Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_12.1105.122ON56356327700.0
YLR044C (PDC1)5.122ON56356327320.0
Smik_12.1065.122ON56356327210.0
Suva_10.1285.122ON56356327020.0
Suva_10.227na 1ON56356325200.0
Skud_12.203na 1ON56356325160.0
YLR134W (PDC5)na 1ON56356325050.0
CAGL0M07920g5.122ON56456325040.0
NDAI0C031105.122ON56456324880.0
TDEL0E050805.122ON56356224870.0
NCAS0D016605.122ON56456324810.0
KAFR0E020205.122ON56456324710.0
Smik_12.197na 1ON56356324710.0
KLLA0E16303g5.122ON56356224530.0
KLTH0B01188g5.122ON59356224410.0
ZYRO0F01606g5.122ON56356324370.0
NDAI0A01400na 2ON56356224180.0
SAKL0G14894g5.122ON56456324160.0
Kpol_1010.485.122ON56356324080.0
TBLA0B075205.122ON56356324040.0
SAKL0G10164gna 3ON56456324030.0
ACL134C5.122ON58656324030.0
Suva_7.369na 4ON56356323880.0
Ecym_24795.122ON56456323730.0
TPHA0H009505.122ON56356323720.0
YGR087C (PDC6)na 4ON56356323710.0
Kwal_33.155405.122ON56456223690.0
NCAS0A14630na 2ON56356223690.0
TPHA0Q00120singletonON56356323590.0
TBLA0B10060singletonON56456323420.0
SAKL0F04334gsingletonON56456323280.0
KAFR0E01520singletonON56356323140.0
AAL073Wna 3ON56356223020.0
TBLA0E03070singletonON56356322800.0
NDAI0A02510singletonON56356322660.0
KNAG0M012505.122ON56356322520.0
KNAG0J01340singletonON56556222510.0
TBLA0D02840singletonON56356322490.0
NCAS0A14240singletonON56556422400.0
KNAG0J01330singletonON56456322350.0
KLTH0D08272gsingletonON56356222120.0
NDAI0D03270singletonON52152021760.0
CAGL0G02937gna 4ON56456320650.0
Ecym_3185na 3ON56356320010.0
SAKL0E04972g2.390ON61155018300.0
ZYRO0A08426g2.390ON58454916190.0
YDL080C (THI3)2.390ON60955615830.0
Suva_4.1672.390ON62055615820.0
KLTH0E09702g2.390ON60755115790.0
Kwal_47.178782.390ON61055115540.0
TDEL0G032102.390ON60656715440.0
Skud_4.1752.390ON62055615360.0
KNAG0A059002.390ON62055815350.0
Smik_4.1562.390ON62155615310.0
CAGL0L06842g2.390ON63857015120.0
NCAS0A040002.390ON62556814990.0
TPHA0G026202.390ON68859315030.0
KAFR0F029902.390ON60855814540.0
TBLA0B088202.390ON63558614510.0
NDAI0E017002.390ON62156814360.0
Ecym_60552.390ON59256113490.0
ADR254W2.390ON58155412651e-168
Kpol_1046.92.390ON59855910721e-139
CAGL0A03102g5.456ON6496018321e-102
KLLA0F16962g2.390ON5785538171e-101
SAKL0G03036g5.456ON6376008111e-100
Kpol_1062.125.456ON6305968004e-98
Skud_4.6515.456ON6356037962e-97
ACR211W5.456ON6295977952e-97
Suva_2.5545.456ON6356087935e-97
KLTH0F15510g5.456ON6256037831e-95
Smik_4.6495.456ON6356117803e-95
YDR380W (ARO10)5.456ON6356107787e-95
NCAS0A118305.456ON6376117735e-94
KAFR0E037305.456ON6356097571e-91
TPHA0J026805.456ON6486287536e-91
TBLA0A026705.456ON6406077526e-91
Kpol_440.45.456ON6366057491e-90
KNAG0C047905.456ON6376067291e-87
ZYRO0G04378g5.456ON6136057235e-87
TPHA0E016005.456ON6516167179e-86
TDEL0D024505.456ON6756077102e-84
TBLA0A064205.456ON6386067046e-84
KLLA0E02707g5.456ON6315956984e-83
SAKL0D00220gsingletonON5775806612e-78
TDEL0C07020singletonON5605646071e-70
TDEL0F00150singletonON5605646062e-70
NDAI0A044505.456ON5615556028e-70
KLTH0D00418gsingletonON5615665992e-69
YMR108W (ILV2)2.441ON6873101992e-15
Skud_7.383na 4ON86911755e-15
KAFR0A005702.441ON6823091956e-15
CAGL0K03465g2.441ON6773101931e-14
NDAI0H023802.441ON6853081931e-14
Smik_13.2972.441ON6873101921e-14
KNAG0E023602.441ON6933141912e-14
Kpol_297.122.441ON6713101912e-14
TBLA0I014002.441ON7103151912e-14
NCAS0A043202.441ON6893141894e-14
NCAS0F015002.441ON6843101894e-14
KNAG0A062502.441ON6803101851e-13
SAKL0E03740g2.441ON6793111841e-13
TPHA0G024402.441ON6913031842e-13
Kwal_26.75822.441ON6793051822e-13
KLLA0B12584g2.441ON6913041823e-13
Suva_13.2872.441ON6873031796e-13
KLTH0D04532g2.441ON6783051752e-12
TDEL0A021602.441ON6823041733e-12
Skud_13.2672.441ON6873031724e-12
TPHA0G028852.441ON6883031707e-12
ZYRO0E03454g1.450ON5494971662e-11
ZYRO0G19954g2.441ON7003111672e-11
Ecym_61072.441ON6893101653e-11
NDAI0E020502.441ON6903111644e-11
NCAS0G039601.450ON5775221617e-11
AEL305C2.441ON6683081573e-10
TDEL0B055201.450ON5552941529e-10
AEL055C1.450ON5452801214e-06
Skud_5.761.450ON5602911206e-06
Smik_5.871.450ON5605091207e-06
YEL020C1.450ON5605061152e-05
Ecym_13601.450ON5444981143e-05
TPHA0B039401.450ON5753081101e-04
KNAG0H015801.450ON5602581101e-04
Kwal_34.161161.450ON5532951063e-04
Suva_5.681.450ON5615091045e-04
SAKL0D10934g1.450ON550134930.010
KLTH0H14102g1.450ON551289850.10
CAGL0M03245g1.450ON56294761.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_12.110
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...  1071   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...  1056   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...  1052   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...  1045   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   975   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   973   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   969   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   969   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    962   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   962   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   960   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   956   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   956   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   949   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   944   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   943   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              936   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   935   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   932   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   930   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   930   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   930   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   924   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   918   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   918   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   917   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   917   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   917   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      913   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   906   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   901   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   895   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   891   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              882   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   877   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   872   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   871   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   870   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            867   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   865   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   856   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              842   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   800   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   775   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   709   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   628   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   614   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   613   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   612   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   603   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   599   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   596   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   595   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   594   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   587   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   582   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   583   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   564   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   563   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    557   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   524   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   491   e-168
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   417   e-139
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   325   e-102
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   319   e-101
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   317   e-100
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   312   4e-98
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   311   2e-97
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   310   2e-97
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   310   5e-97
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   306   1e-95
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   305   3e-95
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   304   7e-95
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   302   5e-94
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   296   1e-91
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   294   6e-91
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   294   6e-91
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   293   1e-90
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   285   1e-87
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   283   5e-87
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   280   9e-86
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   278   2e-84
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   275   6e-84
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   273   4e-83
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   259   2e-78
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   238   1e-70
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                238   2e-70
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   236   8e-70
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   235   2e-69
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    81   2e-15
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    72   5e-15
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    80   6e-15
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    79   1e-14
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     79   1e-14
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    79   1e-14
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    78   2e-14
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    78   2e-14
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    78   2e-14
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    77   4e-14
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    77   4e-14
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    76   1e-13
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    75   1e-13
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    75   2e-13
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    75   2e-13
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    75   3e-13
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    74   6e-13
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    72   2e-12
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    71   3e-12
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    71   4e-12
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     70   7e-12
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    69   2e-11
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    69   2e-11
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    68   3e-11
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    68   4e-11
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    67   7e-11
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    65   3e-10
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    63   9e-10
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    51   4e-06
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    51   6e-06
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    51   7e-06
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    49   2e-05
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    49   3e-05
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    47   1e-04
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    47   1e-04
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    45   3e-04
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    45   5e-04
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    40   0.010
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    37   0.10 
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    34   1.2  

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1071 bits (2770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/563 (94%), Positives = 533/563 (94%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/563 (93%), Positives = 529/563 (93%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPIDMSLKPNDAESEKEVIDTI+ALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPRYGGVYVGTLSKP VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLTTIADAAKGYK               
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQ WDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/563 (92%), Positives = 529/563 (93%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPIDMSLK NDAESEKEVIDTI++LVKDAKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPRYGGVYVGTLSKP VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLT IADAAKGYK               
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMWNQLG+FLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/563 (91%), Positives = 527/563 (93%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL QVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPIDMSLKPNDAESEKEVIDTI+ALVKDAKNP+ILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRYGGVYVGTLSKP VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDH+KIRNATFPGVQMKFVLQKLLTT+ADAAKGYK               
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMWNQLG FLQEGDVVIAETGTSAFGINQ  FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFN+NSKIRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLVEQAKLTAATNAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/563 (84%), Positives = 505/563 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL QV+ NTVFGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPIDM+LKPNDAE+E EV+ T++ +++DAKNPVILADAC SRHDVKAETKKLIDLTQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPRYGGVYVGTLSKP VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSDHIKIRNATFPGVQMKF LQ+LL+ I +  K YK               
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STP+KQEWMWNQL  FLQEGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+F+LNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNE+Q WDHL+LLPTFGAKDYETHRV TTGEWDKLTQDK F DNS+IRMIE+ML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLV+QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/563 (83%), Positives = 506/563 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL QVN NTVFGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIA+AP+EIDRCIRTT+ TQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPIDMSLKPNDAE+E EV+ T++ ++KDAKNPVILADAC SRHDVKAETKKLI+LTQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQHPRYGGVYVGTLS+P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDHIKIRNATFPGVQMKF LQKLL  I +  K YK               
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +T +KQEWMWNQLGNFLQEGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+F+LNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNE+Q+WDHLSLLPTFGA+DYETHR+ TTGEWDKLTQDK F DNS+IRMIE+ML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLV+QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/563 (83%), Positives = 506/563 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL QVN NTVFGLPGDFNLSLLDK+YEV+GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDIA APAEIDRCIRTTY TQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EV+ T++ L+KDAKNPVILADAC SRHDVKAETKKL+DLTQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPRYGGVYVGTLS+P VK+AVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKF LQKLL  I +  K YK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TP+KQEWMWN LGNFL+EGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+F+LNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ WDHL+LLPTFGA++YETHRVATTGEW+KLTQDK F DNSKIRMIE+ML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAPQNLV+QA+LTAATNAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/563 (84%), Positives = 504/563 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDL V AKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND E+E EV+DT++ L+K AKNPVILADAC SRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  + +A KGYK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQEWMWNQ+  FLQEGDVVI ETGTSAFGINQT FPNN YGISQVLWGSI     
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQNWDHL+LLPTFGAKDYE HRVATTGEWDKLTQDK FN NSKIRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP +L+EQAKLTA+ NAKQ
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQ 563

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/563 (83%), Positives = 504/563 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLK ND E+E EV++TI+ L+KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS PAVKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKI+NATFPGVQMKF LQKLL ++A+AAKGYK               
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQEWMWNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+DPKKRVILFIGDGSLQLTVQEISTM+RW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ+WDHLSLLPTFGAKDYE HRVATTGEW KLT++K FN NS+IR+IEIML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QA+LTA  NAKQ
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQ 563

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/562 (81%), Positives = 497/562 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV+ NT+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+ ++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLK NDAE+E+EV+D ++AL+K AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL  + D AK YK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQ+ FPN TYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTM+RWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KAQYN+IQ W +L LLPTFGAKDYETHRV+TTGEW+KLT D  FN NSKIRMIE+ML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/563 (82%), Positives = 505/563 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL Q++V T+FGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLK NDAE+E EVI+TI+ LVK AKNP+ILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS PA+K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKFVLQKLLT IA AAKGYK               
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WNQ+G FLQEGDVVI+ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLF+LNNDGYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQNW+HL+LLPTFGAKDYE HRV+TTGEWDKLT +K FN N++IRMIEIML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/563 (83%), Positives = 500/563 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+E+TLGKYLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V AKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+EKEV+DTI++L+KDAKNPVIL+DAC SRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPR+GGVYVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNI+EFHSD+ KIRNATFPGVQMKFVL+KLL ++ADAAKGYK               
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPL QEWMWNQ   F QEGDV+I ETGTSAFGINQ+ FPNN+ GISQVLWGSI     
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRW LKPYLF+LNNDGYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQNW HL LL TFGAKDYE HRVATTGEWD L  DK FN NS+IRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QAK+TAATNAKQ
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQ 563

