query: 436 LLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK 495
           +LTP+L+P  I + ++ LN FL+ VHSSG IP  T+  +V LWF+FSIPLS  GS+I+RK
Sbjct: 433 ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK 492

Query: 496 KCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFY 555
           K  WD  PT TNQIARQIPFQPWYLKT+PA+LIAG FPFGSI VELYFIY+SLWFNKIFY
Sbjct: 493 KSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFY 551

Query: 556 MXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTK 615
           M                       Y+SLC+ENWKWQWRGF +GG GCA YVF+H+ILFTK
Sbjct: 552 MFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTK 611

Query: 616 FKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           FKLGG  T+VLY+GYS VIS LCCL+TG++GF+SS++F+R+IY SIKVD
Sbjct: 612 FKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/689 (57%), Positives = 469/689 (68%), Gaps = 30/689 (4%)

Query: 5   QLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKEN 64
           QLL+L  FV++T  FYLPG AP TYK+ D IPLLVNHLTPS+ +QH D+ GN + GDK  
Sbjct: 4   QLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKAR 63

Query: 65  FLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP 124
            LY YDYY ++ HFC+P+ +EKQPESLGSVIFG++IYNSPF + ML++ ECV LC+TTIP
Sbjct: 64  MLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP 123

Query: 125 GNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKT- 183
           G DAKFINKLIKNGF QNWLIDGLPAAR+++D RT T FYG GFELG VEV Q    K  
Sbjct: 124 GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIV 183

Query: 184 --------------------------APKQ-AETTNEGLELGTRAEDYSIVETFEHPYFA 216
                                     +PK   + +N  +       D +IV   E P FA
Sbjct: 184 SESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVD-NIVTNVEVPVFA 242

Query: 217 NHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCE-TDASPLILDEERDNEVSFTYS 275
           NHFDI +EYH              NP+S+    + +C   +   L LDE +DNEV FTYS
Sbjct: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYS 302

Query: 276 VKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYN 335
           VKF  S T WATRWDKYLH+YDP IQW                      RALKSD +RYN
Sbjct: 303 VKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYN 362

Query: 336 ELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPS 395
           E NL D+F+EDSGWKL HGDVFR P              QLFLM+  SI  +ALG LSPS
Sbjct: 363 EFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPS 422

Query: 396 SRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNF 455
           SRGSL T MF+ YA+FGFVGSYTSMGIYKFF GPYWKAN++LTP+L+PG I L ++ +N 
Sbjct: 423 SRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNV 482

Query: 456 FLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPF 515
            L  V SS VIP  TL FMVFLW LFSIPL+F GSLI+ KKC WDEHPTKTN+I RQIPF
Sbjct: 483 LLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPF 542

Query: 516 QPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXX 575
           QPW+LKT+PATLI G+  FGSIAVELYFIY+SLWFNKIFYM                   
Sbjct: 543 QPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLIN 602

Query: 576 XXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVIS 635
               Y +LC ENW WQWR F +GG+GC++Y+FIHSILFT+FKLGGF TIVLYVGYS++IS
Sbjct: 603 VIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLIS 662

Query: 636 LLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
            L C+VTG+IGFI SMFF+RRI++SIKVD
Sbjct: 663 FLTCIVTGAIGFICSMFFVRRIFASIKVD 691

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/652 (59%), Positives = 460/652 (70%), Gaps = 9/652 (1%)

Query: 16  TKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDR 75
            +AFYLPGVAPTTY E D++PLLVNHLTPS +Y+H D   +  +GDKE FLYSYDYYY +
Sbjct: 20  VEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYKK 78

Query: 76  FHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLI 135
           FHFC+P  ++KQPESLGS+IFGDRIYNSPF+L +L+  EC  LC + IPG DAKFINKLI
Sbjct: 79  FHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLI 138

Query: 136 KNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGL 195
            NGFFQNW+IDGLPAAR++ D +T   FYG GFELG V+V       T      + ++ L
Sbjct: 139 LNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYEPDT-----RSLHDEL 193

Query: 196 ELGTRAEDYSIV---ETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGT 252
           EL   A+   +    +  E PYF NH+DI IEYH              NP SIKR    +
Sbjct: 194 ELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDS 253

Query: 253 CETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXX 312
           CE+    L+L E  DNEV FTYSVKF +S T WATRWDKYLHVYDP IQW          
Sbjct: 254 CESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIV 313

Query: 313 XXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXX 372
                        ALK+D ARYNELNL+ DF+E++GWKL HGDVFR P            
Sbjct: 314 VLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGS 373

Query: 373 XXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWK 432
             QL LM+T +I FA LGFLSPSSRGSL+TVMF+LYA+FG  GS+TSM  YKFFNG  W+
Sbjct: 374 GGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWR 433

Query: 433 ANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLI 492
            NL+LTPLLVPG+IL +++ LNFFL+ VHSSG IP +T+  +V LWF+ SIPLS  GS+I
Sbjct: 434 LNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVI 493

Query: 493 ARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNK 552
           A KKC W+EHPTKTNQIARQIPFQPWYLKTIP  L+AGIFPFGSIAVELYFIY+SLWFNK
Sbjct: 494 AWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNK 553

Query: 553 IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSIL 612
           I+YM                       YHSLC+ENWKWQWR F++GG GCA YVF HSIL
Sbjct: 554 IYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSIL 613

Query: 613 FTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           FTKF+LGG  TIVLY+GYS +IS LCCLVTG+IGF+SS+  +R+IYS +KVD
Sbjct: 614 FTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/671 (58%), Positives = 464/671 (69%), Gaps = 20/671 (2%)

Query: 13  VSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYY 72
            S  + FYLPGVAPTTY E D IPLLVNHLTPSMY++H D+ G   +GD+E+FLYSYDYY
Sbjct: 14  ASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYY 72

Query: 73  YDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFIN 132
           YD+FHFC+P+ +EKQ ESLGS+IFGDRIYNSPF+L ML++KEC  LC++ IP NDAKFIN
Sbjct: 73  YDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTN 192
           KLI NGFFQNWL+DGLPAAR+  D RTK+ FY  GFELG ++V           + +   
Sbjct: 133 KLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHP 192

Query: 193 EGLELGTRAEDY-------------------SIVETFEHPYFANHFDIMIEYHXXXXXXX 233
           +G       +DY                    +V+  E  YFANHF+I ++YH       
Sbjct: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252

Query: 234 XXXXXXXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYL 293
                  NP SIKR  + +C      L L EE +  V F+YSVKF  S T WATRWDKYL
Sbjct: 253 RVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYL 312

Query: 294 HVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNH 353
           HVYDP IQW                      R L+ D +RYN+LNL+DDFQE++GWKL H
Sbjct: 313 HVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372

Query: 354 GDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGF 413
           GDVFR P              QLF+M  C+I FA LG LSPSSRGSL TVMFILYALFG 
Sbjct: 373 GDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGS 432

Query: 414 VGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFF 473
           +GSYTSM  YKFF G YWK N++LTP+LVPG +  +++ LNFFL++V S+G IP  T+  
Sbjct: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492

Query: 474 MVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFP 533
           +V LWF+FSIPLS  GSLIA+KKC W+EHPTKT QI RQIPFQPWYLKT PA LIAGIFP
Sbjct: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552

Query: 534 FGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWR 593
           FGSIAVELYF+Y+SLWFNKIFYM                       Y+SLCLENWKWQWR
Sbjct: 553 FGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWR 612

Query: 594 GFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFF 653
           GF +GG GCALYVF+H+ILFTKFKLGGFVTIVLYVGYS VISLL CL+TG++GF+SS++F
Sbjct: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672

Query: 654 LRRIYSSIKVD 664
           +RRIYSSIKVD
Sbjct: 673 VRRIYSSIKVD 683

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/688 (58%), Positives = 467/688 (67%), Gaps = 25/688 (3%)

Query: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60
           M    LLL   + S    FYLPGVAPTTY E D IPLLVNHLTP+MYYQH DE GN + G
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-G 59

Query: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120
           DKE+ LYSYDYYY +FHFCRP+ +EKQ ESLGS+IFGDRIYNSPF++ ML+ KEC  LC+
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180
            +IP +DAKFINKLI NGFFQNWL+DGLPAAR+  D RTK+ FY  GFELG V +     
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 181 SKTAPKQAETTNEGLELGTRAE----DY--------------------SIVETFEHPYFA 216
                  ++  ++    G+  E    DY                     +V+  E PYFA
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFA 239

Query: 217 NHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSV 276
           NHF+I ++YH              NP SIKR    TC+     L L E    EV F+YSV
Sbjct: 240 NHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSV 299

Query: 277 KFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE 336
           KF  S T WATRWDKYLHVYDP IQW                        L  D +RYN+
Sbjct: 300 KFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQ 359

Query: 337 LNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSS 396
           +NL+DDFQE++GWKL HGDVFR P              QLFLM  C+I FA LG LSPSS
Sbjct: 360 INLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSS 419

Query: 397 RGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFF 456
           RGSL TVMFILYALFG  GSYTSM  YKFF GPYWK N+LLTP+LVPG +  +++ALNFF
Sbjct: 420 RGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFF 479

Query: 457 LMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQ 516
           L+VV S+G IP  T+  +V LWFLFSIPLS  GSLIARKKC WDEHPTKT QI RQIPFQ
Sbjct: 480 LVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQ 539