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/563 (82%), Positives = 500/563 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL QV  NTVFGLPGDFNLSLLDK+YEVEGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKG++CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDLNV AKL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EV+ T++ ++KDAKNPVILADAC SRHDVKAETKKLI+LTQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPRYGGVYVGTLS+P VKE VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKF LQKLL  I    K YK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TP+KQEWMWNQL NFLQEGD+VIAETGTSAFGINQTTFP + Y I QVLWGSI     
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPY+F+LNN+GYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A YNEIQ WDHL+LLPTFGAKDYE HR+ATTGEWDKLTQDK F DNS+IR+IE+ML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAP+NLV+QA+LTA+ NAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/562 (82%), Positives = 499/562 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV V T+FGLPGDFNLSLLD IYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMS+NISETTAMITDI TAPAEIDRCIRTTYV+QRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLKPND E+E+EVI+ ++ L+K+AKNPVILADACCSRHD KAETKKLIDLTQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDE+HPR+GGVYVGTLS PAVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+ KIR+ATFPGVQMKF LQKLLT +ADAAKGYK               
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+W Q+G FL+EGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN IQNW HL LLPTFGAKDYE  RV+TTGEW+KLT D+ F DN++IR+IE+ML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           P  DAP NLV+QA+LTAATNAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/562 (78%), Positives = 492/562 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+Y+FERLKQV+V TVFGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMITD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  V A L
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID++LKPND ++E+EVI T++ ++KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS PAVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVLQ LL  +    K YK               
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLF+LNN GYTIEKLI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQNW+HL LLPTFGAKDYE  RV+TTGEW+KL +DK FN NSKIR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 491/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV+ NT+FG+PGDFNLSLLDK+YEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KG++ +ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  YV QRPVYLGLPANLVD  V A L
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLK ND E+E EV+DT++ L+K+AKNPVILADACCSRHDVKAETKKLIDLTQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVL+KLL  + +A K YK               
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            ST LKQEW+W Q+G+FL+EGDVVI ETGTSAFGINQT FPN TYGISQVLWGSI     
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  A+YN IQ W HL LL TFGAKDYE HRV+T GEW+KLTQD  FN+NS+IRMIE+ML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
            V DAP +LV QA+LTAATNAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/562 (82%), Positives = 503/562 (89%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QVNVNT+FGLPGDFNLSLLDKIYE  GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EV++ +++L+K+AKNPVILADACCSRHDVK ET+KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PR+GGVYVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLL ++  A KGYK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMWNQ+G FLQEGD+VI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPK+RVILFIGDGSLQLTVQEISTM+RW LKPYLFILNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ+W+HL LL TFGAKDYE HRVATTGEW+KL ++K FN NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAPQ+L++Q +LTA  NA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/563 (81%), Positives = 497/563 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTA +TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLKPND E+E EV++T++ L+KDAKNPVILADAC SRH+VK+ETK+LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPR+GGVYVGTLS   VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL+ + +  K YK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W +L LLPTFGAKDYET+RVATTGEWDKL QD++FN NS+IRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/563 (80%), Positives = 493/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSA ISETTAMITDIA APAEIDRCIRTTY+TQR VYLGLPAN+VDL V A L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SLKPND E+E EV+DTI+A+VK+AKNP+ILADAC SRHDVKAETK+LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPR+GGVYVGTLS+P VK AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSDH KI+ A+FPGVQMKFVLQKL+  I  A K YK               
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+F+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQNW HL +LPTFGAKDYE  RVATTGE++KL +DK+FN+NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/563 (80%), Positives = 496/563 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+E+TLGKYLFERL QV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSA ISETTAMITDIATAPAEIDRCIRTTYV QR VYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDAE+E EVI+T++ LV++AKNP+I+ADACCSRHDVK+ET++LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E+HPR+GGVYVGTLS+P VK AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDHIK++NATFPGVQMKFVLQKL++ I  A KGYK               
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQEW+WNQLGNFLQEGD+V+ ETGTSAFGINQTTFP +TYGISQVLWGSI     
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEI+P KR ILFIGDGSLQLTVQEIST+IRW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W+HL +LPTFGAKDYE  RVATTGEW KLT DK+F  NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QAKLTAATNAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/563 (81%), Positives = 495/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTA +TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLKPND E+E EV+++++ L+KDAKNP+ILADAC SRHDVK ETK+LID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPR+GGVYVGTLS   VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKF LQKLL+ I    K YK               
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTMIRWGL+PYLF+LNNDGYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W +L LLPTFGAKDYET+RVATTGEWDKL QD++FN NS+IRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQ 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/563 (79%), Positives = 496/563 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL+Q+ V T+FGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANIS TTAMI+DI +APAEIDRCIRT Y+TQRPVYLGLPAN+VDL V A L
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID++LKPND E+E EV++T++ ++  AKNPVIL+DAC SRHDVKAET KLID+TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSI EQHPR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDHIKIRNATFPGVQMK+VL+KL+  +A+  K Y                
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPLKQEW+WNQ+G FL+EGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+DP +RVILFIGDGSLQLTVQEISTM+RWGLKPYLF+LNNDGYTIE+LI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN+IQ W HL+LLPTFGAKDYE  RV+TTGEWD LTQDK+FN+NSKIRMIE+ML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTAATNAKQ
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQ 585

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 495/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQVNVNT+FGLPGDFNLSLLDKIYEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKG+S +ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMS NISETT+MITDIATAP+EIDR IRTT+VTQRP YLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+ PID+SLKPND E+EKEVIDT++ L++ +KNP+IL+DAC SRH VK ET+KLIDLTQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPRYGGVYVGTLSKP VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IK++NATFPGVQMKF LQKLL+ I    K YK               
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WN+L  FLQEGDV+++ETGTSAFGINQT+FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+DP +RVILFIGDGSLQLTVQEISTM+RWGLKPYLF+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ WDHL+LLPTFGAK YE H+VATTGEWDKLT D  F  NS IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAP++L++QA+LTAATNAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 491/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+T+G YLF+RLKQV V T+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISE+TAMITD+ATA  EIDRCIRT Y++QRPVYLGLPANLVD  V A L
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID SLKPNDAE+E EV+ T++ ++ ++KNPVIL+DAC SRHDVK ETK+LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDH K+RNATFPGVQMKFVL+KL+  + D AK Y                
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TPL+QEW+W ++  FL+EGDVVI ETGTSAFGINQT FPN+TYGISQVLWGSI     
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN+IQ WDHL LLPTFGAKDYE  RV+T GEW +LTQDK+F++NSKIRMIE+ML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QA+LTAATNAKQ
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQ 563

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  918 bits (2372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 488/563 (86%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS++TLGKYLFERLKQV   T+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL V A +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND ++E EV+  I+ L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+  +    KGYK               
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPLKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+F+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQNW HL +LPTFGAKDYET RVATTGEWDKL  DK+FN+NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTAATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 492/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERLKQVNVNT+FGLPGDFNLSLLDKIYEV+G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKG+S ++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETT+MITDIATAP+EIDR IRTT++TQRP YLGLPANLVDL V   L
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+ PID+SLKPND E+EKEVIDT++ L++++KNPVIL+DAC SRH+VK ET+KLIDLTQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDEQHPRYGGVYVGTLSK  VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD++K++NATF GVQMKF LQ LL  I D  KGYK               
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WN+L  FLQEGDV+I+ETGTSAFGINQT FP + YGISQVLWGSI     
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDP KRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNNDGYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQ WDHL+LLP FGAK YE H++ATTGEWD LT D  F  NS IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PVFDAP++L++QA+LTAATNAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/562 (81%), Positives = 497/562 (88%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL+QV  NT+FGLPGDFNL LLD+IYE EGMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAMI+D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  V A L
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPNDA +E+EV+ T++ L+K+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS PAVKEAVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLT + D  K YK               
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQ+W+WNQ+G FLQEGDVVI ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEISTMIRWGLKPYLF+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQ W+HL LLPTFGAKDYET RVATTGEW+KL +D+ FN NSKIRMIE+ML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/562 (79%), Positives = 491/562 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQVNVNT+FGLPGDFNL+LLDKIYEV GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMS+NISETTAM+TD+A A +EIDRCIRTTYVTQR VYLGLPAN+ DL V A L
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLKPNDA +E EV++TI++LVKDAKNP+ILADACCSRHDVKAETKKLID+TQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQ+PRYGGVYVGTLS P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDHIKI++ATFPGVQMKFVLQKLL  I   AKGYK               
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            +TP+KQEWMWN+L  F QEGDV+I ETGTSAFGINQT FP N YGISQVLWGSI     
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLF+LNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG KA YN+IQ W+HL+LL TFGAKDYE HRV+TTGEW+KLT +K FN NS+IR+IEIML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
            V DAP NLV QA+LTA+ NAK
Sbjct: 541 EVMDAPSNLVAQAQLTASINAK 562

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/563 (78%), Positives = 487/563 (86%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS++TLGKYLFERLKQV  NT+FGLPGDFNLSLLDKIYEV GMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSA ISETT+MITDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL V A +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND ++E EV+  I+ L+KDAKNP+ILADAC SRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS+P VK+AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y TKNIVEFHSDHIKIR A+FPGVQMKFVL+KL+  +    KGYK               
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPLKQEW+WNQ+G FL+EGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKR I+FIGDGSLQLTVQEISTMIRW LKPY+F+LNN+GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A+YNEIQNW HL +L TFGAKDYE HRVATTGEWDKL  D++FN+NSKIR+IEIML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ QAKLT ATNAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/563 (78%), Positives = 489/563 (86%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS++TLGKYLFERL QV V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF  FHRMSA ISETTAMITDIA APAEIDRCIRTTYVTQR VYLGLPANLVDL V A L
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID++LKPN  ESE EVI+TI+ +VK+AKNP+I+ADAC SRH+VK ET++LID+TQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSI+E+HPR+GGVYVGTLS+P +K+AVESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSDH+KI+NATF GVQMKFVL+KL+  I D  K YK               
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPLKQEW+WNQLGNFLQEGD+V+ ETGTSAFGINQTTFP +TYGISQVLWGSI     
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEI+P KR ILFIGDGSLQLTVQEIST+IRW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W+HL +LPTFGAKDYE  RVATTGEWDKLT DK+FN NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV QA+LTAA NAKQ
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQ 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/563 (77%), Positives = 492/563 (87%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV V T+FGLPGDFNLSLLDKIYEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGMSCI+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMS+ ISETTA+ITDI  AP EIDRCI+ TY  QRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+S+ PNDA++E EV++T++A+V  AKNPVILADACC+RHDVK ETKKLIDLTQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDE HPR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+ K+RNATFPGVQMK VLQKLL+ ++DAA GYK               
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEW+WN + ++L+EGDVVI ETGTSAFGINQ+ FPN+TYGISQVLWGSI     
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  +RVILF+GDGSLQLTVQEISTM+RWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN++Q W HL+LLPTFGAKDY++ R++TTGE+ KLT+D++F+ NSKIR+IE+ML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP  LV+QA+LTAATNAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 482/563 (85%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV+V T+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTA++TDIATA AEIDRCI+TTY+TQRPVYLG+PAN+ D  + AKL
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SLKPND E+E EVID I++LVK AKNPVIL+DAC SRH+V+ ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSIDEQHPRYGGVYVGTLS+P VK+AVES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+ KI+NATFPGVQMKFVLQKL   I    KGYK               
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPL QEWMWNQ   F QEGD++I ETGT+AFGINQ+ FP +  GISQVLWGSI     
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  +RVILFIGDGSLQLTVQEISTMIRW L+PYLF+LNN+GYTIEKLI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYNEIQNW HL LL TFGAKDYE HR+ATTGEWD L  +K FN NS+IR+IEIML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NLV+QAK+TAATNA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/562 (77%), Positives = 486/562 (86%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERLKQV V T+FG+PGDFNLSLLDK+YEV+GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+K +SC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SAQAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANIS+TTA+ITDI++APAEIDRCIR  YV QRPVYLGLPAN+VDL V A L
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+T ID+SLKPND E+E+EV+ T++ LV +AK+PVIL+DAC SRHDVK ETK+LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDEQHPR+GGVYVGTLS P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSDH KIR+ATFPG++MK VLQ L+  I +AAKGY+               
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPLKQEW+WNQ+ +FL+EGD+VI ETGT+AFGINQT FP++T GISQVLWGSI     
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDP KRVILFIGDGSLQLTVQEISTM+RWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HG  AQYN IQ W HL LLPTFGAKDYETHRVATTGEW  LT+ + FN NS IRMIEIML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
            V DAP +L++QAKLTAATNA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/563 (76%), Positives = 476/563 (84%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERLKQVNVNT+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS ++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF VFHRMS  ISETTAMITD++ A ++ID CIR TY TQRPVYLG+PAN+ D  + AKL
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPI+M L PN+ ESE EV++TI+ +VK AKNPVI+ADACCSRH+VKAET+KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAF TPMGKGSI+E HPR+GGVYVGTL++P VK+AVESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSDHIKI+NATF GVQMKFVL +L+  I D  K YK               
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL+QEW+WNQLGNFLQEGD+V+ ETGTSAFGIN T FP NTYGI+QVLWGSI     
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRV LFIGDGSLQLTVQEISTMIRW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ WDHLS+LPTFGA DYE  RVAT GEW+KLT D  FN NSKIRMIEIML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ Q KLT A NA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/563 (73%), Positives = 471/563 (83%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+TLG+YLFERL QV+V+T+FGLPGDFNL+LLDK+YEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVG PS ++QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTY+ QRPVYLG+PAN  DL V A L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SL  N+ E+EKE +  ++ LVK +KNP+I+ DAC SRHDVKAET KLI+LTQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+I+EQHPRYGGVYVGTLS+P VKEAVESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y TK++VEFHSD+++I+ ATFPGVQMKF+L KL   I +  + YK               
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            ST LKQ W+WNQL  FL+EGD+VI ETGTS FGIN+TTFP N   ISQVLWGSI     
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+DPK+RVILF GDGSLQLTVQEISTMIRW LKPYLF+LNN GYTIEKLI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A YNEIQ+W+HL LL TFGAKDYE +RV+TTG W+++T DK FN+NSKIRMIE+ML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP++L++Q +LTA  N+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/563 (75%), Positives = 473/563 (84%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M +LTLG+YLFERL QV+V T+FGLPGDFNLSLLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+CIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMSANISETTAM+TDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V   L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID++LKPND E+E EVI+T++ L+++A NPVILADAC  RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKG+IDE++PR+GGVYVGTLS   V+ AVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           YKTKNIVEFHSD+IKIRNATFPGVQMKFVL KLL  +  A KGY                
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             T L+QEWMWN++  F ++GD+++ ETGT+AFGINQ+ FPNNT GISQVLWGSI     
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDP KRVILFIGDGSLQLTVQEIST+IRW LKPYLF+LNN+GYTIE+LI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP A YN IQ W H  LL  FGA DYE  ++ TTGEW  LTQDK FN+ SKIRMIE+ML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP NL+ QAKLTA  N+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/562 (74%), Positives = 466/562 (82%), Gaps = 1/562 (0%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERLKQV VNT+FGLPGDFNL LLDKIY+V G+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  +QA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF VFHRMSA ISETT MITD   A  +IDRCIRTTYV QR VYLG+PAN+ D  +   L
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLK N+  SE++V+DTI+  VKDAKNP+I++DAC SRHDVK ET++LI++TQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTP+GKGSIDE HPRYGG+YVGTLS+P VKEAVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSDH+KI+NA FPGVQM+ +L+KLL  I    KGY                
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 361 XST-PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
            +T PL+QEWMWNQL  FLQEGD++I ETGTSAFGIN TTFP N  GISQVLWGSI    
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKL 479
                     EEIDPKKRVILFIGDGSLQLTVQEISTMI+W LKPYLFILNN+GYTIEKL
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIM 539
           IHGP A+YNEIQ+WDHL LLPT GAKDYE  RVAT GEW+KLTQDK FN NS+IR+IE+M
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVFDAPQNLVEQAKLTAATNA 561
           LPV DAPQ+L+EQ KLT   NA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/563 (73%), Positives = 474/563 (84%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS++TLG+YLFERL Q+ + T+FGLPGDFNL LLDKIYE+ GMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ AQAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF  F+RMS+ ISET  MI D+ TAPAEIDRCI+T YV QRPVYLGLP NLV+  V   L
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L TPID+SL+PNDA+SE EVI TI+ +VK AKNP+I+ADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI+EQHPR+GGVYVGTL++P VK+AVESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKN++EFHSDH KI+NA + G+QMKFVL KL+T I +  K YK               
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL+QEW+WNQLGNFLQEGD+V+ ETGTSAFGINQT FP NTYGISQVLWGSI     
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRV+LFIGDGSLQLTVQEISTM+ W LKPYLF+LNNDGYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ W++L LL TFGAKDY+  RVATTGEW+ LTQ+  FN NSKIRMIE+ML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           P  DAP NL+ QA+LTA+ NAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/564 (74%), Positives = 475/564 (84%), Gaps = 2/564 (0%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ++LG+YLFERL QV+V+T+FGLPGDFNL+LLDKIYEV GMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFTVFHRMS+NISETT+++TD+A APAEIDRCIR TY+ QRPVYLG+PAN  DL + AKL
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+SL  ND E+E E ID ++ LVKDA NP+IL DAC SRHDVK ETKKLID+TQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+I+EQHPRYGGVYVG L+ PA+KEAVESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
            KTKN+VEFHSD++KIRNA+FPGVQMKFVLQKL   +    K YK               
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STP+KQEWMWNQL  FLQEGD+VI+ETGTS FGINQT+FPNNT GISQVLWGSI     
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDPKKRVILF GDGSLQLTVQEISTM+RW LKPYLF+LNN+GYTIEKLI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEI 538
           HG  A YNEIQ W+HL L   FGAK+  +E HRV+TTGEW+KLT+ K F DN+KIRMIE+
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVFDAPQNLVEQAKLTAATNAK 562
           MLPV DAP +L++QAKLTA+ NAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/563 (75%), Positives = 472/563 (83%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERLKQV VNT+FGLPGDFNL LLDKIY++ GMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YARIKGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  +QAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF VFHRMSA ISETTA+ITD++ A +EIDRCIRTTYV QR VYLG+PAN+ D  +   L
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SLK N+ ESE EV+DTI+ LV  AKNP+ILADAC SRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           PAFVTPMGKGSIDE HPRYGG+YVGTLS PAVK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y+TKNIVEFHSDHIKIRNA FP +QMK +LQKL+T I      Y                
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
            STPLKQEWMW +LGNFLQEGD+VI ETGTSAFGIN TTFP NT GISQVLWGSI     
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EEIDP +RVILFIGDGSLQLTVQEIST I+W LKPYLFILNN+GYTIEKLI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQ+W+HL LLPTFGAKDYE  R+AT GEW+KLTQDK FN NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           PV DAP++L++Q +LTAA NAK+
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKK 563

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/562 (72%), Positives = 469/562 (83%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS +TLG+YLFERL+QV   T+FGLPGDFNL LLD+IYEVEGMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KG++C+ITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS+++QAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF VFHRMSANIS+TTAM+TD+ATAP EIDRCIRTTYVTQRPVYLGLPAN+V+  VD +L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID+SL+PND ++E+EV+  ++ALV+ A+NP+ILADACCSRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E+HPR+GGVYVGTLS P VK AVE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y T+N+VEFHSDH K+RNA FP V MKFVLQKL+  I  A + Y                
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL QEW+W Q+G FL+EGDVV+ ETGTSAFGINQT FPNNTYGISQVLWGSI     
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    EE+D  KRVILFIGDGSLQLTVQEIS+M+RWGL+PYLF+ NNDGYTIEKLI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP AQYNEIQNW HL LLPTFGA DYE  RVATTGEWD LT D +FN NS+IR++E+ML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVFDAPQNLVEQAKLTAATNAK 562
            V DAP +LV QA+LTAATNA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/520 (76%), Positives = 437/520 (84%)

Query: 43  MRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGNANELNAAYAADGYAR+KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRP 162
           S ++QAK LLLHHTLGNGDFTVFHRMS+N+SETTAMITD+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLNVDAKLLDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACC 222
           VYLG+PAN  DL V A LL+TPID+ L PN+ E+EKE +D I+ L+KD+KNP IL DAC 
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLI 282
           SRHDVKAET KLI+LTQFP FVTPMGKG+I+EQHPRYGGVYVGTLSKP VK+AVESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAK 342
           LSVGALLSDFNTGSFSYSYKTKNIVEFHSD+IKIRNATFPGVQMKFVL KL   I +   
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 GYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPN 402
           GYK                +TPLKQ WMWNQL  FL+EGDVVI ETGT  FGIN+TTFP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGL 462
           N  GISQVLWGSI              EE+DP KRVILF GDGSLQLTVQEISTMIRW L
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLT 522
           +PYLFILNN+GYTIEKLIHGP AQYNEIQ+WDHL LL TFGAKDYE HRVATTGEW KLT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 QDKSFNDNSKIRMIEIMLPVFDAPQNLVEQAKLTAATNAK 562
           ++K FN NS+IR+IE+MLPV DAP++L++Q +LTA  NAK
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAK 520

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/563 (68%), Positives = 454/563 (80%), Gaps = 1/563 (0%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+E+TLG+YLFERL Q++++T+FGLPGDFNL+LLDKIYEVEG+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+KGM+C++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  ++AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DF  FHRMS+ ISETT +++D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D  V +KL
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           LDTPID++L+PN  ++E+EV+D I+ ++K +K P+ILADAC SRHDVK ETK+LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDE  PR+GGVYVG LS P VK  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
             T+N++EFHSDH+KIRNATFPGVQMKFVL+KLL  +    KG                 
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 361 XST-PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
                +KQEWMW  +G FLQEGDVV+ ETGTS FGI ++ FP NT GISQVLWGSI    
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKL 479
                     +EIDPKKRVILFIGDGSLQLTVQE+ST  RWGL PY+F+LNN+GYTIE+L
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIM 539
           IHG    YN+IQ+WDH  +LP FGAK+YE  RVAT GEW+ +  DK FN N K+RMIE+M
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVFDAPQNLVEQAKLTAATNAK 562
           LP  D P+NL +QAKLTA+ NAK
Sbjct: 541 LPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/563 (63%), Positives = 444/563 (78%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MSE+++G+YLFERL QV V T+FGLPGDFNLSLLDK+YEV G+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120
           YAR+ GM C++TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           DFT FHRM   I++TTA+++D ATA +EIDRCI+T  +T  PVYLG+PAN+    +DA L
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           L+TPID+S + ND ++E EVID ++ L+++A+NP+IL+DAC SR+D+K E K LID+TQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGK S++EQHPRYGGVY G++SKP VK+AVESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXX 360
           Y TK+IVEFHS    I+NATF GVQMKFVLQKL   + D  + Y                
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 XSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
             TPL Q+W+W ++  FL+EGD+VIAE+GT AFGIN+ T P  T  ISQ+LWGSI     
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 XXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480
                    +EIDP +RVILFIGDGSLQL VQE+STMIRWGLKPYLF+LNNDGYTIE+LI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540
           HGP+AQYN+IQ W+HL LLP FGAK+YE  R++T G W +LTQD  FN++SKIR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVFDAPQNLVEQAKLTAATNAKQ 563
           P  D+   LV+QAK+    N+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/550 (58%), Positives = 422/550 (76%), Gaps = 1/550 (0%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           ++LG YLF+RL+Q+ V T+FGLPGDFN++LLDKIYEV G+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           IKG+ C++TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  AQ K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ VD  +L  
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+SLK ND E EK+V+++I+  +K AKNPVI+ADAC +RHDV  ET++L+DLTQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDEQHPR+GGVYVG++S P V+E V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
           KN+V  +++H K++NA +P +++KFVLQ LL ++++    YK                + 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
           PL+QEW+WNQ+ ++  EGD+VI ETGTSAFGINQT FPNNT  ISQVLWGSI        
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIH-G 482
                 EE+  K RVILF+GDG+LQLTVQEISTMIRWGLKPYLF++NN GYTI++L+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPV 542
             A Y++IQ WD+L LLP FGA +Y+  +V T G++ KL  D  F  + K++MIE++LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 FDAPQNLVEQ 552
            DAP  L+ +
Sbjct: 554 MDAPPALLNK 563

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/549 (51%), Positives = 387/549 (70%), Gaps = 1/549 (0%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T+  Y F RLKQ+ V T+FGLPG+FN  L+DK+Y +EG+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CII+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  SAQ +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHRM+  +S  +A+I D      E+D CIR  Y+ QRPVY+G+P NLV + VD+  L+ 
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           PID+S+ PND   E EVID I+     A NPVI+ADAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P++GGVY G++S P+V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
             +V  +   +K ++AT+P + +K +L  LL  + +    Y+                + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
           PL+QEW+WNQ+  +  EGDV+I ETGTSAFGINQT FP +T GISQ LWGS+        
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 XXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGP 483
                 +E     RV+LF+GDG+ QLT QE+ST+IRWGL PY+FI+NN GY++++ +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 KAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVF 543
            A Y +IQ W++ +L   FGAKDYE+ ++ T G++  +  D +F+   +IR++EIMLP  
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPQNLVEQ 552
           D PQ L E+
Sbjct: 551 DVPQALREK 559

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/556 (48%), Positives = 396/556 (71%), Gaps = 7/556 (1%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           + +  YLF RL Q+N++T+FGL G+F++ LLDK+Y +  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L +++  L+T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  I++ +  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
           KN    +S  +K++NAT+P + +K +LQK+L  + ++   Y+                + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++ ++ Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+F++NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  +  D +F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/556 (49%), Positives = 396/556 (71%), Gaps = 7/556 (1%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           + +  YLF RL Q+N++T+FGL G+F++ LLDK+Y++  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L ++++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  I++ +  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
           KN    +S  +K++NAT+P + +K +LQKLL T+ ++   Y+                + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++  + Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+F++NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  +  D +F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/551 (49%), Positives = 394/551 (71%), Gaps = 1/551 (0%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           E+ L +Y+  RL+Q+ + T+FG+PG FN+ LL +I  V  M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK ++C++TTFGVGELSA+NG+AGS+AEHVG+LH VG+P ++AQ ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V + LL+
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
            P+D+S    + E +++ ++ I++ +   ++P I+ DAC SRH+V AE ++L++LTQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPR+GG +VG++S P V+E V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXS 362
            KN     S + +++NA +P +++K  L+ LLT +  +   Y+                +
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
            PL+QEW+WNQ+ N+ +EGD+VI ETGTSAFG+NQ+ FPNNT  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIH- 481
                   E     RVILF+GDG+LQLTVQE+STMIRWGLKP +F++NN GYTI++L+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 482 GPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLP 541
              A Y++IQ WD+L LLP FGA DY+T  V T G++  L  D  F  N+KI+M+E++LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VFDAPQNLVEQ 552
             DAP  L+++
Sbjct: 554 PMDAPPALMDK 564

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/551 (49%), Positives = 385/551 (69%), Gaps = 1/551 (0%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           ++TL ++L  RL+Q+ + T+F +PG F++  + +IY+   M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK + C+ TTFGVGELSA+NG+AG++AEHVG+LHVVG+P ++AQ KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL+
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
            P+D+     + ++E+  ++T++  +    NP I+ADAC SRH+V+AE K L+DLTQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQHPR+GG +VG++S P V+E V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXS 362
           TKN V   SD+ K++NA +P + +K VL+ +L  +  +   Y+                +
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
            PL+QEW+W Q+  + +EGD+VI ETGTSAFG+NQ  FP++T  I+Q LWGS+       
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIH- 481
                   E     RVILF+GDG+LQLTVQEISTMIRWGL P +F++NN GYTI++L+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 482 GPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLP 541
              A Y++IQ WD+L +LPTFGA +YE   V T G++  L  D  F  N KI+M+E++LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VFDAPQNLVEQ 552
             DAP  L+++
Sbjct: 554 PMDAPPALMDK 564

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/567 (48%), Positives = 394/567 (69%), Gaps = 8/567 (1%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +++ +YLF RLKQ+++ T+FGLPG FN +LLDK+ E+ G+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ CIITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHRM++ ++  + +I D      E+D CI   +  Q+PVY+G+P NLVD +V+++ L+T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
            ++++L  ND ++E E++  I+  +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P +GGV++G++S P V+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
           K  V  +   +K ++A +P +++K ++  LL  + ++   Y+                  
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+ EW+WNQ+ ++ QEGD++I ETGTSAFGINQT FP+++ GISQ LWGS+        
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 XXXXXXEEIDPKK------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
                  E+   +      RVILF+GDG+ QLTVQE+STMIRWGL PY+F++NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 KLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L L+P FGA+ YET ++ T G++ ++  D  F  N KIRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EIMLPVFDAPQNLVEQAKLTAATNAKQ 563
           EIMLP  D PQ L+++  LT   N K+
Sbjct: 553 EIMLPPMDVPQALMDRW-LTEQENKKR 578

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/556 (49%), Positives = 397/556 (71%), Gaps = 7/556 (1%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           + +  YLF RL Q+N++T+FGL G+F++ LLDK+Y++  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHR++++++  T +I D      E+D+CI+  ++ QRPVY+G+P N V+L +++  L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  I++++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
           KN    +S  +K++NAT+P + +K +LQKLL ++ ++   Y+                + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++  + Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
                 +EI+       K RVILF+GDG+ QLTVQE+ST+++WGL PY+F++NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  L  D +F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQALLDR 570

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/558 (49%), Positives = 380/558 (68%), Gaps = 9/558 (1%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           ++T+  YLF RL+Q+ V T+FGLPG+FN+ LLDKIY +  MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK + C++TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            VF+RM+ +++  T ++ D      E+D+C+   +  Q+P YLG+P N VDL VD+  LD
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           TP+++  +PN+ E E +V+ TI+  +   +NP I+ DAC  RHD+  ETK+   +T FP 
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    +GGV+ G+LS P+V+E V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXS 362
           TKN    HS  +K++NAT+P + +K ++Q LL+ +  +                     +
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
             LKQEW+WN+L ++ Q+GD++I E GTSAFGINQT FP  T GISQ LW S        
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 XXXXXXXEEIDP--------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGY 474
                  +E+          + RV+LF+GDG+ Q+T+QEISTMIRW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIEKLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKI 533
           ++++ +H   KA Y ++Q W +L     FGA DYET ++ T G+   +  DK F  + KI
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEIMLPVFDAPQNLVE 551
           RM+EIMLP  D PQ LVE
Sbjct: 556 RMLEIMLPSTDVPQVLVE 573