Query: 517 PWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXX 576
           PWYLKT+PA+LIAGIFPFGSIAVELYFIY+SLWFNKIFYM                    
Sbjct: 540 PWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITV 599

Query: 577 XXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISL 636
              Y+SLCLENWKWQWRGF +GG GCALY+FIH+ILFTKF+LGGF TIVLYVGYS V+SL
Sbjct: 600 LLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSL 659

Query: 637 LCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           L CL+TG++GF+SS++F+RRIYSS+KVD
Sbjct: 660 LSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/664 (55%), Positives = 459/664 (69%), Gaps = 1/664 (0%)

Query: 1   MAYIQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSG 60
           M Y+ L LL F +S  +AF LPG+ P TY++ D+IPLLVNHLTPSM++ H++E+G  +S 
Sbjct: 1   MNYVILSLL-FCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDIST 59

Query: 61  DKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCN 120
            K+  ++SYDYYY++FHFC+P H+EK   S+GS++FGDRIYNSPF+LNML+ K CVPLC 
Sbjct: 60  AKKYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCE 119

Query: 121 TTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTR 180
           + IPG DA+FINKLIKNG++QNW IDGLPAAREVYD RTK++FYG GFELG VE+ Q T 
Sbjct: 120 SIIPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTG 179

Query: 181 SKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXX 240
            K  P      ++  +   +    ++++  E PYF NHFDI+IEYH              
Sbjct: 180 DKLLPDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATV 239

Query: 241 NPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSI 300
           NP+SI R   G C      L L+EE DN V  TYSV F  S TSW TRWDKYLHVYDP I
Sbjct: 240 NPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKI 299

Query: 301 QWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPP 360
           QW                      +ALKSDFARYN +NL+DD +E+SGWKL HG VFR P
Sbjct: 300 QWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIP 359

Query: 361 XXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSM 420
                         QLFL++ C++F AA+  LSP  RG+L T M ILY LFGF+ SY SM
Sbjct: 360 KNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSM 419

Query: 421 GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFL 480
           G+YKFF GPYWK N+LLTP+LVPG I++  +ALN FLM   SS V+PA+T+  ++ LWF 
Sbjct: 420 GVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFA 479

Query: 481 FSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVE 540
            SIPLS  GSL+A+KKC WDEHPT TNQIA+ IP Q WYLKTIPA+LI G+F FGSI+V+
Sbjct: 480 VSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQ 539

Query: 541 LYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGV 600
           LYFIYTSLWFN IFYM                       YHSLC ENWKWQWRGF +GG+
Sbjct: 540 LYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGL 599

Query: 601 GCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           GC++YV +HS+ F + KLGGF  I+LY+GYS V++ L  LVTGS+GF+SSMFF++RI+SS
Sbjct: 600 GCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSS 659

Query: 661 IKVD 664
           +KVD
Sbjct: 660 VKVD 663

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/664 (55%), Positives = 467/664 (70%), Gaps = 6/664 (0%)

Query: 6   LLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENF 65
           L L+ F +  + AFY+PG++  TY   D I L VN LTPSMY++H DE G SV+ DKE+F
Sbjct: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68

Query: 66  LYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPG 125
           LYSYDYYYD+FHFCRP+ VE++ ESLGSV+FGDRIYNSPFEL ML+ KECVPLC TTIP 
Sbjct: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128

Query: 126 NDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQ--GTRSKT 183
           +DAKFINKLIKNGFF NWLIDGLP+AR++YD +T++ FY +GF LG V V    G    T
Sbjct: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVT 188

Query: 184 APKQAETTNEGLELGTRAEDYSI----VETFEHPYFANHFDIMIEYHXXXXXXXXXXXXX 239
            P  ++  NE ++   + E  ++    +   E  YFANHF+I IEYH             
Sbjct: 189 IPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVT 248

Query: 240 XNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPS 299
            +P+SIKR    +C    + L L+E  +N+V FTYSV F +S T+WATRWDKYLH YDPS
Sbjct: 249 VDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPS 308

Query: 300 IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRP 359
           IQW                      RALK D +RY +LNL++ F EDSGWKL HGDVFR 
Sbjct: 309 IQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRM 368

Query: 360 PXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTS 419
           P              QLFLM+ C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTS
Sbjct: 369 PRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTS 428

Query: 420 MGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWF 479
           MG+YKFF+GPYWKAN++LTPLLVPG++LL+I+ LNFFL+ VHSSG IPA T+  M+ LW 
Sbjct: 429 MGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWL 488

Query: 480 LFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAV 539
           L S+PLSF GS +A KKC W+++PT  N+I R+IP QPWY+++IP  L++GI PFG+IAV
Sbjct: 489 LVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAV 548

Query: 540 ELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGG 599
           ELYFIY+SLW+NKIFYM                       YHSLCLENW+WQWR F+ GG
Sbjct: 549 ELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGG 608

Query: 600 VGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYS 659
           +GCA Y+F++SI FT+FK  GFV+I+LY+GYS +I ++ CL+TG++ F+ +MFF++RI++
Sbjct: 609 LGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFT 668

Query: 660 SIKV 663
           SIKV
Sbjct: 669 SIKV 672

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/684 (55%), Positives = 455/684 (66%), Gaps = 30/684 (4%)

Query: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66
           LL+   VS   AFYLPGVAP+TY E DE+PLLVNHLTPS+ YQ +D+ G  V   +E  L
Sbjct: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64

Query: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           YS+DYY+ + HFC+P+ + KQP+SLGS++FGDRIYNSPF + ML+ +  V LC+ TIPG+
Sbjct: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124

Query: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186
           DAKFINKLIKNGFFQNWLIDGLPAAR++YD  T T FY  GF LG VE+ +       P 
Sbjct: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184

Query: 187 QAETTNEGL--------------------ELGTRAEDY------SIVETFEHPYFANHFD 220
            A+T + G                     E   + E         +V   E PY ANH+ 
Sbjct: 185 DAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYV 244

Query: 221 IMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKE 280
           I +E H              +P S   S         + L LDE++DNEV+F+YSV F E
Sbjct: 245 INVEVHDRGEGNYRVVGVTVDPYSTTDSAN---PEKGNKLFLDEKKDNEVTFSYSVNFIE 301

Query: 281 SATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLE 340
           S T WATRWDKYLH Y+P+IQW                      +ALKSDFARY E NL+
Sbjct: 302 SETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLD 361

Query: 341 DDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSL 400
           + F EDSGWKL HGDVFR P              QLFLM+  SIF AA+G +SPSSRGSL
Sbjct: 362 NSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSL 421

Query: 401 ATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVV 460
            + MF  YALFGF GSY SM +YKFF GPYWKAN++LTPLLVPG IL+ I+ LNFFL+ V
Sbjct: 422 PSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFV 481

Query: 461 HSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYL 520
           HSSG IP   L  +V +WF+ S+PLSF GSL+A K+  W EHPTKTNQIARQIPFQ WYL
Sbjct: 482 HSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYL 541

Query: 521 KTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXY 580
           KTIPA LIAGIFPFG+IAVELYFIYTSLWFNKIFYM                       Y
Sbjct: 542 KTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITY 601

Query: 581 HSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCL 640
            SLC+ENW WQWR F +GGVGC+LY+FIHSILFTKFKLGGF T++LY+GY+ ++S+L C+
Sbjct: 602 QSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCI 661

Query: 641 VTGSIGFISSMFFLRRIYSSIKVD 664
           VTG++GFISSM F+R+IYS+++VD
Sbjct: 662 VTGAVGFISSMIFVRKIYSNVRVD 685

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/651 (53%), Positives = 435/651 (66%), Gaps = 7/651 (1%)

Query: 14  SATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYY 73
           + ++A +LPG++PT Y    EI L VNHLTPS ++QH+D+ GN++  DKE++LYSYDYY 
Sbjct: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72

Query: 74  DRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINK 133
            + HFC+P++V +Q ESLGSV+FGDR+YNSPF+LNML++K CV LC + IPG DA FINK
Sbjct: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132

Query: 134 LIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNE 193
           LIKNGF  NWL+DGLPA   + + R  +     GF LG VE+ QG  +       E    
Sbjct: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPRE---- 188

Query: 194 GLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTC 253
             E G  A   ++V   E P+  NH+DI I+YH               P SIK++ + +C
Sbjct: 189 --ETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQT-SNSC 245

Query: 254 ETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXXX 313
           E     + L E++DNEV +TYSV++   + +WATRWD Y   YD ++QW           
Sbjct: 246 EFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVI 305

Query: 314 XXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXX 373
                      RALKSDFARYNELNL+D+F E+SGWKL+HGDVFR P             
Sbjct: 306 GLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSG 365

Query: 374 XQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKA 433
            QL L+    I  AA+ F +  SR  L T+ F+LYALFGFVGSY SMG+Y+FF GPY K 
Sbjct: 366 VQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKV 425

Query: 434 NLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIA 493
           N++LTP L+PG ILL I++LNFFL++ HSS  IP   LF +V LW + S+PLS  GSL A
Sbjct: 426 NMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTA 485

Query: 494 RKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI 553
            K C WD+HPTKTNQIARQIPFQPWYLKT+PA L+AGIFPF SIAVELYFIY SLWF++ 
Sbjct: 486 IKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQF 545