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/556 (49%), Positives = 395/556 (71%), Gaps = 7/556 (1%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +++  YLF RL Q+N++T+FGL G+F++ LLDK+Y +  +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
           +KG+ C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           VFHR++++++  T +I D      E+D+CIR  ++ QRPVY+G+P N V+L +++  L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAF 243
           P+D+ L  ND + EKEVI  I++ +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P++GGV+ G++S P V+E V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXST 363
           KN    +S  +K++NAT+P + +K +LQKLL ++ ++   Y+                + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXX 423
            L+QEW+WN++ ++ Q GD++I ETG SAFG+NQT FP NT GISQ LWGS+        
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 XXXXXXEEIDP------KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
                 +EI        K RVILF+GDG+ QLTVQE+ST+++WGL PY+F++NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 KLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           + +H    A Y +IQ W++L LL  FG  +YET ++ T GE+  +  D  F  N KIRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EIMLPVFDAPQNLVEQ 552
           EIMLP  D PQ L+++
Sbjct: 555 EIMLPPRDVPQVLLDR 570

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/570 (48%), Positives = 380/570 (66%), Gaps = 19/570 (3%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S++++ +YLF RL Q+ + T+FGLPGDFN+ LLDK+Y +  MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           +R+K + C+ITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLL 181
           ++VF+R++ +I+  TA+I D      E+D CIR  +  Q+PVYLG+P N VD+ VD+  L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 DTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
           + PID+S+     E++ +VID ++  +  A  P+I+ DAC  RHD   ET  L +LT FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  +GGVY G+LS P V+E  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXX 361
           K KN        +KI+ ATFP + +K  LQ L+ TI  +   YK                
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
           S  L+QEW+WN++ ++ +E D++I ETG+SAFGINQT FP NT GI+Q LWGS+      
Sbjct: 371 SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCS 430

Query: 422 XXXXXXXXEE------------------IDPKKRVILFIGDGSLQLTVQEISTMIRWGLK 463
                   EE                  I  + R ILF+GDG+ QLTVQE+ST+IRW LK
Sbjct: 431 CLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLK 490

Query: 464 PYLFILNNDGYTIEKLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLT 522
           PY+FI+NN+GY++++ +H    A Y ++Q W++L LL  FG   +ET ++ T  ++ +L 
Sbjct: 491 PYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELL 550

Query: 523 QDKSFNDNSKIRMIEIMLPVFDAPQNLVEQ 552
            D+SF    KIRMIEIMLP  D P+ L+ +
Sbjct: 551 ADESFAKPDKIRMIEIMLPQSDVPKTLIAR 580

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/568 (47%), Positives = 388/568 (68%), Gaps = 15/568 (2%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           ++T+ +YLF RLKQ+++ T+FGL G++N+ L+DK+Y+V  +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+KG+  +ITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
           +VFHR++++I+    +I D      E+D+CI   ++ QRPVY+G+P N V+L VD+K LD
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
            P+D+ +  N  E   E+ + I+  +   K+P I+ DAC  RH+   E ++    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P +GGV++G+LS P+V+E V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXS 362
            K+ V   SD +KI+N+ +  + +K +++ LL ++ ++   Y                  
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 TPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX 422
             L+QEW+WN++ ++ +EGD++I E GTSAFGINQT FPN   GISQ LWGS        
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 423 XXXXXXXEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFI 468
                  +E +               K RVILF+GDG+ QLT+QE+ST+IRW L PY+F+
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNDGYTIEKLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSF 527
           LNN+GY++++ +H    A Y +IQ W++L L+ TF AK+YET ++ T G++  + QD  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NDNSKIRMIEIMLPVFDAPQNLVEQAKL 555
             N KIRM+EI+LP  D PQ LV+  KL
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/593 (47%), Positives = 392/593 (66%), Gaps = 43/593 (7%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           ELT+ +YLF RLKQ+NVNT+FGLPG+FN+SLLDK+Y VEGMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+K + C++TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            +FHR+S +I   +A++T       EID+C+   +++Q+PVYLGLP NLV + V + LL+
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           TP+D+ L  ND ++E   ID I+  +  AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE   ++GGV+VG++S   V+E V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYK----------XXXXXXX 352
           TK+IV   S  +K++N  +P + +K  L KL+  I      YK                 
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 353 XXXXXXXXXSTP-----------LKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFP 401
                     TP           LKQEW+WN+   + +EGD++I ETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNTYGISQVLWGSIXXXXXXXXXXXXXXEEI---DP---KKRVILFIGDGSLQLTVQEIS 455
           N T GISQ LWGS               EEI   +P   K RVILF+GDG+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMIRWGLKPYLFILNNDGYTIEKLI----------------HGPKAQYNEIQNWDHLSLL 499
           TM++W L PY+F++NN GY++++ +                      Y +IQ WD+L+L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVEQ 552
             F A +YET++V +  +  K+   KSF++  +IRM+EI+LP  D P++L+E+
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/558 (46%), Positives = 377/558 (67%), Gaps = 8/558 (1%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           E+T+  YLF RLKQ++V T+FGLPG+FN+ LLD++Y + G++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           R+KG+ CIITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            VFHRM+ ++S  + +I D      E+D+CI   Y+ Q+PVYLG+P N V+L V++  L+
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
             +   +  N+ + E E I+ I+  +   ++P I+ DAC +R D   ET++ I LT FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P +GGV+ G++S P V+E V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXS 362
           +KN V    D ++ + + +P + +K +++ +L+ +      ++                S
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 363 TP--LKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXX 420
               L+QEW+W++  ++ QEGD++I E GTS+FGINQ  FP++T GISQ LWGS      
Sbjct: 372 DDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSMG 431

Query: 421 XXXXXXXXXEE-----IDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYT 475
                     E        ++RVILFIGDG+ Q+T+QEISTMIRW L PY+F+LNN GY+
Sbjct: 432 SCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGYS 491

Query: 476 IEKLIHGPK-AQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIR 534
           I++ +H  K     ++Q W++LS    FGA DYET ++ T G+  ++  ++ F+   +IR
Sbjct: 492 IDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRIR 551

Query: 535 MIEIMLPVFDAPQNLVEQ 552
           M EIMLP  D P+ +V++
Sbjct: 552 MAEIMLPSMDVPKAIVDK 569

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/586 (46%), Positives = 385/586 (65%), Gaps = 24/586 (4%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           +++TL  YLF RL Q  ++TVFGLPG+FN+ L+DK+  +  ++WAGNANELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           ARIKG+ C++TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLL 181
           +TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +   + + LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 DTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
           +  +D +L+ N+  S+ +VI+ I+  +   K PVI+ DAC +RH+++ ET++L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P + GV+ G++S P V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTI-ADAAKGYKXXXXXXXXXXXXXXX 360
           K+K+ +   SD+IK RN TF  + +K +++KLL  +     K ++               
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQLQENNNGNIYIPNIK 370

Query: 361 XSTP--LKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXX 418
            +    L+QEW+WNQL ++ Q+GD++I ETGT+AFGINQT FP+N  GISQ LWGS    
Sbjct: 371 LNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTGYS 430

Query: 419 XXXXXXXXXXXEEID--------------------PKKRVILFIGDGSLQLTVQEISTMI 458
                       EI                     PK RVILFIGDG+ QLTVQE+ST+I
Sbjct: 431 LGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELSTII 490

Query: 459 RWGLKPYLFILNNDGYTIEKLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGE 517
           RWGL PY+FI+NN GY+ ++ +H    A Y +I  WD+L LL  FGAK YE+ ++ T G+
Sbjct: 491 RWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITVGD 550

Query: 518 WDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVEQAKLTAATNAKQ 563
           ++K+  + +F  +S +RMIEI+LP  D PQ L+++ +L      K+
Sbjct: 551 FEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/568 (45%), Positives = 378/568 (66%), Gaps = 15/568 (2%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S +T+ +Y+F RLKQ+ + T+FGLPG+FN+ L+DK+Y++  +RWAG+ANELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           +R+KG+  ++TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLL 181
           + VF R+++ ++  T +I D      E+D+CI   +  Q+PVY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 DTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
           + P+ +S   N  +   +V+  ++  +  + +PVI+ D C  RH    E ++ I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P + GV+ G++S P+V+E V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXX 361
           K+KN    +SD IK  NAT+P V +K +LQ LL  + ++   Y                 
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
              L+QEW+WN++ ++ QEGD++I ETGTSAFGINQT FPN   GISQ LWGS+      
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 XXXXXXXXEEID--------------PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLF 467
                   +E                 K RVILF+GDG+ QLT+QE+ST++RW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 ILNNDGYTIEKLIHG-PKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKS 526
           ILNN GY++++++H    A Y +IQ WD+L+L+ TF A D +T ++ T G+   + +D  
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNDNSKIRMIEIMLPVFDAPQNLVEQAK 554
           F  +++IRMIE+MLP  D P+ LV+  K
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALVDTWK 578

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/561 (46%), Positives = 366/561 (65%), Gaps = 12/561 (2%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYA 62
           ++ LGKYLF RL Q+NV T+FGLP +FN  LLD+IY++  MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           RIK +SC++TTFGVGE+S LNGIAGS++EHV VLHVVG+P  SAQ K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    VD+K LD
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDMSLKPNDAESE--KEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
           +P+ +    N   S+  +E++D ++  +  A++PVI+AD C SRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  RY GVY+G++S P V+E V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNIVEFHSDHIKIRNA-TFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXX 359
           YK KNIV     + K+    T+P V++K VLQ L   +      Y               
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVKP 372

Query: 360 XXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
             +TPL+QEWMW +L ++ + GDV++ E GTS  G+NQ  FP+ T  +SQ LWGS+    
Sbjct: 373 DANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYSV 432

Query: 420 XXXXXXXXXXEEID-----PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGY 474
                     +E          R+ILF+GDG+LQLTVQEIST+I+WGL PY+F++NN GY
Sbjct: 433 GACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQGY 492

Query: 475 TIEKLI----HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDN 530
           TI++L+    H   A Y  IQ W++LS++P FG  +Y+  +V   G+ D+L +D+ F++ 
Sbjct: 493 TIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSNQ 552

Query: 531 SKIRMIEIMLPVFDAPQNLVE 551
             ++M+EI+LP  DAPQ L+E
Sbjct: 553 DILKMVEIILPSMDAPQALLE 573

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  491 bits (1265), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 235/554 (42%), Positives = 339/554 (61%), Gaps = 6/554 (1%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S + L +YLF RL+Q+ V T FGLP D+N+ LLD +  V  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           AR++ +SC+++TFGVGELS +NGIAGS+AEHV VL +VG+P  SAQ ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLL 181
           + VF R++++I   + ++    TA   +D CI   Y  Q+PVY G+P NL +  + +  L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 DTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
           D P+ +  +P       E++  ++  +  AK+PV++ DAC +RH    + ++L   T FP
Sbjct: 192 DVPLPLLDEP--CAPLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  R+ GVYVG+LS P V+E V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXX 361
           K KNI   H+ H ++    FP   ++ +L  L+      A                    
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
           +TPL+ EW+W +L  +   GD++++ETGTSAFG+ QT  P     +SQ LWGS+      
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 422 XXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI- 480
                       P +RV+LF+GDG+LQLTVQE+STM+R  L P +F+LNN GY+ ++L+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 481 ---HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIE 537
              H   A+Y ++Q W +L+L P FGA  Y+   V T GE D L  D +F   S ++M+E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 538 IMLPVFDAPQNLVE 551
           + LP  D P  L++
Sbjct: 550 VALPSMDGPPALLD 563

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  417 bits (1072), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 219/559 (39%), Positives = 325/559 (58%), Gaps = 38/559 (6%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGY 61
           S +T+ +YLF RLKQ+++ T+FGLPG+FN+ L+DK+Y++  +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGD 121
           AR+K + C+ITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+    G+  
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLILFRNGDYK 131

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLL 181
           F +  R             DI   P    R +    +     ++     L         +
Sbjct: 132 FPMKAR-------------DILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKI 178

Query: 182 DTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFP 241
                      + +     + +     K+          C S + V+ +        +FP
Sbjct: 179 PKGKGADXXXKNLQCRTSYLSSRSLRFKEQ------CRRCNSDYSVRKQ--------KFP 224

Query: 242 AFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSY 301
            FV P  +    E + ++GGV+ G++S P V+E V+ ADL++ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 302 KTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXX 361
           + K++V   S ++KIRN  +P + +K +L  LL+ +  +   Y                 
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSKLPS-- 341

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
            + L+QEW+WN++ ++ QE DV+I ETGTSAFGINQT FP  ++GISQ LWGS+      
Sbjct: 342 KSVLRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYSLGA 401

Query: 422 XXXXXXXXEEIDPK-------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGY 474
                   +E+           RVILF+GDG+ QLT+QE+STMI+W LKPY+F++NN GY
Sbjct: 402 CLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNNQGY 461

Query: 475 TIEKLI-HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKI 533
           +I++ + H   A+Y +IQ W++L+LL  FGA DYE  ++ T  ++  + +D +F  N KI
Sbjct: 462 SIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARNDKI 521

Query: 534 RMIEIMLPVFDAPQNLVEQ 552
           RMIEIMLP  D PQ+L+EQ
Sbjct: 522 RMIEIMLPPMDVPQSLMEQ 540

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  325 bits (832), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/601 (34%), Positives = 307/601 (51%), Gaps = 54/601 (8%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE---VEGMRWAGNANELNAAYAAD 59
           E+T G+Y+F RL      +VFG+PGDFNL+LL+ +Y+    + +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQL---LLHH 115
           GY+R    + C+ITT+GVGELSALNG+AGS+AE V VLH+VGV S     K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLNVDAK-LLDTP---IDMSLKP--NDAESEKE-VIDTIMALVKDAKNPVILAD 219
           +PA+  D+ V  + L+  P   ++ ++ P     ES+ E ++  +  L+ ++ NP IL D
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGD 269

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESA 279
               R+ V  +   LI   Q   F T MGK  IDE +P Y G+Y G     +V E     
Sbjct: 270 VLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKC 329

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK---NIVEFHSDHIKIRNAT------FPGVQMKFVL 330
           DLIL  G   ++ N G ++  Y      N+VEFHSD+I+  N+         GV    VL
Sbjct: 330 DLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVL 389

Query: 331 QKLLTTI-ADAAK-GYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAET 388
            +L   I AD     Y+                S  + QE++ + +  +L  GDV++ ET
Sbjct: 390 NRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCET 449

Query: 389 GTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX-----------XXXXXXXEEIDPKKR 437
           G+  FG+    FP+N   +SQ  + SI                         EEI+ + +
Sbjct: 450 GSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEPK 509

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLS 497
           +ILF GDGS Q+T+QE+STM+   +K  +F+ NNDGYTIE+ I GP   YN+I  W+   
Sbjct: 510 LILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWTK 569

Query: 498 LLPTF----GAKDYETHRVATTGE--WDKLTQDKSFNDN---SKIRMIEIMLPVFDAPQN 548
           +   F    G+K    ++V +T E    +L + K    N    +I ++E+ + V D P+ 
Sbjct: 570 MFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPEQ 629

Query: 549 L 549
           L
Sbjct: 630 L 630

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/553 (32%), Positives = 300/553 (54%), Gaps = 34/553 (6%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           + L +YLF RL Q+N  TVFG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFT 123
             G+SC +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
           +FH              D+   P+EID C+RT +  +RPVY+GL +      V +  L+ 
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PI--DMSLKPNDAESE--KEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQ 239
            I   M +K    +++  K VID I+A V  +  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P + G ++GT+S+P V+E + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXX 359
           +YK+KN +   +D +KI N   P + +  +L +L+ ++                      
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMIPRVEP 362

Query: 360 XXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
              T L+QE++W ++  +L++GDV+I+E+GTSA G+ Q  FP+NT  +SQ +W S     
Sbjct: 363 QPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGYSI 422

Query: 420 XXXXXXXXXXEEIDP--KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
                      ++    K R+IL +GDGSLQ T QE+ST++  G KPY+F++NN GYT++
Sbjct: 423 GACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYTVD 482

Query: 478 KLIHGPK----AQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKI 533
           + ++  K    A Y +IQ W+ L L   F +++Y   R  + GE + L  DK FN + ++
Sbjct: 483 RTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSDQL 542

Query: 534 RMIEIMLPVFDAP 546
           +++E++LP  D P
Sbjct: 543 KIVELILPSMDVP 555

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/600 (32%), Positives = 309/600 (51%), Gaps = 50/600 (8%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           +  G+Y+FERL      +VFG+PGDFNLSLL+ +Y    + + ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
                + N +F       +H M    IS +T  + ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLNVDAKLLDTPIDMSLKPNDAES-EKEVIDT----IMALVKDAKNPVILADA 220
            +PA+  D  V+A+ L T   ++L+   ++   +EV+D+    I+ L+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESAD 280
            C R     E +  + +T+  AF + MG+  +DE  P + GVY G  S P + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDHIKI------RNATFPGVQMKFVLQKL 333
           LIL  G L ++ N G +S+S+      VE HSD++              GV    VL ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LTTIADAAKGYKXXXXXXXXXXXXXXXXSTP---LKQEWMWNQLGNFLQEGDVVIAETGT 390
           +  I       K                 +P   + Q+++ N +  +L  GDV + ETG+
Sbjct: 392 IQLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETGS 451

Query: 391 SAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE-------------IDPKKR 437
             F +    FP N   ISQ  + SI              ++             +D   +
Sbjct: 452 FQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTPK 511

Query: 438 VILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLS 497
           +IL  GDG+ Q+T+QE+++ +R+ +   +F+ NN GYT+E+ I GP   YN+I  W    
Sbjct: 512 LILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWTK 571

Query: 498 LLPTFGAKD---YETHRVATTGEW-DKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVEQA 553
           LL  FG  D    E  +V   GE+ D +   K   + SK+R+IE+ML + D P+ L+  A
Sbjct: 572 LLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAMA 631

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  312 bits (800), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 197/596 (33%), Positives = 304/596 (51%), Gaps = 49/596 (8%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY------EVEGMRWAGNANELNAAYA 57
           L  G Y+F+RL      ++FG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHT 116
           ADGY+R    + CI+TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGL 167
           L N         ++ VF  M   ++S +T  I ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLNVDAK-LLDTPI-----DMSLKPNDAESEKEVIDTIMALVKDAKNPVILADAC 221
           P N   L V+ K L +TP       +++ P+  E    + D I + +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADL 281
             R+   +   + I  T    F T MGK  +DE    Y GVY G      V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDHIKI------RNATFPGVQMKFVLQK 332
           IL  G   ++ N+G+++   Y  K   I+EFH  +I++          F GV+  ++L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLTTI--ADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGT 390
           +L  +  ++    Y                 +  + Q+ +   + ++++ GDVV+ +TGT
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAVA-NNQITQDHISTTMESYIKPGDVVLCDTGT 442

Query: 391 SAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------DPKKRV 438
             F +    F +    +SQ  + SI               +             + K R+
Sbjct: 443 FQFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRL 502

Query: 439 ILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLSL 498
           ILF GDG+ Q+TVQE+STM+R+ +   +F+ NNDGYTIE+ I GP   YN+IQ W+   L
Sbjct: 503 ILFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYL 562

Query: 499 LPTFG-AKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNLVE 551
              FG AK+   + H+V TT E D +  +    D + I  +E+ L + D P+ L +
Sbjct: 563 FKAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMPKILTD 618

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 207/603 (34%), Positives = 308/603 (51%), Gaps = 57/603 (9%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAY 56
           ++ ++ G+Y+F RL      +VFG+PGDFNLSLL+ +Y    E  G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL-- 112
           AADGY+R    + C++TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI +++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLNVDAK-LLDTP----IDMSLKPNDAESEKEVIDTIMALVKDAKNPVIL 217
            Y+ +PA+  D++V  + L++ P     D    P+  +   +++D I + +  +K P IL
Sbjct: 202 GYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQL-FDILDRITSWMYSSKTPAIL 260

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVE 277
            D    R+ V     KLI  T    F T MGK  IDE +P+Y G Y G      V E  E
Sbjct: 261 GDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKI------RNATFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    I++FH ++I+           F G+    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAPVL 380

Query: 331 QKLLTTIADAAK-------GYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDV 383
            +L   I D ++       G                  S  + Q  +   +  FL  GDV
Sbjct: 381 MELYKGI-DVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQVHLQKVMPKFLSPGDV 439

Query: 384 VIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP--------- 434
           V+ ETG+  F +    FP     ISQ  + SI              ++            
Sbjct: 440 VVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDENIG 499

Query: 435 ---KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQ 491
              K R+ILF GDG+ Q+T+QE+ST+++  +   +FI NN+GYTIE+ I GP   YN++ 
Sbjct: 500 EGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYNDVM 559

Query: 492 NWDHLSLLPTFGAKDYETHRVATTGEWD-----KLTQDKSFNDNSKIRMIEIMLPVFDAP 546
           +W    LL  FG  D   H  +T  E+      KL + KS N    I ++E+ L V D P
Sbjct: 560 SWKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDFP 618

Query: 547 QNL 549
           + L
Sbjct: 619 EQL 621

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 201/597 (33%), Positives = 305/597 (51%), Gaps = 46/597 (7%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYA 57
           +E+ LG+Y+F RL      TVFG+PGDFN+ LL+ +Y      EG++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-IKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   +AQ    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLNVDAK-LLDTPIDMSL-----KPNDAESEKEVIDTIMALVKDAKNPVILA 218
           L +PA++ ++ V ++ L+  P  M       + N A  ++  I+ +  L + +  P IL 
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSS-TPAILC 266

Query: 219 DACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVES 278
           D  C R  +  + ++L++LT    F T MGK  +DE  P Y GVY G  SK      ++ 
Sbjct: 267 DGLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGAGSKER-NALLQE 325

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTKN-IVEFHSDHIKI-RNA---TFPGVQMKFVLQKL 333
            DLIL +G +  + NT  +++ +  ++ I+E H +++ + RN          +  VL+ +
Sbjct: 326 CDLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSI 385

Query: 334 LTTIADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAF 393
           L  +  A   +                   P+ Q  + + +   L  GDV++ +TGT  F
Sbjct: 386 LAHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTFQF 445

Query: 394 GINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE-----IDPK-------KRVILF 441
            +    FP +   ISQ  + SI               E     + PK        R++L 
Sbjct: 446 SVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVLC 505

Query: 442 IGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLSLLPT 501
            GDG+ Q+T+QE+ST IR+ L   + + NNDGYT+E++I GP   YN+I +WD   LL  
Sbjct: 506 EGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLRV 565

Query: 502 FGAKDYETHRVATTGEWDKLTQD----KSFNDNSKIRMIEIMLPVFDAPQNLVEQAK 554
           FG  D          +++ L +     KS    SKIR++E++L   D    L E AK
Sbjct: 566 FGDFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELAK 622

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  310 bits (793), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 216/608 (35%), Positives = 309/608 (50%), Gaps = 58/608 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           +  G+Y+F RL  +   +VFG+PGDFNLSLL+ +Y    E +G++W G  NELNAAYAAD
Sbjct: 25  MPFGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQLLLH 114
           GY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+  LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLH 144

Query: 115 H---TLGNGDFT-----VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYV 204

Query: 166 GLPANLVDLNVDA-KLLDTPIDMSLKPNDAESEKE---VIDTIMALVKDAKNPVILADAC 221
            +PA+  D++V    L++ P         + SE +   +ID I   +  ++ P IL D  
Sbjct: 205 FVPADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVL 264

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADL 281
             R+ V     KLI  ++   F T MGK  IDE +P Y G+Y G      V E  ES DL
Sbjct: 265 TDRYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDL 324

Query: 282 ILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKI------RNATFPGVQMKFVLQKLL 334
           IL  G  +++ N G +S++YK    I++FH ++I+           F GV    VLQ+L 
Sbjct: 325 ILHFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELY 384

Query: 335 TTIADAAK---GYKXXXXXXXXXXXX----XXXXSTPLKQEWMWNQLGNFLQEGDVVIAE 387
             I D +K    Y                     ST + Q  +   +  FL  GDVV+ E
Sbjct: 385 QCI-DVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVVCE 443

Query: 388 TGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP------------- 434
           TG+  F +    FP     ISQ  + SI              ++  P             
Sbjct: 444 TGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINEGY 502

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWD 494
           K R+ILF GDG+ Q+T+QE+ST++++ +   + I NN+GYTIE+ I GP   YN+I +W 
Sbjct: 503 KPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSWK 562

Query: 495 HLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNS--KIRMIEIMLPVFDAPQNL- 549
              L   FG  D  Y  + +  T     L      N ++  +I ++E+ L V D P+ L 
Sbjct: 563 WTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQLR 622

Query: 550 --VEQAKL 555
             VE A L
Sbjct: 623 CMVEAAAL 630

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  306 bits (783), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 198/603 (32%), Positives = 311/603 (51%), Gaps = 55/603 (9%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAA 58
            + LG+Y+FER+      T+FG+PGDFNLSLL+ IY  E    G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SAQAKQLL 112
           DGY+R    + C+ITT GVGELSALNGIAG++AE V +LH+VGV PS     SAQ+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
            H      D  +    HR+        +S ++  + DI++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLNVDAKLLDTPIDMSLKP-------NDAESEKEVIDTIMALVKDAKNPVIL 217
           + +PA+  D  VDA+ L+    + L+        ND + + E+ + I+  +  +  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVE 277
           AD  C R+D+ +  ++L++ T    F + MGK  +DE +  + GVY G+ S+  V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKT-KNIVEFHSDHIKIRNA-----TFPGVQMKFVLQ 331
           + D +L VG + ++ NTG +SY +    NIVE H  ++   +A      +   Q  F + 
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 332 KLLTTIADAAK---GYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAET 388
            ++T + D  K   GY+                S  +   ++      FL  GDV + +T
Sbjct: 380 DMMTQMIDPTKLHLGYQESIPSRTQEYCGPPHSS--VTHSYLQTHFPKFLSSGDVFVVDT 437

Query: 389 GTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPK 435
           G+  FG+    FP++   ISQ  + SI              ++              + +
Sbjct: 438 GSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQ 497

Query: 436 KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDH 495
            R+IL  GDG+ Q+T+QE+++ +R+ +   LFI NN GYT+E+ I GP   YN+I  W+ 
Sbjct: 498 PRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEW 557

Query: 496 LSLLPTFGAKDYETHRVATTGEWDKLTQ-DKSFNDNSK----IRMIEIMLPVFDAPQNLV 550
             LL  FG    E          D++++  K+F  + K    +R++E+ML V D P+ L 
Sbjct: 558 TELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQLK 617

Query: 551 EQA 553
             A
Sbjct: 618 AMA 620

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  305 bits (780), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 211/611 (34%), Positives = 310/611 (50%), Gaps = 58/611 (9%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAY 56
           ++ +  G+Y+F RL  +   +VFG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQL 111
           AADGY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S   K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLNVDA-KLLDTP----IDMSLKPNDAESEKEVIDTIMALVKDAKNPVIL 217
            Y+ +PA+  D++V A  L+  P     D    P + +   ++ID I + +  +K P IL
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQL-LDIIDKITSWMYSSKTPAIL 260

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVE 277
            D    R+ V     +LI  T+   F T MGK  IDE +P Y G Y G      V +  E
Sbjct: 261 GDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFE 320

Query: 278 SADLILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKIRNA------TFPGVQMKFVL 330
           S DL+L  G  +++ N G ++++YK    I++FH ++I+  +        F GV    VL
Sbjct: 321 SCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVL 380

Query: 331 QKL--LTTIADAAKGYKXXXXXXXXXXXX----XXXXSTPLKQEWMWNQLGNFLQEGDVV 384
           ++L  L  +A  +  Y                     S+ + Q  +   +  FL  GDVV
Sbjct: 381 KELYKLIDVARLSLQYDSNVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPGDVV 440

Query: 385 IAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------ 432
           + ETG+  F +    FP     ISQ  + SI              ++             
Sbjct: 441 VCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVKE 500

Query: 433 DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQN 492
           D K R+ILF GDG+ Q+T+QE+ST+++  +   + I NN+GYTIE+ I GP   YN+I +
Sbjct: 501 DYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIMS 560

Query: 493 WDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFND-----NSKIRMIEIMLPVFDAPQ 547
           W    L   FG  D   H  +T  E+      K          ++I ++E+ L V D P+
Sbjct: 561 WKWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDFPE 619

Query: 548 NL---VEQAKL 555
            L   VE A L
Sbjct: 620 QLKCMVEAAAL 630

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  304 bits (778), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 208/610 (34%), Positives = 312/610 (51%), Gaps = 62/610 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY----EVEGMRWAGNANELNAAYAAD 59
           +  G+Y+F+RL  ++  +VFG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI +++       LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLNVDA-KLLDTPI----DMSLKPNDAESEKEVIDTIMALVKDAKNPVILADA 220
            +PA+  D++V    L++ P     D  + P++ +   ++I+ I + +  +K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQLS-DIINKITSWIYSSKTPAILGDV 263

Query: 221 CCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESAD 280
              R+ V     KLI  T    F T MGK  IDE +P Y G Y G      V E  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKI------RNATFPGVQMKFVLQKL 333
           L+L  G  +++ N G ++++YK    I++FH ++I++          F G+    +L++L
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKEL 383