Query: 554 FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILF 613
           FYM                       YHSLCLENW+WQWR FIVGG+G A+Y+FIHSI F
Sbjct: 546 FYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFF 605

Query: 614 TKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
           T+FKL GF TIVLYVGYS +IS+LCCL TG++GF SSMF +R+I+SS+KVD
Sbjct: 606 TEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/661 (54%), Positives = 441/661 (66%), Gaps = 9/661 (1%)

Query: 4   IQLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKE 63
           I L+    ++   + FYLPG APTTY+  D IPLLVNH+TP+++   +D  G     DKE
Sbjct: 2   IALVAWVAWLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKE 59

Query: 64  NFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTI 123
            +LY+YDYYY R H CRP  +EK  ESLGS+IFGDR++NSPFEL ML+EK CV LC  T+
Sbjct: 60  RYLYAYDYYYPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTV 119

Query: 124 PGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKT 183
           P  DAKFIN+LI++GFF NWL+DGLPA RE++D RT T FYG GFELG   V +GT  + 
Sbjct: 120 PAEDAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRN 177

Query: 184 APKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPL 243
             +  E     +EL TR            PYF NHF+I ++YH               P 
Sbjct: 178 QEEPGE-----IELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPR 232

Query: 244 SIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWX 303
           S++  +   C    + L+L E  D +V+FTYSV+F ES  SWATRW KYLHVYDP +QW 
Sbjct: 233 SLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWY 292

Query: 304 XXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXX 363
                                RALK+D  RYN+ NL+++FQED GWKL H DVFR P   
Sbjct: 293 SLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKT 352

Query: 364 XXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIY 423
                      QLFLM  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM  Y
Sbjct: 353 LLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTY 412

Query: 424 KFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSI 483
           K F G  WK N++LTPLLVPG I   ++ +NFFL++V SSG +P  T+  +V LWF+ SI
Sbjct: 413 KMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSI 472

Query: 484 PLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYF 543
           P+S  GSL ARKK  WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG+IAVELYF
Sbjct: 473 PISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYF 532

Query: 544 IYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCA 603
           IYTS+WFN +FYM                       Y+SLC+ENW WQWR FI+GG+GC+
Sbjct: 533 IYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCS 592

Query: 604 LYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKV 663
            YVFI+SILFTKF+LGGFVTIVLYVGYS +IS L CLVTG+IGF+SS++F+R+IYSSIKV
Sbjct: 593 TYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKV 652

Query: 664 D 664
           D
Sbjct: 653 D 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/619 (53%), Positives = 421/619 (68%)

Query: 46  MYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPF 105
           M+Y H++++G  +S D +  +YSYDYYY++ HFC+P+HVEK   S+GSV+FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 ELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYG 165
           +LNML+ K C  LCN+TI G DAKFINKLIKNG++QNWLIDGLPAAREVYD RTK+NFYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 AGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEY 225
            GFELG VE+ Q T  K  P  A+T  +  +   +    ++++  E PYF NHFDI IEY
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEY 180

Query: 226 HXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSW 285
           H              NP+SI RS  G C+     L L E   N + FTYSV+F  S T+W
Sbjct: 181 HDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAW 240

Query: 286 ATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQE 345
            TRWDKYLHVYDP+IQW                      +ALKSDF+RY ELNL++  +E
Sbjct: 241 VTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETIKE 300

Query: 346 DSGWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMF 405
           D+ WKL HGDVFR P              QLFLM+ C+IF  A+G ++P SRG+L TVMF
Sbjct: 301 DASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMF 360

Query: 406 ILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGV 465
           +LY  F F+ S+ SMG+YKFFNG  W  N +LTP LVPG +LL+I+ LN FL+ VHSSGV
Sbjct: 361 LLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSSGV 420

Query: 466 IPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPA 525
           IP  T   ++ LWF   +PLS  GSL+ARK C WD HPTKTN +++ IP Q WYL+TIPA
Sbjct: 421 IPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPA 480

Query: 526 TLIAGIFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCL 585
           +LI G+F FGS++VELYF+YTSLWFNKIFYM                       Y+SL  
Sbjct: 481 SLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSLSA 540

Query: 586 ENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSI 645
           ENW+WQWR F++ G+GC+ YVF+HS+LFT+ KLGGF   +LY+GYS+VI+ L  +VTG++
Sbjct: 541 ENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGAL 600

Query: 646 GFISSMFFLRRIYSSIKVD 664
           GF+SSM F+R IYS++KVD
Sbjct: 601 GFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/647 (45%), Positives = 384/647 (59%), Gaps = 57/647 (8%)

Query: 18  AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFH 77
            FY PGV+P TY   DEIPLLVN+L+                    +FL++ DYY D   
Sbjct: 16  GFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYYSDSIG 56

Query: 78  FCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKN 137
            C+P  +++Q ESLGSVIFGDR+YNSPF+++ML+  ECV LC+TTI   D    N     
Sbjct: 57  LCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFFGY 113

Query: 138 GFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLEL 197
            +  NWL+DGLP      DG +  N Y                           N  L +
Sbjct: 114 RYSYNWLVDGLPVLG--IDGTSDANGY-------------------------HNNSELFM 146

Query: 198 GTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDA 257
           G +A+        E  Y  NHFDI I Y+               P+S+ R+ +  C  DA
Sbjct: 147 GYQAD--------EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDA 198

Query: 258 SPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXX 317
            P+ +       ++FTYSV FK+S  SW+TRWD+YLHVYD  IQ                
Sbjct: 199 KPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSS 258

Query: 318 XXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXXXXQLF 377
                  R LK D A Y+E NL+D+FQ+D  WK+ HG+VFR P              QLF
Sbjct: 259 VLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLF 318

Query: 378 LMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLL 437
            M  C++   + GFLSPS+RGSL TVMF+LYALFG VGSYTSM IYKFF G  WK NL+L
Sbjct: 319 FMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLIL 378

Query: 438 TPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKC 497
           TPLL+P  + +  V LNFFL+   SSG +P  T+  ++ LWF+ S+P+S  GSL++ K  
Sbjct: 379 TPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLN 438

Query: 498 GWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMX 557
            WDEHP KTNQIARQ+P QPWY+KT  AT +AG+FPFG++AVELY+IY S+W   IF+M 
Sbjct: 439 RWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMY 498

Query: 558 XXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFK 617
                                 Y+SLC+ENWKWQWR FI+GGVGC++YVF+HS+ F KFK
Sbjct: 499 GFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFK 558

Query: 618 LGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
             GFV++VLY+GYS ++S++CCLVTGSIGF+++++F+R+IYS+IKVD
Sbjct: 559 FPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  131 bits (329), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 166/683 (24%), Positives = 266/683 (38%), Gaps = 112/683 (16%)

Query: 26  PTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKHVE 85
           P  Y + D + L+VN                 V  D     Y+Y   YD   F  P  + 
Sbjct: 44  PNYYSKGDPVELIVN----------------KVESDLTQLPYAY---YD-LPFTCPPTMH 83

Query: 86  KQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQNW 143
           K+P   SL  +I GDR + S + LN  ++ +C  LC         K   +L+KNG+   W
Sbjct: 84  KKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQW 143

Query: 144 LIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAET-TNEGLELGTRA 201
           LID  LPA            +Y +GF LG V+          P+  +T  N  + +  R 
Sbjct: 144 LIDDELPAVTTFISTTDHKKYYASGFPLGFVD----------PETGKTYLNTHVMIVIR- 192

Query: 202 EDYSIVETFEHPYFANHF--DIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASP 259
             Y+ V+T +H  F         +++H               P + K       + +   
Sbjct: 193 --YNTVDTNKHTIFGFELYPKSTVDFHC--------------PGASK-------DYEQYE 229

Query: 260 LILDEERDNE--VSFTYSVKFKES-ATSWATRWDKYLHV----YDPSIQ--WXXXXXXXX 310
           L++ E  D+   + FTYSV ++E     W  RWD YL+      D S Q  W        
Sbjct: 230 LVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFG 289

Query: 311 XXXXXXXXXXXXXXRALKSDFARYNELNLEDD-----FQEDSGWKLNHGDVFRPPXXXXX 365
                         R  K     +++++ E+D     +     W LN     + P     
Sbjct: 290 IVFLISSITAVILYRTFKISRRSFSDISKEEDDKGSIYVVARKWLLNE----QTPLANVL 345

Query: 366 XXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKF 425
                     LF ++   I   +L  L  + R S+ T+  + +    F+ S+T   + K 
Sbjct: 346 IIFVSMGVQFLFTVLGSLIISCSLKKLH-NVRDSVLTMGLLCFVTGAFMASFTGAHLLKS 404

Query: 426 FN----------GPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMV 475
                         Y+    LL   L+P  ++L+ + LN  +    S+  +P  T+ F++
Sbjct: 405 REEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLI 464

Query: 476 FLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIA---------RQIPFQPWYLKTIP-- 524
            ++F+  IPLS  G  IA K    +  P+ +  I          + I   P  L   P  
Sbjct: 465 SVYFVVCIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLS 522

Query: 525 --ATLIAGIFPFGSIAVELYFIYTSLWFNK-IFY----MXXXXXXXXXXXXXXXXXXXXX 577
             A L  G+FPF  I VEL ++Y SLW  K  FY                          
Sbjct: 523 SLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTF 582