Query: 334 LTTIADAAKGYKXXXXXXXXXXXXXXXXSTP-------LKQEWMWNQLGNFLQEGDVVIA 386
              I D +K                     P       + Q  +   +  FL  GDVV+ 
Sbjct: 384 YKRI-DVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVVVC 442

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------------DP 434
           ETG+  F +    FP+    ISQ  + SI              ++             D 
Sbjct: 443 ETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKEDY 502

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWD 494
           K R+ILF GDG+ Q+T+QE+ST+++  +   + I NN+GYTIE+ I GP   YN++ +W 
Sbjct: 503 KPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSWK 562

Query: 495 HLSLLPTFGAKDYETHRVATT------GEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQN 548
              L   FG  D++     +T          KL + K+ N  S I ++E+ L   D P+ 
Sbjct: 563 WTKLFEAFG--DFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQ 620

Query: 549 L---VEQAKL 555
           L   VE A L
Sbjct: 621 LKCMVEAAAL 630

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  302 bits (773), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 198/611 (32%), Positives = 312/611 (51%), Gaps = 52/611 (8%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYAAD 59
           +  G+YL +R+      ++FG+PGDFNLSLL+ +Y      +G+RW G  NELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQAKQLL---LH 114
           GY+R    MSC+ITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ +++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPANLVDLNVD-AKLLDTPI---DMSLKPNDAESEKEVIDTIMALVKDAKNPVILADAC 221
            +PA+  D+ V+ + L+  P+   + ++    +   +EV   ++  + D+K P I+ D  
Sbjct: 208 FVPADFSDMLVNPSNLVSNPVITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDVL 267

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADL 281
             R     E  KLI +T    F T MGK  IDE +P+Y G+Y G     +V E     DL
Sbjct: 268 TDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCDL 327

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHIKI------RNATFPGVQMKFVLQKLL 334
           +L  G  +++ N G ++Y Y +   IVE H ++++           F GV    +L++LL
Sbjct: 328 VLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRLL 387

Query: 335 TTIADAAKGYKXXXXXXXXXXXXX---XXXSTPLK--QEWMWNQLGNFLQEGDVVIAETG 389
             +      +                    S+ LK  Q  + N++ ++  +GDVV+ ETG
Sbjct: 388 EKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCETG 447

Query: 390 TSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKK------------- 436
           +  F +    FP+    ISQ  + SI              ++  PK              
Sbjct: 448 SFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSYQP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHL 496
           R+ILF GDG+ Q+TVQE++TM+R  +   + +LNN+GYTIE+ I GP   YN+I  W   
Sbjct: 507 RLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKWT 566

Query: 497 SLLPTFGAKDYE---THRVATTGEWDKLTQDKSFND-NSKIRMIEIMLPVFDAPQNLVEQ 552
            L   FG  D +      V T  E D++ +D  +   ++ I ++E+ L V D P+ L   
Sbjct: 567 KLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQSM 626

Query: 553 AKLTAATNAKQ 563
               A   +K+
Sbjct: 627 VDAAAFKRSKK 637

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  296 bits (757), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 198/609 (32%), Positives = 316/609 (51%), Gaps = 58/609 (9%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAYAA 58
           ++  G+Y+F+R+      +VFG+PGDFNL LL+ +Y+     +G+RW G  NELNAAYAA
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  DGYARI-KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISAQA---KQLLL 113
           DGY+R  +G+ C+ITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI +Q    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPANLVDLNVDAK-LLDTPI----DMSLKPNDAESEKEVIDTIMALVKDAKNPVILAD 219
           + +P + V++ VD K LL  P     D  L+ +      ++ + I+  +  +K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESA 279
               R+       + I LT+   F T  GK  I+EQ+P Y G+Y G      V +     
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNA------TFPGVQMKFVLQK 332
           DLI++VG  +++ N G +++SY+    ++E H  +I++ +        F G+    VL++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLTTIA------DAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIA 386
           +L  I       D                      S  + Q ++   + ++L +GDV++ 
Sbjct: 384 MLIKIDIKRFDFDYDPSVTKFDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDGDVLVV 443

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK----------- 435
           ETG   F       P+    I+Q  + SI              ++  P+           
Sbjct: 444 ETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKIPETY 502

Query: 436 -KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWD 494
             R+IL  GDG+ Q+TVQE+S+ IR+ +   + +LNNDGYTIE+ I GP   YN+I  W+
Sbjct: 503 NPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAWN 562

Query: 495 HLSLLPTFGAKDYETHRVATTGE-----WDKLTQDKSFNDNSKIRMIEIMLPVFDAPQNL 549
              +    G  D +   V TT +      +K  Q K+  + +KI  IE++L V D P+ L
Sbjct: 563 WTKIFEALGDFDNKA-TVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDYPEQL 621

Query: 550 ---VEQAKL 555
              VE AK+
Sbjct: 622 KSMVEAAKV 630

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  294 bits (753), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 209/628 (33%), Positives = 321/628 (51%), Gaps = 77/628 (12%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY-------EVEGMRWAGNANELNA 54
           + +TL +Y+F RL+     ++FG+PGDFNL LL+ +Y       EVE + W G  NELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISA-QAKQLL 112
           AYAADGY+R    + C++TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 113 LHHTLGN--------GDFTVFHRMSAN-ISETTAMI--TDIATAPA-----EIDRCIRTT 156
           +HH++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 157 YVTQRPVYLGLPANLVDLNVD-AKLLDTP---IDMSLKP---NDAES-EKEVIDTIMALV 208
           +++ +P YL +P+N+ ++ V  A L   P   +D +LK    N +E+ E ++I+ I  L+
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 209 KDAKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLS 268
             +K P IL D    R D + +  +LI       F T +GK  IDE + R+ G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 269 KPAVKEAVESADLILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHIKIR------NATF 321
              VK+  ES DLIL +G   ++ NTG +S+SY     I+E   D+IKI       +   
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 322 PGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXSTP-------------LKQE 368
             + ++ V+QKLL  I D+   Y                 S               + Q+
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 369 WMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXX------ 422
            +  ++     +GDVV+ ETG+  F I    FP  T  I+Q  + SI             
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 423 ------XXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTI 476
                        E+  PKK +ILF GDG+ Q+T+QE+S+++R+ +   +FI NN+GYT+
Sbjct: 495 MRDYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTV 553

Query: 477 EKLIHGPKAQYNEIQNWDHLSLLPTFGAKDYE-----THRVATTGEWD-KLTQDKSFNDN 530
           E++  G K  YN+I  W  ++LL  FG  D+E     +  ++T  E   K+ + K+ N  
Sbjct: 554 ERIFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQ 611

Query: 531 SKIRMIEIMLPVFDAPQNL---VEQAKL 555
             I +IE+ L   D P+NL   VEQ KL
Sbjct: 612 KIIELIEVKLGEMDIPKNLKHIVEQMKL 639

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  294 bits (752), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 201/607 (33%), Positives = 305/607 (50%), Gaps = 63/607 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIY---------EVEGMRWAGNANELNA 54
           +T G Y+F+RL  +   +VFG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SAQAK 109
           AY+ADGY+R    +SC+ITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLNVDAK-LLDTP---IDMSLKPNDAESE------KEVIDTIMALVKD 210
           RP YL +P+N  D+ V  K L+D P   +D +L  N  +S       K++   I+ ++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKP 270
           ++ P ++ D    R+  K    + I+ T+   FVTP+ K +IDE +  Y G+Y G  S  
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 AVKEAVESADLILSVGALLSDFNTGSFSYSYKTK-----------NIVEFHSDHIKIRNA 319
            V E  E++DL+L  G   ++ NTG +S+SY               +VE+ + H      
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHS--EL 380

Query: 320 TFPGVQMKFVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQ 379
            +  V    +L++LL  I  +   +K                   + Q  +     +   
Sbjct: 381 IYRDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQASLGQAFPSTFN 440

Query: 380 EGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEID------ 433
            GD+++A+TG   F I    F +    I+Q  + SI              ++        
Sbjct: 441 PGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAMQDYPLEHVYD 500

Query: 434 ----PKK---RVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQ 486
               PK    R+IL  GDG+ Q+TVQE+STMIR  +   +++ NNDGYTIE+ I GP   
Sbjct: 501 KSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTIERAIMGPTRS 560

Query: 487 YNEIQNWDHLSLLPTFGAKDYE-THRVATTGEWD---KLTQDKSFNDNSKIRMIEIMLPV 542
           YN+I  W+  +LL +FG  + + T+ V    + D   KL   K  ++N  I  +E+ML  
Sbjct: 561 YNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKCIEFMEVMLGK 620

Query: 543 FDAPQNL 549
            D P  L
Sbjct: 621 VDYPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  293 bits (749), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 196/605 (32%), Positives = 311/605 (51%), Gaps = 64/605 (10%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEG---MRWAGNANELNAAYAAD 59
           ++ LG+YL  RL  +   + FG+PGDFNL LL+ +Y  +G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISAQAKQLL---LH 114
           GY+R    + C+ITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  ++ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLNVDAK-LLDTP-IDMSLKPNDAESEK--EVIDTIMALVKDAKNPVILADAC 221
            +P++  +  V +K L++ P I++S   N    EK   + + I+ L+ ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 CSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADL 281
             R          I +T+F  F T MGK  IDE    Y G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNIVEFHSDHIKIRNAT---------FPGVQMKFVLQ 331
            L  G  +++ N+G++S+ + K   I+E + +++KI             +P V M  +L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLL--TTIADAAKGYKXXXXXXXXXXXXXXXXSTPLKQE--------WMWNQLGNFLQEG 381
            L+    I DA   Y                   PL+QE         +  +L NFL  G
Sbjct: 376 GLIAKVNIHDANTNYDKSVKSYDTSELVL-----PLQQEDEEKITQVHLQRELPNFLNPG 430

Query: 382 DVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPK------ 435
           DV++ ETG+  F +    FP+N   ISQ  + SI              ++  PK      
Sbjct: 431 DVLVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDH 489

Query: 436 -------KRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYN 488
                   R+IL  GDG+ Q+TVQE++TM+R  +   +F+ NN+GYT+E+ I GP   YN
Sbjct: 490 SLARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYN 549

Query: 489 EIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQD----KSFNDNSKIRMIEIMLPVFD 544
           +I  W+   LL   G  + E +R  T  +  +L++     K   DN+ I++IE+ L   D
Sbjct: 550 DIMPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHD 609

Query: 545 APQNL 549
            P+ L
Sbjct: 610 IPRQL 614

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  285 bits (729), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 190/606 (31%), Positives = 295/606 (48%), Gaps = 53/606 (8%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV----EGMRWAGNANELNAAYAA 58
           ++ LGKYLF+R+      ++FG+PGDFNL LL+ +YE     +G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTL 117
           DG++R    + C+ITT+GVGELSALNG+AG++AE+V +LH+VGV   SA+ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
            N   + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLVDLNVD-AKLLDTPI---DMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSR 224
            + V+  V+   LL TP+   + SL   D  +  EV   I   +  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILS 284
           +D        I LT+   F T  GK  IDE +P Y G+Y G      V +     DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNIVEFHSDHIKIRNAT------FPGVQMKFVLQKLLTTI 337
            G  +++ N G +++ YK    IVE H  +++  +        F G+   FVL++L+  I
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 ADAAKGYKXXXXXXXXXXXXXX--------XXSTPLKQEWMWNQLGNFLQEGDVVIAETG 389
                 +                         ++ + Q  +   + ++L  GD+V+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI-------------DPKK 436
           +  F +     P     +SQ  + SI              ++              + K 
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHL 496
           R+IL  GDG+ Q+TVQE+++MIR+ +   + + NN+GYT+E+ I GP   YN+I  WD  
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 SLLPTFG---AKDYETHRVATTGEWDKLTQDKSFNDNSK-IRMIEIMLPVFDAPQNL--- 549
            L   FG    K   +  + TT +            N   I M+E+ L V D P  L   
Sbjct: 567 KLFAAFGDFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDIIEMVEVKLGVMDYPHQLKHM 626

Query: 550 VEQAKL 555
           VE AK+
Sbjct: 627 VEAAKV 632

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  283 bits (723), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 186/605 (30%), Positives = 299/605 (49%), Gaps = 50/605 (8%)

Query: 3   ELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAA 58
            +  G+YLF++L Q    ++FG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTL 117
           DGY+R    ++ +ITT+GVGELSA+NG+AGS AE+V VLH+VGV  + + A +   HH +
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 118 ---------GNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
                    G      +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLNVDAKLLDTPIDM--SLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHD 226
           A+  D  VD   L+  I++  S++   +E    ++D ++  +  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVG 286
           + ++  + I+ TQ   F T MGK  IDE +PRY G+Y G      V+    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNA------TFPGVQMKFVLQKLLTTIAD 339
              ++ N  +  + Y  +  ++EFH  +I++ +        F  V    VL  L   I  
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRIDI 372

Query: 340 AAKGYKXXXXXXXXXXXXX----XXXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGI 395
           +    +                    ++ + Q ++  +    L  GD+++++TG+  FG+
Sbjct: 373 SKLNLQYDKAIFTTYEPSQLNLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFGV 432

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDP-------------KKRVILFI 442
                P  +  ++Q  W SI              ++                K +++L +
Sbjct: 433 RDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLGV 492

Query: 443 GDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLSLLPTF 502
           GDG+ Q+TVQE++TM+R+ +   +F+ NN+GYTIE+ I G  + YN+I  W    L   F
Sbjct: 493 GDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEAF 552

Query: 503 G---AKDYETHRVATTGEWDKLTQDKSFNDNSK-IRMIEIMLPVFDAPQNLVEQAKLTAA 558
           G    K   +  V T  E D+  +D   N   K I ++E+ L V D P  L  Q  L+  
Sbjct: 553 GDFDGKYSNSSLVKTRQELDQKIED--INKGGKGIELVEVKLGVMDYPAQL--QMMLSNM 608

Query: 559 TNAKQ 563
            NAK+
Sbjct: 609 KNAKK 613

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  280 bits (717), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 196/616 (31%), Positives = 311/616 (50%), Gaps = 59/616 (9%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEG------MRWAGNANELNAA 55
           + +  GKY+F RL+     +VFG+PGD+NL+LL+++Y+ E       ++W G  NELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLH 114
           YAADGY+R    + C+ITT+GVGELSA+NGIAG++ E+V +LH+VGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYL 165
           H + N +        + +   M  N IS +T  + +IATA  + D  +R  +   +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANLVDLNV-DAKLLDTP---IDMSLKPNDAESEKEVIDTIMALVKD----AKNPVIL 217
            +P    +L V DA L   P   ++ S+ P+    +   ID +  + KD    +K P I+
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDS--IDRLTQITKDLIYQSKRPAII 273