Query: 578 XXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLG--GFVTIVLYVGYSYVIS 635
              +S    +  W+W  F +G   CA Y+ ++S+ +  F L   GF +I + V Y  + +
Sbjct: 583 ILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFN 641

Query: 636 LLCCLVTGSIGFISSMFFLRRIY 658
           ++C   TGSI  ++S +F+++IY
Sbjct: 642 IMCGCATGSIACLTSHWFVQKIY 664

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  124 bits (312), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 163/714 (22%), Positives = 270/714 (37%), Gaps = 115/714 (16%)

Query: 9   LYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQ--GNSVSGDKENFL 66
           L F +++   FY+     +  + N+ I      L P+ Y+Q ++ +   N V  D     
Sbjct: 8   LVFAITSFILFYIFYGNVSNKRGNNTILEKAGWLQPNFYFQGDEVELIVNKVESDLTQLP 67

Query: 67  YSYDYYYDRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP 124
           Y+Y   YD   F  P  + K+P   SL  +I GDR + S + L   Q+  C  LC     
Sbjct: 68  YAY---YD-LPFTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTT 123

Query: 125 GNDAKFINKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKT 183
               K   KL+++G+   WLID  LPAA        +  +Y +GF LG V+   G     
Sbjct: 124 KEGLKNAKKLVEDGYVVQWLIDEELPAATTFISTIDQKKYYASGFPLGFVDPDTG----- 178

Query: 184 APKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPL 243
                                         Y   H  ++I Y+               P 
Sbjct: 179 ----------------------------KVYLNTHVMLVIRYNTVDVNKHTIVGFEVYPK 210

Query: 244 SIKRSITGTCETDASPL-ILDEERDNEVSF---TYSVKFKES-ATSWATRWDKYLHVYDP 298
           S+          +  P  I+  E D++++F   TYSV ++E     W  RWD YL+  + 
Sbjct: 211 SVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGEL 270

Query: 299 S------IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDD------FQED 346
           S        W                      R+ KS      ++N  ++      ++  
Sbjct: 271 SENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVA 330

Query: 347 SGWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSR--------G 398
             W +N     R P               LF+ +     F  LG L+ S           
Sbjct: 331 RNWIINE----RTPLANLLI---------LFVSMGVQFLFTVLGSLTISCSLNKLHDIGD 377

Query: 399 SLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKAN----------LLLTPLLVPGAILL 448
           S+ T+  + + L  F+ SY    + +  N    K             +L    +PG +++
Sbjct: 378 SVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMI 437

Query: 449 IIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIA---RKKCGWDE---H 502
           + + LN  +    S+  +P +T+   + ++F+  IPLS  G  +A   + K    +   H
Sbjct: 438 VTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFH 497

Query: 503 PTK------TNQIA--RQIPFQPWYLKTIPATL---IAGIFPFGSIAVELYFIYTSLWFN 551
            ++       N++   + I      LK+I   L   ++GIFPF  I VEL ++Y S+W  
Sbjct: 498 TSRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLE 557

Query: 552 KI--FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCL---ENWKWQWRGFIVGGVGCALYV 606
           K   +Y                        Y  L +    N  W+W  F +G   CA Y+
Sbjct: 558 KTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYM 616

Query: 607 FIHSILFTKFKLG--GFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
            ++S+ +  F L   GF +I + V Y  + + LC    GSI  ++S FF+ ++Y
Sbjct: 617 ELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  124 bits (311), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 155/716 (21%), Positives = 264/716 (36%), Gaps = 128/716 (17%)

Query: 14  SATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYY 73
           S+ K  Y   + P  Y++ D + L+VN                 V  D     Y+Y   Y
Sbjct: 42  SSQKNLYDGWITPNFYRKGDPLELIVN----------------KVESDLTQLPYAY---Y 82

Query: 74  DRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFI 131
           D   F  P  + K+P   SL  +I GDR + S ++L   ++  C  LC         + +
Sbjct: 83  D-LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTL 141

Query: 132 NKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAET 190
           +KL++ G+   WLID  LPAA           +Y +GF LG ++          P   +T
Sbjct: 142 DKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFID----------PDTDKT 191

Query: 191 TNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR-SI 249
                                  Y  NH  ++I +H               P S+     
Sbjct: 192 -----------------------YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHC 228

Query: 250 TGTCETDASPLILDEERDNEVS---FTYSVKFKES-ATSWATRWDKYLHV----YDPSIQ 301
            G  +      I+  E +NE++   FTYSV ++E     W  RWD +L+      + SIQ
Sbjct: 229 PGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQ 288

Query: 302 --WXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE---------LNLEDDFQEDSGWK 350
             W                      R + +D +             +  EDD  +D   K
Sbjct: 289 FHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGK 348

Query: 351 LNHGDVFRPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSS--------RGSLAT 402
            +   V +                 L +       F  +G L+ S         R S+ T
Sbjct: 349 YSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLT 408

Query: 403 VMFILYALFGFVGSYTSMGIYKFFNGPYWKANLL-----------LTPLL-------VPG 444
           +  + + L  F+ S+    +         KAN L            +P+        +PG
Sbjct: 409 MAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPG 468

Query: 445 AILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK--------- 495
            +++    LN  +    S+  +P +T+ F + ++F+  IPLS  G ++A           
Sbjct: 469 IVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLS 528

Query: 496 KCGWDEHPTKTNQI---ARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNK 552
               DE  +  N +     +  F P     I    + GIFP   I VE+ ++Y SLW  K
Sbjct: 529 GITKDESNSDGNGLFVPKSRAKFNPLVYCGI---YLCGIFPLLVIYVEMQYVYKSLWLEK 585

Query: 553 I----FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGGVGCAL 604
                FY                            C E+      W+W+ F +G  G  +
Sbjct: 586 TTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GV 644

Query: 605 YVFIHSI--LFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
           Y+ ++S+  +F    + GF +I++ + YS + +++C L  G++ ++++ +F+ +IY
Sbjct: 645 YMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  120 bits (302), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 150/638 (23%), Positives = 246/638 (38%), Gaps = 103/638 (16%)

Query: 72  YYDRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAK 129
           YYD    C P   EK+P   SL  +I GDR + S ++L + Q+  C  LC         +
Sbjct: 70  YYDLPFTCPPTP-EKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQ 128

Query: 130 FINKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQA 188
               LIK+G+   W+ID  LPAA           +Y  GF LG V+          P+ +
Sbjct: 129 TAKDLIKSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD----------PRSS 178

Query: 189 ETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRS 248
                                    +F NH  ++I Y+               P S+   
Sbjct: 179 RV-----------------------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDY 215

Query: 249 ITGTCETDASPLILDEERDNEVSF---TYSVKFKESA-TSWATRWDKYLH---VYDPS-- 299
                  D  P  + +    E+ +   TYSV ++E A   W+ RW  Y++   + D S  
Sbjct: 216 HCPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSS 275

Query: 300 -IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358
              W                        L   F   NE  LE    EDS       D+F 
Sbjct: 276 TFHWMALANSVGIVLFVTFIVIVN----LIMIFRNPNE-QLESKENEDSS------DIFN 324

Query: 359 PPXXXXXXXXXXXXXXQLFLMVTC-----SIFFAALGFLSPS-----------SRGSLAT 402
                           QL  ++ C      + F  LG L+ S           S  ++A 
Sbjct: 325 ----VANNWLRARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAA 380

Query: 403 VMFILYALFG-FVGSYTSM----GIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFL 457
           + F+  A    FVG++  M      Y F+N  +     +L    +PG+I+++ ++LN  +
Sbjct: 381 LCFVAGAFMASFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCII 436

Query: 458 MVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIA---RKKCGWDEHPTKT---NQIAR 511
            +  S+  +P  T+   V  +F+  I +S  G  +A    +    D  P  T    ++ R
Sbjct: 437 WIWDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLR 496

Query: 512 QIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI-------FYMXXXXXXXX 564
           +       L    A LI+G  PF  I VEL ++Y S+W  K        F          
Sbjct: 497 RSRAISGKLVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCI 556

Query: 565 XXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSI--LFTKFKLGGFV 622
                           +   + +  W+WR F++   GC+ Y+ I+S+  +F    + G  
Sbjct: 557 VVCEISLLGCLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDS 615

Query: 623 TIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
            + + V YS++ ++LC L TGS+G+++S +F+++I+ +
Sbjct: 616 AVFISVCYSFIFNVLCGLATGSLGYLTSSWFVKKIHRT 653

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  116 bits (290), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 161/724 (22%), Positives = 272/724 (37%), Gaps = 133/724 (18%)

Query: 14  SATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYY 73
           S+    Y   + P  YK  D + L+VN                 V  D     Y+Y   Y
Sbjct: 42  SSQSNLYDGWITPNFYKNGDPLELIVN----------------KVESDLTQLPYAY---Y 82

Query: 74  DRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFI 131
           D   F  P  + K P   SL  +I GDR + S ++L   ++  C  LC         + +
Sbjct: 83  D-LPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTL 141

Query: 132 NKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAET 190
           +KLI+ G+   WLID  LPAA           +Y +GF LG ++          P   +T
Sbjct: 142 DKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD----------PDTGKT 191

Query: 191 TNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR-SI 249
                                  Y  NH  ++I +H               P S+     
Sbjct: 192 -----------------------YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHC 228

Query: 250 TGTCETDASPLILDEERDNEVS---FTYSVKFKES-ATSWATRWDKYLHVYDPS------ 299
            G  +T     I   E +NE++   FTYSV ++E     W  RWD +L+  + S      
Sbjct: 229 PGASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQ 288

Query: 300 IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE----LNLEDDFQEDSGWKLNHGD 355
             W                        + +D    +     +N+E    ED    LN+  
Sbjct: 289 FHWMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDV---LNNDK 345

Query: 356 VFRPPXXXXXXXXXXXXXXQLF----LMVTCSI----FFAALGFLSPSS--------RGS 399
             +                 LF    L+V  S      F  +G L+ S         R S
Sbjct: 346 YSKNSVYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNS 405

Query: 400 LATVMFILYALFGFVGSY--TSMGIY---KFFNGPYW------KANLLLTPLL------- 441
           + T+  + + +  F+ S+  T + I    + FN  Y+      K     +P+        
Sbjct: 406 VLTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSS 465

Query: 442 VPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK------ 495
           +PG I++    LN  +    S+  +P +T+ F + ++F+  IPLS  G ++A        
Sbjct: 466 LPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQY 525

Query: 496 ---KCGWDEHPTKTNQIARQIPFQPWYLKTIP--ATLIAGIFPFGSIAVELYFIYTSLWF 550
                  DE  +K N++   +P  P     +      + G+FP   I VE+ ++Y SLW 
Sbjct: 526 WLSGITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWL 583

Query: 551 NKI----FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGGVGC 602
            K     FY                            C E+      W+W+ F +G  G 
Sbjct: 584 EKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG- 642

Query: 603 ALYVFIHSI--LFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
            +Y+ ++S+  +F    + GF +I++ + YS + +++C L  G++ ++++ +F+ +IY  
Sbjct: 643 GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-H 701

Query: 661 IKVD 664
           +KV+
Sbjct: 702 VKVN 705

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  112 bits (279), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 155/722 (21%), Positives = 269/722 (37%), Gaps = 135/722 (18%)

Query: 12  FVSATKAFYLPG-VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYD 70
           F S+    Y  G + P  YK+ND + L+VN                 V  D     Y+Y 
Sbjct: 40  FSSSQNNLYYDGWITPNFYKKNDFLELIVN----------------KVESDLTQLPYAY- 82

Query: 71  YYYDRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDA 128
             YD   F  P  + K+P   SL  +I GDR + S ++L   ++  C  LC         
Sbjct: 83  --YD-LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGM 139

Query: 129 KFINKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQ 187
           + ++KL++ G+   WLID  LPAA           +Y +GF LG V+          P  
Sbjct: 140 QTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD----------PDT 189

Query: 188 AETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR 247
            +T                       Y  NH  ++I +H               P S+  
Sbjct: 190 DKT-----------------------YLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSD 226

Query: 248 -SITGTCETDASPLILDEERDNEVS---FTYSVKFKES-ATSWATRWDKYLHVYDPS--- 299
               G  +      I+  E +++++   FTYSV ++E     W  RW+ +L+  + S   
Sbjct: 227 YHCPGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQ 286

Query: 300 ---IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNE---------LNLEDDFQEDS 347
                W                      R +++D    +          +  ED   +D 
Sbjct: 287 SAQFHWMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDD- 345

Query: 348 GWKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVT---CSIFFAALGFLSPSS-------- 396
             K     V+                 ++ +++        F  +G L+ S         
Sbjct: 346 --KYGKNSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNV 403

Query: 397 RGSLATVMFILYALFGFVGSY--TSMGIY---KFFNGPYWKAN------LLLTPLL---- 441
           R S+ T+  + + L  F+ S+  T +GI    +  N  Y   N         +P+     
Sbjct: 404 RNSVLTMAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVIC 463

Query: 442 ---VPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK--- 495
              +PG +++    LN  +    S+  +P RT+ F + ++F+  IPLS  G ++A     
Sbjct: 464 GSSLPGMVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPL 523

Query: 496 ---------KCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYT 546
                    K   D + +K  +   +  F P          + GIFP   I VE+ ++Y 
Sbjct: 524 PKYWLSGITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYK 580

Query: 547 SLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSL----CLENWK----WQWRGFIVG 598
           SLW  K  +                           L    C ++ +    W+WR F +G
Sbjct: 581 SLWLEKTTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMG 640

Query: 599 GVGCALYVFIHSI--LFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRR 656
             G  +Y+ ++S+  +F    + GF +I++ + YS + ++LC L  G++  +++ +F+ R
Sbjct: 641 FSG-GVYMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINR 699

Query: 657 IY 658
           IY
Sbjct: 700 IY 701

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 166/737 (22%), Positives = 271/737 (36%), Gaps = 185/737 (25%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           + P  Y+END + ++VN                 +  D   F Y+Y   Y+    C P +
Sbjct: 56  IRPNVYEENDPVEIIVN----------------KIESDLTQFPYAY---YELPFTCPPTN 96

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQN 142
           V+K    SL  +I GDR + S + L+  +++ C+ LC+     +  +  ++LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 143 WLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRA 201
           WLID  LPAA      +    +Y +GF LG ++   G   KT                  
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMDKDTG---KT------------------ 195

Query: 202 EDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR-SITGTCET-DASP 259
                       Y  NH  ++I YH               P S+      G  +  D   
Sbjct: 196 ------------YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASKNFDHYE 243

Query: 260 LILDEERDNEVSFTYSVKFKES-ATSWATRWDKYLHVYDPS------IQWXXXXXXXXXX 312
           +  +E     + FTYS+ ++E     W  RW+ +++  + S        W          
Sbjct: 244 VNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVIV 303

Query: 313 XXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXXXXX 372
                       +++ +D     E       Q  S W + H  +                
Sbjct: 304 TLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLN-------------- 344

Query: 373 XXQLFLMVTCSIFFAALGFLSPSS--------RGSLATVMFILYALFGFV-GSYTSMGIY 423
              +F  +     F  LG L  S         R S+ T+     AL  F+ G+YTS    
Sbjct: 345 HLNVFTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLTM-----ALMCFISGAYTSS--- 396

Query: 424 KFFNGPYWKANLLLTPLL-------VPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVF 476
             F G    AN   T  +       +PG  L +++ LN  +    S+  +P  T+  ++ 
Sbjct: 397 --FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLIT 454

Query: 477 LWFLFSIPLSFGGSLIA---RKKC-----------------GWDEHPTKTNQI------- 509
           ++F+  IPLS  G + A   R+KC                  +D+ P   N++       
Sbjct: 455 VYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISG 514

Query: 510 ARQIPF---QPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI--FYMXXXXXXXX 564
             ++P    QP  L     T+I+GI PF  I VEL F+Y SLW  K   +Y+        
Sbjct: 515 NSKLPLMLRQPVLL-----TVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANI 569

Query: 565 XXXXXXXXXXXXXXXY---------------------HSLCLENWKWQ------------ 591
                          Y                     HS  L+  + Q            
Sbjct: 570 VLLCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAM 629

Query: 592 --WR--GFIVGGVGCALYVFIHSILF--TKFKLGGFVTIVLYVGYSYVISLLCCLVTGSI 645
             WR   F +GG   A Y+  +S+ +  T  K+  F +I+L+  YS + + LC    G++
Sbjct: 630 TQWRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGAL 688

Query: 646 GFISSMFFLRRIYSSIK 662
           G++S  +F+ RI+++ K
Sbjct: 689 GYLSCCWFVNRIHTNSK 705

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  108 bits (270), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 152/691 (21%), Positives = 252/691 (36%), Gaps = 112/691 (16%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           + P  Y+  D + LLVN                 V  D   F Y Y   YD    C P  
Sbjct: 41  LQPNVYRWGDHVELLVN----------------KVESDLTQFPYGY---YDLPFTCPPTE 81

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQ 141
            +K+P   SL  +I GDR + S ++L   Q+  C  LC         +   +L++ G+  
Sbjct: 82  -DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 142 NWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTR 200
            WLID  LPAA           +Y +GF LG V+          P   +T          
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD----------PDTEKT---------- 180

Query: 201 AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIK--RSITGTCETDAS 258
                        Y   H  ++I Y+               P S+        +   +  
Sbjct: 181 -------------YLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQY 227

Query: 259 PLILDEERD--NEVSFTYSVKFKES-ATSWATRWDKYLHVYDPS------IQWXXXXXXX 309
            LI+ E  D    + FTYSV ++E     W+ RW+ +L+  + S        W       
Sbjct: 228 ELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSV 287

Query: 310 XXXXXXXXXXXXXXXRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPXXXXXXXXX 369
                          R ++      +E   +  F E+      +G V +           
Sbjct: 288 GISFLLMLIVIANLYRIVRVGHEAGSE-EFQFTFDENEEADSIYG-VAKTWLAQTDSSSI 345

Query: 370 XXXXXQLFLMVTCSIFFAALGFLSPSS--------RGSLATVM-FIL----YALFGFVGS 416
                 +F+ +     F  +G L+ S         R S+ +V  F L    Y    FVG+
Sbjct: 346 SFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGT 405

Query: 417 YTSMGIYKFFNGPYWKANL--LLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFM 474
           +  +      +G   +     +L    +PG +++    LN+ +    SS  +P RT+   
Sbjct: 406 WLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLF 465