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVE 277
            D    R        +LI  T    F T MGK  I+E +  Y G++ G   K  V + + 
Sbjct: 274 GDILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIR 333

Query: 278 SADLILSVGALLSDFNTGSFS---YSYKTKNIVEFHSDHIKIRNATFPGV----QMKFV- 329
             DLIL  G   ++ N+G ++   Y  K   I+EFHS++IKI++ +   V     + F+ 
Sbjct: 334 QCDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIH 393

Query: 330 LQKLLTTIADAAK---GYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIA 386
           + K L  I D +K    Y                 +  + Q+++ + +   L  GD+++ 
Sbjct: 394 VLKRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLC 453

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE------------IDP 434
           +TGT  F +     P     ISQ  + SI              ++            I  
Sbjct: 454 DTGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKT 513

Query: 435 KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWD 494
           + ++IL  GDG+ Q+T+QEIST+IR+ +   +F+ NNDGYTIE+ I GP   YN+IQ W+
Sbjct: 514 QPKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWN 573

Query: 495 HLSLLPTF--GAKDY-ETHRVATTGEWDKL---TQDKSFNDNSKIRMIEIMLPVFDAP-- 546
              L+ +F    K + +T++V    E+  L    +  +FN++S +  IE+ L   D P  
Sbjct: 574 WTMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVPHI 632

Query: 547 -QNLVEQAKLTAATNA 561
            Q+ +++ K  A   A
Sbjct: 633 LQDFMDRMKKRATAKA 648

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  278 bits (710), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 189/607 (31%), Positives = 302/607 (49%), Gaps = 60/607 (9%)

Query: 2   SELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV-------EGMRWAGNANELNA 54
           +++  G Y+F+RL  V V ++FG+PGD+N+ LL+ +Y+        + + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISAQA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVT 159
           +   LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVDLNVDAK-LLDTP---IDMSLKPNDAESEKEVIDTIMALVKDAKNPV 215
            +P YL +P + VD  V  K L++ P   +   ++ +  +  K V + I+ L+  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 216 ILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEA 275
           ++ D    R+ ++ E    I+      F T  GK  IDE  P Y G Y G  S P V E 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNAT------FPGVQMKF 328
           + + DL+L  G   ++ N G++++ +K+   IVE H  +I+  + T      + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 329 VLQKLLTT--IADAAKGYKXXXXXXXXXXXXXXXX------STPLKQEWMWNQLGNFLQE 380
           +L  L  +  +++ +  Y                       ++ + Q  +   + N+L  
Sbjct: 420 ILDLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDITQGTLQKSMPNYLNP 479

Query: 381 GDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI------DP 434
           GDV+I++TGT  F I   + P+    I+Q  + SI               +       D 
Sbjct: 480 GDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHVWDV 539

Query: 435 KK-------RVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQY 487
           +K       +VILF GDG+ Q+TVQE+STMIR  +   +F+ NN+GYTIE++I GP   Y
Sbjct: 540 EKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPTRPY 599

Query: 488 NEIQNWDHLSLLPTFGAKDYETHRVATTGEW-----DKLTQDKSFNDNSKIRMIEIMLPV 542
           N+IQ W    LL  FG  D   H  AT  E      +KL++ K  +    I  +E+ L  
Sbjct: 600 NDIQPWKWTKLLEAFGDFD-GKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKLAT 658

Query: 543 FDAPQNL 549
            D P  L
Sbjct: 659 MDVPSQL 665

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  275 bits (704), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 180/606 (29%), Positives = 303/606 (50%), Gaps = 58/606 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE----GMRWAGNANELNAAYAAD 59
           L LG+YL+ +L Q+   T+FG+PGDFNLSLL+ +Y  +    G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPA 169
              ++        V+  M +  +    A ITD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 N----LVDLNVDAKL-------LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILA 218
           +    L+ ++V+  L       ++  +++ L P  +     V D I++L+  +K P I+ 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLP--SLEMVSVCDYILSLLYSSKTPCIIG 263

Query: 219 DACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVES 278
           D    R  V  +   LI  T+   F T M KG ++E +P Y GVY G LS+  + + ++ 
Sbjct: 264 DILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQM 323

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTKNI-VEFHSDHIKIRN------ATFPGVQMK---- 327
            DLI+  G + ++ NTG +S++YK  ++ ++ H D+++I          + G++ +    
Sbjct: 324 CDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFRTFVD 383

Query: 328 FVLQKLLTTIADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAE 387
            V + +     +                        P+  +++   +  ++  GDVV+ E
Sbjct: 384 MVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINPGDVVVCE 443

Query: 388 TGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEE--------------ID 433
           TG+  F +  T   ++   I+Q  + SI               +              + 
Sbjct: 444 TGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKKSSHSNVP 503

Query: 434 P--KKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQ 491
           P  K R+IL  GDG+ Q+TVQEI+ +I++ +   + +LNN GYTIE+ I G   ++N+I 
Sbjct: 504 PNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGADKEFNDIC 563

Query: 492 NWDHLSLLPTFGAKDYETHR----VATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAPQ 547
            W+   LL   G    ET       +TT  ++KL Q K +        +E++L   + P 
Sbjct: 564 EWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVILNKLNIPT 623

Query: 548 NLVEQA 553
            L++ A
Sbjct: 624 TLIKMA 629

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  273 bits (698), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 182/595 (30%), Positives = 298/595 (50%), Gaps = 48/595 (8%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYE----VEGMRWAGNANELNAAY 56
           +  +  G Y+FERL      ++FG+PGDFNL LL+ +Y+      G++W G  NELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISAQAKQLL-- 112
           AADGY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVY 164
            +HH +   D          F  +   +  ++A + DI TA   +D+ I       +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANLVDLNVDAK-LLDTPI-DMSL---KPNDAESEKEVIDTIMALVKDAKNPVILAD 219
           + +P +  D  V  K L+  PI DM        D  + K   D ++  + ++  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESA 279
               R +++ E ++ I+      + T MGK ++DE++P+Y G+Y G  +   ++  V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNIVEFHSDHIKIRNATFPGVQMKFVLQ 331
           DLIL  G   ++ N G +S+ +         + NI++F    IK +NA+         + 
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNASTVEEANFVSVL 386

Query: 332 KLLTTIADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGTS 391
           K +    D +K                   +  + Q+ +   + N+  +GDV+I ETG+ 
Sbjct: 387 KYVNDNLDKSKLSFSYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVETGSF 446

Query: 392 AFGINQTTFPNNTYGISQVLWGSIXXXXXXXX----------XXXXXXEEIDPKK---RV 438
            FG+    F      I+Q  + SI                        + + PK    R+
Sbjct: 447 QFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYIPRL 506

Query: 439 ILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEIQNWDHLSL 498
           IL  GDG+ Q+T+QE ++ IR+ +   + + NN+GYT+E+ I+GP   YN+I  +   +L
Sbjct: 507 ILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKWTAL 566

Query: 499 LPTFGAKDYETHRVATTGEWDKLTQD----KSFNDNSKIRMIEIMLPVFDAPQNL 549
           L  FG  + + +   T  + D+L Q     KS  + + I++ E+MLPV D PQ L
Sbjct: 567 LNVFGDFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQEL 621

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  259 bits (661), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 175/580 (30%), Positives = 285/580 (49%), Gaps = 47/580 (8%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVE--GMRWAGNANELNAAYAA 58
           MS + LG YLF RL QV   TVFG+PGDFNL+LL+ +Y  +   ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLL---HH 115
           DGY+RI    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ A+     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMITD--IATAPAEIDRCIRTTYVTQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLNVDAKLLDTPIDMSLKPN---------DAESEKEVIDTIMALVKDAKNPVILA 218
           P+NL D  +       P+D++ + N         D  +  E++   +  +  ++NP  + 
Sbjct: 180 PSNLPDAEI-------PVDLNKQLNFDFITKLRVDPHATSEMVSLTLKRIYSSRNPGFIV 232

Query: 219 DACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVES 278
           D    R D++ +    ++   F  + T   +G  DE  P + GV+   LS     E ++ 
Sbjct: 233 DQFM-RFDLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQ 290

Query: 279 ADLILSVGALLSDFNTGSF----SYSYKTKNIVEFHSDHIKI--RNATFPGVQMKFVLQK 332
            D IL +G   ++ N  S+    S     K+++    D+ ++        G+      ++
Sbjct: 291 NDFILHLG---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEE 347

Query: 333 LLTTIADAA--KGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGT 390
           LL  +      K                   S  + Q  +   +   L+E DV+I E  +
Sbjct: 348 LLQRMNSKTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCS 407

Query: 391 SAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLT 450
             F +    +      + Q  +GSI              ++     RVILF GDGS Q+T
Sbjct: 408 FMFEMPNIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMT 467

Query: 451 VQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNE-IQNWDHLSLLPTFGAKDYE- 508
           +QE+++ IR+ + P +F+LNN GY++E++I GP   YN+ I +WD  ++L  FG ++ + 
Sbjct: 468 LQELASYIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDR 527

Query: 509 --THRVATTGEWDKLTQDKSFNDNSKIRMIEIMLPVFDAP 546
             +++V   GE   +   +    + KI+M+EI+L   D P
Sbjct: 528 STSYKVEKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  238 bits (607), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 158/564 (28%), Positives = 262/564 (46%), Gaps = 17/564 (3%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL +V +   F +PGD+NL+LLDK+     +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDTP 184
              M+  I+     I     AP+ ID  IR     ++P Y+ +P N   ++  +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDMSL--KPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           I+  L   P++ ++    +D    L+     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP+Y GVY G +S       ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKG-YKXXXXXXXXXXXXXXXX 361
             + +E  SD++K  +  +  +++   L  L   ++   K   +                
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
           S  + ++ M  Q+   +     + AETG S F   Q   P       ++ WG I      
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 XXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIH 481
                       P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 -GPKAQYNEIQNWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEI 538
            GP   YN I+NW++ +L+  F A D   +  +V T  E  +  + K+ ++     +IEI
Sbjct: 477 DGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIK-KAKSNTRGPTLIEI 532

Query: 539 MLPVFDAPQNLVEQAKLTAATNAK 562
            +   D    L+      A  NA+
Sbjct: 533 QINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  238 bits (606), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 158/564 (28%), Positives = 262/564 (46%), Gaps = 17/564 (3%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL +V +   F +PGD+NL+LLDK+     +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDTP 184
              M+  I+     I     AP+ ID  IR     ++P Y+ +P N   ++  +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDMSL--KPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
           I+  L   P++ ++    +D    L+     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP+Y GVY G +S       ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKG-YKXXXXXXXXXXXXXXXX 361
             + +E  SD++K  +  +  +++   L  L   ++   K   +                
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 362 STPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXX 421
           S  + ++ M  Q+   +     + AETG S F   Q   P       ++ WG I      
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 XXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIH 481
                       P + ++  +GDGS Q+TVQE++ MIR      +F++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 -GPKAQYNEIQNWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMIEI 538
            GP   YN I+NW++ +L+  F A D   +  +V T  E  +  + K+ ++     +IEI
Sbjct: 477 DGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIK-KAKSNTRGPTLIEI 532

Query: 539 MLPVFDAPQNLVEQAKLTAATNAK 562
            +   D    L+      A  NA+
Sbjct: 533 QINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  236 bits (602), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 169/555 (30%), Positives = 272/555 (49%), Gaps = 58/555 (10%)

Query: 58  ADGYARIKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISAQAKQLL 112
           ADG++R    + C+ITT+GVGELSALNGIAG+++E+V VLH+VGV     S S       
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLNVDAKLLDTPIDMSLKPNDAESEKEVIDTIMALV----KDAKNPVILAD 219
           Y+ +P +  D+ VD   L    +++L+   + +   V+D ++ +V     ++K P I+ D
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRPEITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIGD 182

Query: 220 ACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESA 279
             C R    +    LI LT    F T MGK  IDE +  Y G+Y G  S   V E    +
Sbjct: 183 VLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQS 242

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NIVEFHSDHIKIRNAT------FPGVQMKFVLQK 332
           DL+L  G  + + N G ++ +YK    ++EFHS++I+  +A+      F GV    VL++
Sbjct: 243 DLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLER 302

Query: 333 LLTTIADAAKGYKXXXXXXXXXXXXXXXXSTP-----LKQEWMWNQLGNFLQEGDVVIAE 387
           L+ TI      ++                + P     + Q ++   + ++L  GDV++ E
Sbjct: 303 LIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVCE 362

Query: 388 TGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEI--------------- 432
           TG+  F I     P+    I+Q  + SI              ++                
Sbjct: 363 TGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVEI 422

Query: 433 --DPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLIHGPKAQYNEI 490
             D + R+IL  GDG+ Q+T+QE+++M+R+ +   + ILNN+GYTIE+ I GP   YN++
Sbjct: 423 PDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYNDV 482

Query: 491 QNWDHLSLLPTFGAKDYETHRVAT------TGEWDKLTQDKSFNDNSKIRMIEIMLPVFD 544
            +WD   LL  FG  D++  R  +      +    KL Q K+    + I ++EI L   D
Sbjct: 483 MSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTMD 540

Query: 545 AP---QNLVEQAKLT 556
            P   Q++V+ A  T
Sbjct: 541 FPKQLQSMVDAAAFT 555

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  235 bits (599), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 158/566 (27%), Positives = 261/566 (46%), Gaps = 21/566 (3%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARI 64
           T+G YL  RL Q  +   F +PGD+NL LLDK+ E   +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDTP 184
            + M+  I+     I     AP+ ID  IR     ++P Y+ +P N+      + +   P
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMA-----SAICAPP 177

Query: 185 IDMSLKPNDAESEKEVIDTIMALVKDAKN----PVILADACCSRHDVKAETKKLIDLTQF 240
             +S   N   + K+V+   +    D  N    P +LA       D +    +L +  + 
Sbjct: 178 GPISSLVNSVPTPKDVLSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKC 237

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300
              V P  K    E HP++ GVY G +S       +E +DL +  G + +D++T  ++  
Sbjct: 238 AVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTAL 297

Query: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGY-KXXXXXXXXXXXXXX 359
             + + +E  +D+++    +F  + +   L  L   +++  K   +              
Sbjct: 298 QPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAA 357

Query: 360 XXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIXXXX 419
                + ++ M  Q+   +     + AETG S F   Q   P       ++ WG I    
Sbjct: 358 DPKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSV 417