Query: 475 VFLWFLFSIPLSFGGSLIARK--KCGWDEHPTKTNQIARQIPFQPWYLKTIPAT------ 526
           V ++F+  IPLS  G  ++ +  +      P  ++  AR I  +P    T  A       
Sbjct: 466 VSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAPRKISER 523

Query: 527 --------LIAGIFPFGSIAVELYFIYTSLWFNKI-------FYMXXXXXXXXXXXXXXX 571
                    I G  PF  I VEL +IY S+W  K        F +               
Sbjct: 524 LTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSF 583

Query: 572 XXXXXXXXYHSLCLENWKWQWRGFIVGGVGCALYVFIHSI--LFTKFKLGGFVTIVLYVG 629
                    H        W+W+ F++G   CA Y+ ++S+  +F   K+ GF +I + V 
Sbjct: 584 LGCYVMMRKHKRVATFDSWRWKCFMMG-TSCAWYMELYSLYYIFHTLKMTGFPSIFISVS 642

Query: 630 YSYVISLLCCLVTGSIGFISSMFFLRRIYSS 660
           YS + +++C    GS+G+++S + + R++ +
Sbjct: 643 YSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 153/723 (21%), Positives = 263/723 (36%), Gaps = 134/723 (18%)

Query: 12  FVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDY 71
           F      +Y   + P  YK+ D + L+VN                 V  D     Y+Y  
Sbjct: 40  FSGQDNTYYDGWITPNFYKKGDPLELIVN----------------KVESDLTQLPYAY-- 81

Query: 72  YYDRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAK 129
            YD   F  P  + K+P   SL  +I GDR + S + L   ++  C  LC         +
Sbjct: 82  -YD-LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQ 139

Query: 130 FINKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQA 188
            ++KL++ G+   WLID  LPAA           +Y +GF LG V+          P   
Sbjct: 140 SLDKLVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD----------PDTG 189

Query: 189 ETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR- 247
           +T                       Y  NH  ++I +H               P S+   
Sbjct: 190 KT-----------------------YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDY 226

Query: 248 SITGTCETDASPLILDEERDNEVS---FTYSVKFKES-ATSWATRWDKYLHVYDPS---- 299
              G  +      I+  E +NE++   FTYSV ++E     W  RWD +L+  + S    
Sbjct: 227 HCPGASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKS 286

Query: 300 --IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELN---------LEDDFQEDSG 348
               W                      + +  D    +            +ED+  +D  
Sbjct: 287 AQFHWMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDD-- 344

Query: 349 WKLNHGDVFRPPXXXXXXXXXXXXXXQLFLMVT---CSIFFAALGFLSPSS--------R 397
            K     V+                 ++ +++        F  +G L+ S         R
Sbjct: 345 -KYGKNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVR 403

Query: 398 GSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLL-----------LTPL--LVPG 444
            S+ T+  + + L  F+ S+    +         + N L            +P+  ++ G
Sbjct: 404 NSVITMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICG 463

Query: 445 AIL--LIIVA---LNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK---- 495
           + L  L++V+   LN  +    S+  +P RT+ F + ++F+  IPLS  G  +A      
Sbjct: 464 SSLPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLP 523

Query: 496 ---KCGWDEHPTKTNQIARQIP-----FQPWYLKTIPATLIAGIFPFGSIAVELYFIYTS 547
                G  +  T  N     +P     F P     I    + G+FPF  I VEL ++Y S
Sbjct: 524 RHWLSGITKDETCGNSSRLFVPRSRTKFNPLVYCGI---YLCGLFPFLVIYVELQYVYKS 580

Query: 548 LWFNKI----FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGG 599
           +W  K     FY                            C E+      W+W+ F +G 
Sbjct: 581 VWLEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGF 640

Query: 600 VGCALYVFIHSI--LFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRI 657
            G  +Y+ ++S+  +F    + GF + ++ + YS + +++C L  G + ++++ +F+ +I
Sbjct: 641 SG-GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKI 699

Query: 658 YSS 660
           Y S
Sbjct: 700 YHS 702

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 163/713 (22%), Positives = 265/713 (37%), Gaps = 134/713 (18%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           V P  YK  D + L+VN                 V  D     Y+Y   YD    C P  
Sbjct: 51  VNPNLYKIGDHVELIVN----------------KVESDLTQLPYAY---YDLPFICPPTK 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQ 141
            EK+P   SL  +  GDR + S ++L+   +  C  LC             +L++ G+  
Sbjct: 92  -EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVT 150

Query: 142 NWLID-GLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTR 200
            WLID  LPAA           +Y AGF +G V+   G                      
Sbjct: 151 QWLIDESLPAATTFISSTNHNKYYAAGFPVGYVDDRTG---------------------- 188

Query: 201 AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKR-SITGTCETDASP 259
                        +  NH  ++I YH               P S+      G  +     
Sbjct: 189 -----------KTFLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDKY 237

Query: 260 LILDEERDNEVS---FTYSVKFKES-ATSWATRWDKYLHVYDPS------IQWXXXXXXX 309
            I+  E+D+E++   FTYSV ++E     W  RW+ +L+  + S        W       
Sbjct: 238 EIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSV 297

Query: 310 XXXXXXXXXXXXXXXRAL-KSDFARYN---ELNLEDDFQEDSGWKLNHGDVF-------- 357
                          +   K +    N     NL  D ++D+  K++ G VF        
Sbjct: 298 GIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSVFVNAKTWIT 356

Query: 358 --RPPXXXXXXXXXXXXXXQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILY----ALF 411
             + P                F ++   I   +L  L  + R ++ T+  I +    A+ 
Sbjct: 357 VGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLH-NIRFTVLTMSLICFICGAAIS 415

Query: 412 GFVGSYTSMGIYKFFNGPYWKANLLLTPL----LVPGAIL-----LIIVALNFFLMVVHS 462
           G++GS   +  Y+   G Y +  +  T +    +V G+ L     +I  +LN  ++   S
Sbjct: 416 GYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLNCIILAHDS 473

Query: 463 SGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPT-------KTNQIARQIP- 514
           +  +P +T  F+V ++F+  IPLS  G ++A   C  D + T       + N I+R+   
Sbjct: 474 TNALPFKTEVFLVSIYFVTCIPLSLLGGVLAL-NCKVDSYNTLKRITSLRRNTISRKSRS 532

Query: 515 --------FQPWYLK------TIPATLIAGIFPFGSIAVELYFIYTSLWFNKI--FYMXX 558
                   +Q           T    L  G F F  I VEL ++Y S+W  K   +Y   
Sbjct: 533 DFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYG 592

Query: 559 XXXXXXXXXXXXXXXXXXXXXYHSLCLENWK-----WQWRGFIVGGVGCALYVFIHSILF 613
                                Y  L  +N +     W W+ F++G   CA Y+ ++S+ +
Sbjct: 593 FLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLYY 651

Query: 614 TKFKLG--GFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664
             F L   GF +I + V YS + + +C    GS+ +++S   + +IY   KVD
Sbjct: 652 IFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 142/314 (45%), Gaps = 51/314 (16%)

Query: 397 RGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWK--------ANLLLTPL----LVPG 444
           R S+ T+  + + L  F+ S+    +    N    +        +N+LL  +    L+PG
Sbjct: 364 RNSVLTMALLFFVLGAFMASFVGGTLLIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPG 423

Query: 445 AILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLS-FGGSLIARKKCG----- 498
            ++L  + LN  + +  S+ V+P  T+  ++F++F+  IPLS  GGS+ A K        
Sbjct: 424 MVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRL 483

Query: 499 ----------------WDEHPTKTNQIARQIPFQ-PWYLK-------TIPATLIAGIFPF 534
                            DE      +  R++ ++  W LK       T+ + L +GIFPF
Sbjct: 484 RSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPF 543

Query: 535 GSIAVELYFIYTSLWFNKI--FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW---- 588
             I VEL F+Y S+W+ K   +Y                        Y  + + +     
Sbjct: 544 IMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSD 603

Query: 589 KWQWRGFIVGGVGCALYVFIHSI--LFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIG 646
            W+W+ F +    CA Y+  +SI  +F    +  F +I++ V YS + + LC L  GSIG
Sbjct: 604 SWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIG 662

Query: 647 FISSMFFLRRIYSS 660
           +++S++F++R+Y S
Sbjct: 663 YLASLWFVKRVYRS 676

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 76/173 (43%), Gaps = 26/173 (15%)

Query: 9   LYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYS 68
           L+ FV+ T   +L    PT Y+  D + ++VN                 +  D     Y 
Sbjct: 21  LFSFVNTTNEGWL---TPTIYRHGDPVEIIVNK----------------IESDATQLPYG 61

Query: 69  YDYYYDRFHFCRPKHVEKQPE--SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126
           Y   YD   F  P  V+K+P   SL  VI GDR + S +EL   ++ EC  LC      +
Sbjct: 62  Y---YD-LPFTCPPTVDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPD 117

Query: 127 DAKFINKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQG 178
             + ++K IK  +   W ID  LPAA        +  +YG+GF LG V+   G
Sbjct: 118 GMRSLDKFIKQEYVVQWFIDKELPAATTFISTVDQKKYYGSGFPLGFVDEETG 170

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 105/276 (38%), Gaps = 57/276 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           + P  YK+ D++ +++N                 V  +   F Y Y   YD    C P  
Sbjct: 40  IKPNVYKKGDKVDVIIN----------------KVVSETARFPYGY---YDLQFVCPPSD 80

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQN 142
            +K    SL  +I GDR + S + L   +  +C+ LC+        K  + LI+ G+  +
Sbjct: 81  KKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAH 140

Query: 143 WLI-DGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRA 201
           WLI D LPAA      ++   FY AGF LG+V+   G                    TR 
Sbjct: 141 WLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAVTGK-------------------TR- 180

Query: 202 EDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLI 261
                          NH  +++ Y                P S+  +       D  P  
Sbjct: 181 -------------LYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQPYE 227

Query: 262 LDEERD--NEVSFTYSVKFK-ESATSWATRWDKYLH 294
           ++ E      + FTYS+ ++ ES   W+ RW+ ++H
Sbjct: 228 INTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 55/132 (41%), Gaps = 24/132 (18%)

Query: 442 VPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK------ 495
           +PG +L  ++ LN  + +  SS  IP  T+   V  +F+ S PLS  G   ARK      
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAK 459

Query: 496 ----------------KCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAV 539
                              +D        + +  PF       I  T++AGI PF  I V
Sbjct: 460 LAPANAISKSPFSFLLTLSYDTRSWPATALGK--PFPIALSNPILLTILAGIAPFVVICV 517

Query: 540 ELYFIYTSLWFN 551
           EL+++Y S+W  
Sbjct: 518 ELFYVYKSMWLQ 529

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 590 WQWRGFIVGG-VGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFI 648
           W+W+ F+ GG V   L ++    L     L    +I+L+V Y+ + + +C    G++G++
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYL 674

Query: 649 SSMFFLRRIYSSIK 662
           S ++FL  I SS K
Sbjct: 675 SCLWFLSHISSSSK 688

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 104/273 (38%), Gaps = 59/273 (21%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           + P  YK  D++ L VN +        E E  N   G           YYD    C P  
Sbjct: 44  IKPNVYKRGDKVDLTVNKV--------ESEITNLPYG-----------YYDLRFVCPPSE 84

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQN 142
            +K    SL  VI GDR + S + L     ++C  LC+     +  +  ++LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 143 WLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRA 201
           WLIDG LPAA      R+   FY AGF LG V                            
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLGRV---------------------------- 176

Query: 202 EDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLI 261
            D+   +T  H    NH  ++I Y                P S+             P +
Sbjct: 177 -DHETDKTHLH----NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYV 231

Query: 262 LDEERDNEVS---FTYSVKFK-ESATSWATRWD 290
           ++ E + EV+   FTYSV ++ ES   W+ RW+
Sbjct: 232 INTE-ETEVTYIPFTYSVYWREESNIDWSHRWN 263

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 74/177 (41%), Gaps = 31/177 (17%)

Query: 399 SLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANL---LLTPLLVPGAILLIIVALNF 455
           S A + F+L       G+YTS  +      P  K NL   +L    +P   L+++   N 
Sbjct: 366 STAAICFVL-------GAYTSSLVGSLL-APGPKMNLGTSVLCGCTLPALALVVVAVFNS 417

Query: 456 FLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK-----KCGWDEHPTKTN-QI 509
            + +  SS  +P  TL  ++  +F+  +PLSF G   ARK       G +   +K     
Sbjct: 418 VVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQSKVPFSF 477

Query: 510 ARQIPFQPWYL------KTIPA--------TLIAGIFPFGSIAVELYFIYTSLWFNK 552
              I +  + L      K IPA        T++ G  PF     EL F+Y SLW  K
Sbjct: 478 LLSIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQK 534

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 589 KWQWRGFIVGGVGCALYVFIHSILFTKF--KLGGFVTIVLYVGYSYVISLLCCLVTGSIG 646
            W+W+ F+ G    A Y  ++S+ +  F   L  F +I+L+V Y+ + +L+C    G++G
Sbjct: 618 SWRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALG 676

Query: 647 FISSMFFL 654
           +++ ++FL
Sbjct: 677 YLTCLWFL 684

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 105/260 (40%), Gaps = 43/260 (16%)

Query: 42  LTPSMYYQHE--DEQGNSVSGDKENFLYSYDYYYDRFHFCRP-KHVEKQPESLGSVIFGD 98
           L+P+ Y   +  D   N V  D  +F Y Y   YD    C P + ++  P +   +++G+
Sbjct: 57  LSPNFYEYGDKVDITVNKVESDLTHFSYGY---YDLHFTCPPSQDMKPLPLTFSDILYGN 113

Query: 99  RIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQNWLI-DGLPAAREVYDG 157
           + + S ++L   ++++CV LC+    G   K   +LIK  +   WL  D LP A    + 
Sbjct: 114 KKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNT 173

Query: 158 RTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFAN 217
           + K  +Y +GF LG  +          P+  E                        Y  N
Sbjct: 174 KDKKKYYSSGFPLGQYD----------PETDEA-----------------------YINN 200

Query: 218 HFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPLILDEERDNE--VSFTYS 275
           H  I+I YH               P S+          D +P  +D   ++   +SFTY+
Sbjct: 201 HVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNEDIEFISFTYA 260

Query: 276 VKFKES-ATSWATRWDKYLH 294
           V ++E     W  RW+ +++
Sbjct: 261 VYWREDFKVDWKNRWNFFIN 280

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 127/290 (43%), Gaps = 42/290 (14%)

Query: 409 ALFGFV-GSYTSMGIYKFFNGPYWKANLLLTPLL---VPGAILLIIVALNFFLMVVHSSG 464
           A+F F+ GS+TS  I     G   +  L+ + +    +PG  L+I++ LN+ L   +++ 
Sbjct: 381 AVFLFISGSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAAN 440

Query: 465 VIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIA----RQIPFQPWYL 520
            +P  T+  +   +F+  +P+S  G   A +    +   T  N  A     +   +P Y+
Sbjct: 441 TLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYV 500

Query: 521 KT-----------IPATLIAGIFPFGSIAVELYFIYTSLWFNK--IFYMXXXXXXXXXXX 567
           ++           I  TL  G+ PF  I VEL F Y SLW  K  ++Y+           
Sbjct: 501 ESKNSIPFVLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIV 560

Query: 568 XXXXXXXXXXXXYHSLCLEN------W------------KWQWRGFIVGGVGCALYVFIH 609
                       Y  L   N      W             W+W+ F +GG   A Y+  +
Sbjct: 561 CICICLLSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAY 619

Query: 610 SILFTKF--KLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRI 657
           SIL+  F  +   F++  L+V YS + ++LC    GS+ ++SS++F+ ++
Sbjct: 620 SILYLIFVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 122/279 (43%), Gaps = 36/279 (12%)

Query: 412 GFVGSYTSMGIYKFFNGPYWKANLL---LTPL-------LVPGAILLIIVALNFFLMVVH 461
           GF+ S+    +    N   +K +L     +PL       L+P  I++I + LN  +    
Sbjct: 382 GFMASFVGTCLIMQKNKTMYKGSLKRLHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHG 441

Query: 462 SSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKC-----------GWDEHPTKTNQIA 510
           SS  +P +T+ F++ ++F+  IPLS  G   A   C              +     + +A
Sbjct: 442 SSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLA 501

Query: 511 RQIP--FQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNK--IFYMXXXXXXXXXX 566
           R I   F   +   + +  I G+FPF  I VEL  +Y  +W  K   +Y+          
Sbjct: 502 RTIKSIFDDPFSGLLAS--IGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIII 559

Query: 567 XXXXXXXXXXXXXY---HS--LCLENWKWQWRGFIVGGVGCALYVFIHSI--LFTKFKLG 619
                        Y   HS    LEN  W+WR F +    CA Y+ ++S+  +F      
Sbjct: 560 LCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTT 617

Query: 620 GFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658
           GF +I+L V  S + + LC    GSIG++++ +F+ R+Y
Sbjct: 618 GFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 107/292 (36%), Gaps = 54/292 (18%)

Query: 8   LLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQ--GNSVSGDKENF 65
           +++F +  T +  + G  P   + +       N LTP++Y + +D +   N +  D    
Sbjct: 9   IIFFLLIVTISTIIYGHIPIIQRHD------ANRLTPNIYRKGDDVELIVNKIESDLTKL 62

Query: 66  LYSYDYYYDRFHFCRPKHVEKQP--ESLGSVIFGDRIYNSPFELNMLQEKECVPLC-NTT 122
            Y Y   YD    C P + +++P   SL  ++ GDR + S + L   ++ +C  LC   T
Sbjct: 63  PYGY---YDLPFICPPTN-QRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKT 118

Query: 123 IPGNDAKFINKLIKNGFFQNWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRS 181
            P    K IN L+K  +   W ID  LPA+           +Y  GF LG V+       
Sbjct: 119 TPEGIQKAIN-LVKKDYIVQWSIDNDLPASTTFISTSENRKYYIPGFSLGFVDPDT---- 173

Query: 182 KTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXN 241
                                        E  Y  NH  ++I YH               
Sbjct: 174 -----------------------------ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVY 204

Query: 242 PLSIKRSITGTCETDASPLILDEERDNEVS---FTYSVKFKES-ATSWATRW 289
           P S+          +     L    D EV+   FTYSV ++E     W  R+
Sbjct: 205 PKSVSDYHCPGASRNYEQFELVANDDEEVTYIPFTYSVYWREEFDVEWKDRY 256

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 98/254 (38%), Gaps = 43/254 (16%)

Query: 44  PSMYYQHEDEQ--GNSVSGDKENFLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIY 101
           PS Y + E  Q   +++  D+E     + YY   F    P        SLG V   +  +
Sbjct: 39  PSAYTRGERVQLLVDNIWTDRE----VWGYYETLFTCPPPAEARAIYGSLGQVFRREMPW 94

Query: 102 NSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKT 161
            S + L++  E +C PLC   +  +  + + ++I++G    W +DGLPAA   Y  R  +
Sbjct: 95  ESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLDGLPAA-TTYPDRQSS 153

Query: 162 NFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDI 221
             Y AGF+LG+V+   G                                 H    NH  +
Sbjct: 154 YRYEAGFKLGEVDAETG---------------------------------HVRLHNHVML 180

Query: 222 MIEYHXXXXXXXXXXXXXXNPLSI--KRSITGTCETDASPLILDEERDNEVSFTYSVKFK 279
           ++ Y                P S+  +    G  E +   L  D +    V FTY+V ++
Sbjct: 181 VVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNPDAQAMIMVPFTYAVYWR 240

Query: 280 -ESATSWATRWDKY 292
            +SA  W  RW  Y
Sbjct: 241 YQSAVKWNERWRLY 254

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 100/283 (35%), Gaps = 57/283 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           V P  Y++ +E+ +L+N                 V G      Y Y   YD    C P  
Sbjct: 40  VRPRIYQDGEEVEMLLNQ----------------VVGKPGELSYGY---YDLQFTCTPTK 80

Query: 84  VEKQ-PESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQN 142
             +    SL  V  GDR + S ++L   +E +C  LC      +     + LI+  +   
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQ 140

Query: 143 WLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRA 201
            LID  +PA++     R    +Y  GF LG V+          P+   T           
Sbjct: 141 LLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------PETDVT----------- 179

Query: 202 EDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRS-ITGTCETDASPL 260
                       Y  NHF ++I Y+               P S+      G+ +   +  
Sbjct: 180 ------------YLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYENYA 227

Query: 261 ILDEERDNE-VSFTYSVKFKES-ATSWATRWDKYLHVYDPSIQ 301
           +   E+D   +  TYSV ++E     W  RW+ YL   D  + 
Sbjct: 228 VNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN 270

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 106/269 (39%), Gaps = 57/269 (21%)

Query: 442 VPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDE 501
           +P   + ++V  N    ++     +P R +  ++ L+F+ S+PLS  G   A  K   D+
Sbjct: 404 LPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQ 462

Query: 502 H----------------PTK-------------TNQIA-RQIPFQPWYLKTIPATLIAGI 531
           H                P+K             T   A  QIP   W  K    T I GI
Sbjct: 463 HFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGI 520

Query: 532 FPFGSIAVELYFIYTSLWFNK--IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSL------ 583
            PF +I +++ FI+  LW +   +F +                       Y  +      
Sbjct: 521 IPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDS 580

Query: 584 --CLENW-----------KWQWRGFIVGGVGCALYVFIHSILFTKF--KLGGFVTIVLYV 628
             C ++             W+W+ F +GG   A Y   +S+ +  F  +L  F +I+LY+
Sbjct: 581 ECCFDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYL 639

Query: 629 GYSYVISLLCCLVTGSIGFISSMFFLRRI 657
            Y  ++++      GSIG+++  +FL ++
Sbjct: 640 SYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 98/278 (35%), Gaps = 52/278 (18%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           V P TY   D + ++VN +      Q +D  G+S  G       SY Y+ D  + C P +
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKYH-DLPYICPPTN 93

Query: 84  VEKQ-PESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQN 142
            +K    SL  +  GD    S + L    + +C  LC         +   ++I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 143 WLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTRA 201
           W ID  LPAA       T+   Y  GF LG  +   G+                      
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGWKDPETGSY--------------------- 192

Query: 202 EDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSI-KRSITGTCETDASPL 260
                       Y  NH  ++I Y+               P SI      G         
Sbjct: 193 ------------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYE 240

Query: 261 ILDEERDNEVS---FTYSVKFKES-ATSWATRWDKYLH 294
           + D E ++E S   F+YSV ++E     W TRW  ++ 
Sbjct: 241 LKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVR 278

 Score = 38.1 bits (87), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 412 GFVGSYTSMGIYKFFNGPYWKANL-LLTPLLVPGAILLIIVALNFFLMVVHSSGVIPART 470
            FVG++  M +++    P +   + ++   ++PG  L  +   N     +  +   P R 
Sbjct: 409 SFVGTWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRK 468

Query: 471 LFFMVFLWFLFSIPLSF-GGSLIAR 494
           L +++F++F+FSIP+S  GGSL  +
Sbjct: 469 LSWLIFVYFIFSIPMSLIGGSLAVK 493

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/275 (21%), Positives = 85/275 (30%), Gaps = 58/275 (21%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           + P  YK  D++ +  N   P       D+   S              YYD    C P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-------DDPAVSQPALC---------YYDLPFVCPPSD 103

Query: 84  VEKQP--ESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQ 141
             K+P   SL  +  GD +  S + L   +++ C  LC+        +    LIKN +  
Sbjct: 104 T-KRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 142 NWLIDG-LPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLELGTR 200
            W +D  LP        +     Y  GF LG  +   G                      
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFDNQTG---------------------- 200

Query: 201 AEDYSIVETFEHPYFANHFDIMIEYHXXXXXXXXXXXXXXNPLSIKRSITGTCETDASPL 260
                        Y   H   ++ YH               P SI          D  PL
Sbjct: 201 -----------QAYLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPL 249

Query: 261 ILDEERDNE----VSFTYSVKFKES-ATSWATRWD 290
            +    +N+    + F+YSV ++E     W  RWD
Sbjct: 250 EVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWD 284

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 53/127 (41%), Gaps = 16/127 (12%)

Query: 380 VTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTP 439
           +  ++FF A G +     G+L    FIL                  F   Y+  N +L  
Sbjct: 389 IIVALFFIAFGIIVSVFIGTLIQRTFILTN----------------FPDKYYLTNPILFG 432

Query: 440 LLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGW 499
             +P  ILL +  +N  + +   +   P +   +    +F+ SIPLS    +++ +   +
Sbjct: 433 STLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISF 492

Query: 500 DEHPTKT 506
            ++P+++
Sbjct: 493 PKYPSRS 499

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 70/156 (44%), Gaps = 16/156 (10%)

Query: 412 GFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTL 471
            F+G++  M I    +  Y     +L   L+P  +++ +  ++  + ++ SS   P +TL
Sbjct: 402 SFLGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTL 461

Query: 472 FFMVFLWFLFSIPLSF-GGSLIARKKCGWDEH------PTKTNQIARQIPFQPWY----- 519
             M+  +++  +P S  GG L  + +  + E         + N    +  F+  +     
Sbjct: 462 TMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSI 521

Query: 520 ----LKTIPATLIAGIFPFGSIAVELYFIYTSLWFN 551
               L T+  +LI  I PF  I  ELY+I+T+ W N
Sbjct: 522 NKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLN 557

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 58/150 (38%), Gaps = 19/150 (12%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFHFCRPKH 83
           + P  YK  D + LLVN            +  ++++ D + ++Y     +D    C P  
Sbjct: 47  LQPNVYKVGDNVDLLVN------------KAISTLNADLKPYIY-----HDLPFVCPPTS 89

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKNGFFQN 142
           V K       S+  GD +  S ++L    + EC  LC      N       +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 143 WLIDG-LPAAREVYDGRTKTNFYGAGFELG 171
           W ID  LP +       T+   Y  GF LG
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLG 179

>Skud_13.466 Chr13 (828310..828331,828415..828809) [417 bp, 138 aa]
           {ON} YMR292W (REAL)
          Length = 138

 Score = 33.5 bits (75), Expect = 0.59,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 399 SLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLM 458
           +L  ++F++  +F  +GS  +   Y FF  P  +   LL    V G+ LLI++   FF  
Sbjct: 35  ALGNILFLI-GVFLIIGSQKT---YVFFTRPNKRRGSLL---FVVGS-LLILLKWTFFGF 86

Query: 459 VVHSSGVIPARTLFFMVFLWFLFSIPL 485
           ++ S G+I     FF V + FL S+P+
Sbjct: 87  IIESLGIIGLFGDFFGVIVQFLRSMPI 113

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 13/87 (14%)

Query: 22  PGVAPTTYKE------NDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDR 75
           PGV P +  +      N ++PL  +H  P+ + Q     GN      +N   S  Y Y +
Sbjct: 123 PGVTPQSQNQKPHITDNMQVPLQPHHFGPNQHGQKRMSAGNYY----QNVTASLQYQYHQ 178

Query: 76  FHFCRPK---HVEKQPESLGSVIFGDR 99
            HF + +   H ++QP  L + +  D+
Sbjct: 179 GHFIQGQSSYHAQEQPNQLYTYLSPDQ 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,740,799
Number of extensions: 2766063
Number of successful extensions: 8405
Number of sequences better than 10.0: 53
Number of HSP's gapped: 8415
Number of HSP's successfully gapped: 81
Length of query: 664
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 548
Effective length of database: 40,180,143
Effective search space: 22018718364
Effective search space used: 22018718364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)