Query: 420 XXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKL 479
                         P +R+I  +GDGS Q+T QE+S M+R      +F++NN GYTIE  
Sbjct: 418 PASLGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVE 473

Query: 480 IH-GPKAQYNEIQNWDHLSLLPTFGAKD--YETHRVATTGEWDKLTQDKSFNDNSKIRMI 536
           IH GP   YN I+NW++ +L+  F A +   +  +  T GE     + K+  + S   +I
Sbjct: 474 IHDGP---YNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIE-KAQANVSGPTLI 529

Query: 537 EIMLPVFDAPQNLVEQAKLTAATNAK 562
           EI +   D    L+      A  NA+
Sbjct: 530 EIQINRDDCTNELITWGHFVALANAR 555

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 135/310 (43%), Gaps = 30/310 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LDTPIDMSLK-PNDA----------ESEKEVIDTIMALVKDAKNPVILADACCSRH-DVK 228
           L  PI      P++A          E   + I+    L+  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L D  Q P   T  G GS D++ P+   + +G         AV++ADLI++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 72.0 bits (175), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 387 ETGTSAFGINQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGS 446
           ETG S    NQ     + + ISQVLW  I              E+IDP  R ILF GD  
Sbjct: 2   ETGASTLASNQAILLKDAHDISQVLWRPIRFANGATLSA----EDIDPG-RAILFSGDRP 56

Query: 447 LQLTVQEISTMIRWGLKPYLFILNNDGYTIE 477
           L LTVQE+ T IRW LKPYLF+ NND   +E
Sbjct: 57  L-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 140/309 (45%), Gaps = 28/309 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D IY+ +  ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  IKGMSCII-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G   I+  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   MI ++A  P  I+      T     PV + LP ++      A L
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKDV----TAAIL 253

Query: 181 LDT-PIDMSLKPN------DAESEKEVIDTI---MALVKDAKNPVI-LADACCSRHDVKA 229
            D  P+  SL  N      +   ++ V+D I     L+  AKNPV+ +        D   
Sbjct: 254 RDAIPVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYVGGGILGNEDGPK 313

Query: 230 ETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALL 289
             K+L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI+++G   
Sbjct: 314 LLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTRF 372

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 373 DDRVTGNIA 381

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 143/310 (46%), Gaps = 30/310 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I+  +  ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+ ++A  P  I+   +  T     PV + LP      +V A +
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPK-----DVTAAI 247

Query: 181 LDTPIDM-SLKPNDA-------ESEKEVIDTIMA---LVKDAKNPVI-LADACCSRHDVK 228
           L TPI + S  P+ A         ++ VI+ I     L+  AKNPV+ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G G+ D++ P+   + +G         AV+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 367 FDDRVTGNIT 376

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 139/308 (45%), Gaps = 28/308 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E +K+ NV+TVFG PG   L + D IY  +  ++    +E  A + A+GYAR
Sbjct: 92  LSGGQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGMS-CIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G +  ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +A  P  I+         +  PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LDTPIDM--------SLKPNDAES-EKEVIDTIMALVKDAKNPVI-LADACCSRHDVKAE 230
           L  PI +         LK    E+   E I+    L+  AK PV+ + +   +  D    
Sbjct: 258 LRNPIPIKSTLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRL 317

Query: 231 TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLS 290
            K+L D  Q P   T  G G+ D++ P+   + +G         A+++ADL++++GA   
Sbjct: 318 LKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFD 376

Query: 291 DFNTGSFS 298
           D  TG+ +
Sbjct: 377 DRVTGNIA 384

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTI----EKLIHGPKAQYNE 489
           P   VI   GD S  +T+ E+S+ ++ G+   + +LNN+   +    + L +  +  +  
Sbjct: 538 PDAIVIDIDGDASFNMTLTELSSAVQAGVPIKILLLNNEEQGMVTQWQSLFYEHRYSHTH 597

Query: 490 IQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEI-------MLPV 542
             N D + L    G K     RV   GE D     K F D     ++E+       +LP+
Sbjct: 598 QLNPDFMKLADAMGLKGI---RVKNQGELDGAL--KEFVDYQGPVLLEVEVEKKVPVLPM 652

Query: 543 FDAPQNLVE 551
             A + L E
Sbjct: 653 VPAGKGLDE 661

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 134/310 (43%), Gaps = 30/310 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LDTPIDMSLK-PNDA----------ESEKEVIDTIMALVKDAKNPVILADACCSRH-DVK 228
           L  PI      P++A          E   + I+    L+  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L    Q P   T  G GS D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 134/314 (42%), Gaps = 37/314 (11%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D IY  E  ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLP------------ 168
                 +S + ++   M+ ++A  P  I+         +  PV + LP            
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKDVTAAVLREAI 267

Query: 169 ---ANLVDLNVDAKLLDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVI-LADACCSR 224
              + L  LN  A    T  D  L P         I+    L+  AK PV+ + +   + 
Sbjct: 268 PTESTLPSLNGGATTGATVFDEFLAP--------AINKAADLINLAKKPVLYVGNGILNN 319

Query: 225 HDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILS 284
            D     K+L D  Q P   T  G G+ D++ P+   + +G         A+++ADLI++
Sbjct: 320 EDGPRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIA 378

Query: 285 VGALLSDFNTGSFS 298
           VGA   D  TG+ +
Sbjct: 379 VGARFDDRVTGNIT 392

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 138/310 (44%), Gaps = 30/310 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D IY  +  ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 241

Query: 181 LDTPIDM-SLKPNDA----------ESEKEVIDTIMALVKDAKNPVILADACCSRHDVKA 229
           L  PI + S  P++A          E  +E +    +L+  AK PV+        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              ++L +  Q P   + +G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 361 FDDRVTGNIA 370

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/315 (26%), Positives = 137/315 (43%), Gaps = 33/315 (10%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M  +T G+   E +++ NV+TVFG PG   L + D IY  E  ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVD 177
                    +S + ++   M+  +   P  I+         +  PV + LP      +V 
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPK-----DVT 276

Query: 178 AKLLDTPIDM---SLKPNDAESE----------KEVIDTIMALVKDAKNPVILADA-CCS 223
           A +L  PI +   SL P  A S            E I     L+  AK PVI A A   S
Sbjct: 277 AAVLKNPIPVLNNSL-PYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILS 335

Query: 224 RHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLIL 283
             +     K+L + +Q P   T    G+ D+Q P+   + +G         A+++ADLI+
Sbjct: 336 NLNGPTLLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLII 394

Query: 284 SVGALLSDFNTGSFS 298
           ++G    D  TG+ S
Sbjct: 395 ALGGRFDDRVTGNIS 409

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 142/314 (45%), Gaps = 38/314 (12%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+T+FG PG   L + D I++ +  ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTY---VTQRPVYLGLPANLVDL--NV 176
                 +S + ++   M+  +   P    RCI   +   ++ RP  +     LVDL  +V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPV-----LVDLPKDV 255

Query: 177 DAKLLDTPIDM-SLKPNDAESE----------KEVIDTIMALVKDAKNPVILADA-CCSR 224
            A +L  PI + S  P+ A S+           E I+   AL+  AK PV+   A   + 
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNN 315

Query: 225 HDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILS 284
            D     K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++
Sbjct: 316 VDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIA 374

Query: 285 VGALLSDFNTGSFS 298
           +G    D  TG+ +
Sbjct: 375 LGTRFDDRVTGNIT 388

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 138/310 (44%), Gaps = 30/310 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E +K+ NV+TVFG PG   L + D IY  E   +    +E  A + A+GYAR
Sbjct: 89  LSGGQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYAR 148

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 149 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 205

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +A  P  I+         +  PV + LP      +V A +
Sbjct: 206 ------ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPK-----DVTAAI 254

Query: 181 LDTPIDM-SLKPNDAESE----------KEVIDTIMALVKDAKNPVI-LADACCSRHDVK 228
           L  PI + S  P+   ++           + I+    L+  AK PV+ + +   +  D  
Sbjct: 255 LREPIPIKSTLPSGTLTQIKSIAQEDFLADSINRAADLINLAKKPVLYVGNGIFNNEDGP 314

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 315 RLLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGAR 373

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 374 FDDRVTGNIA 383

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 137/310 (44%), Gaps = 32/310 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + NV+TVFG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+ ++A  P  I+         +  PV + LP      +V A +
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPK-----DVTAAI 249

Query: 181 LDTPIDM-SLKP-----------NDAESEKEVIDTIMALVKDAKNPVI-LADACCSRHDV 227
           L  PI + S  P           +DA + KE I+    L+  AK PV+ +     +  + 
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFT-KERIEKAAKLINIAKKPVLYVGGGILNNPEG 308

Query: 228 KAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGA 287
               K L D  Q P   T  G G+ D++ P+   + +G         ++++ADLI+++G 
Sbjct: 309 PKLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAVANLSIQNADLIIAIGT 367

Query: 288 LLSDFNTGSF 297
              D  TG+ 
Sbjct: 368 RFDDRVTGNL 377

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 134/311 (43%), Gaps = 32/311 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E +++  V+TVFG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  S +A          +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVSTTA----------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAK 179
                  +S + ++   M+  I   P  I+      T     PV + LP      +V A 
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAA 248

Query: 180 LLDTPIDM-SLKPNDA--ESEKEVIDTIMA--------LVKDAKNPVILADACCSRHDVK 228
           +L  PI   S  P+DA  +  K  +D            L+  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 229 AE-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGA 287
            +  K+L +  Q P   T  G G+ D++ P+   + +G     A   AV++ADLI+++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 368 RFDDRVTCNIS 378

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 131/303 (43%), Gaps = 30/303 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E +K+ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  I   P  I+      T     PV + LP      +V A +
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPK-----DVQASI 259

Query: 181 LDTPIDMSLK-PNDA----------ESEKEVIDTIMALVKDAKNPVI-LADACCSRHDVK 228
           L TPI +    P++A          +  +  I     L+  AK P++ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L D  Q P   T    G+ D++ P+   + +G         A+++ADLI++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGAR 378

Query: 289 LSD 291
             D
Sbjct: 379 FDD 381

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 137/305 (44%), Gaps = 34/305 (11%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E +++  V+TVFG PG   L++ D IY  +   +    +E  A + A+GYAR
Sbjct: 84  LSGGQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAF 193

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVDA 178
                  +S + ++   M+  +   P  I+       V+ RP  +     LVDL  +V +
Sbjct: 194 QEADVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPV-----LVDLPKDVTS 247

Query: 179 KLLDTPIDM-SLKPNDAESE----------KEVIDTIMALVKDAKNPVI-LADACCSRHD 226
            +L TPI + S  P DA S+          K  I  +  L+  AK P++ +      R D
Sbjct: 248 AILKTPIPVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGRED 307

Query: 227 VKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVG 286
                ++L D  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++G
Sbjct: 308 GPKLLRQLADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALG 366

Query: 287 ALLSD 291
           A   D
Sbjct: 367 ARFDD 371

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 133/304 (43%), Gaps = 32/304 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+ V ++   G  + SA          +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSA----------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAK 179
                  +S + ++   M+  I   P  I+      T     PV + LP      +V A 
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAA 260

Query: 180 LLDTPIDM-SLKPNDA----------ESEKEVIDTIMALVKDAKNPVILADACCSRHDVK 228
           +L  PI M S+ P+D           E   E I     L+  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 AE-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGA 287
            +  K+L D  Q P   T  G G+ +++  +   + VG     A   A+++ADLI+++GA
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLDM-VGMHGNAAANLAIQNADLIIALGA 379

Query: 288 LLSD 291
              D
Sbjct: 380 RFDD 383

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 132/303 (43%), Gaps = 30/303 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LDTPIDMSLK-PNDA------ESEKEV----IDTIMALVKDAKNPVILADACCSRH-DVK 228
           L  PI      P++A       ++ E     I+    L+  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 139/305 (45%), Gaps = 34/305 (11%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           L+ G+   E +++  VNTVFG PG   L++ D IY  E   +    +E  A + A+GYAR
Sbjct: 83  LSGGQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYAR 142

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           + G    ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F
Sbjct: 143 VSGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAF 192

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVDA 178
                  +S + ++   M+ ++   P  I+       V+ RP  +     LVDL  +V +
Sbjct: 193 QEADVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPV-----LVDLPKDVTS 246

Query: 179 KLLDTPIDM-SLKPNDAESE------KEV----IDTIMALVKDAKNPVI-LADACCSRHD 226
            +L TPI + S  P++A S+      KE     +     L+  AK P+I +      +  
Sbjct: 247 AILRTPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQ 306

Query: 227 VKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVG 286
                ++L +  Q P   T  G G+ D++ P+   + +G         +V++ADLI+++G
Sbjct: 307 GPKLLRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALG 365

Query: 287 ALLSD 291
           A   D
Sbjct: 366 ARFDD 370

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 133/304 (43%), Gaps = 32/304 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I++ +   +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVDAK 179
                 +S + ++   M+  I   P  I+       V+ RP  +     LVDL  +V A 
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPV-----LVDLPKDVTAA 251

Query: 180 LLDTPIDMSLK-PNDA----------ESEKEVIDTIMALVKDAKNPVILADACCSRHDVK 228
           +L  PI      P+++          ES  E I     L+  AK PV+   A    +   
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTADLLNKAKTPVLYVGAGILNNPAG 311

Query: 229 AE-TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGA 287
            +  K+L +  Q P   T    G+ D+Q P+   + +G         A+++ADLIL+VG+
Sbjct: 312 PKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVGS 370

Query: 288 LLSD 291
              D
Sbjct: 371 RFDD 374

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 130/303 (42%), Gaps = 30/303 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I+  +   +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPK-----DVTAAI 257

Query: 181 LDTPIDMSLK-PNDA----------ESEKEVIDTIMALVKDAKNPVILADA-CCSRHDVK 228
           L  PI      P++A          E   + I     L+  AK PV+   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L +  Q P   T  G GS D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGAR 376

Query: 289 LSD 291
             D
Sbjct: 377 FDD 379

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 30/303 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E +K+ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  IKG-MSCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPK-----DVQASI 256

Query: 181 LDTPIDMSLK-PNDA----------ESEKEVIDTIMALVKDAKNPVI-LADACCSRHDVK 228
           L  PI +    P++A          +  +  I     L+  AK P++ +     +  +  
Sbjct: 257 LRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGP 316

Query: 229 AETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
              K+L D  Q P   T    G+ D+  P+   + +G         A+++ADLI++VGA 
Sbjct: 317 RLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM-LGMHGYAPANLAIQNADLIIAVGAR 375

Query: 289 LSD 291
             D
Sbjct: 376 FDD 378

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 112/497 (22%), Positives = 198/497 (39%), Gaps = 73/497 (14%)

Query: 9   YLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM- 67
           Y    L+   V+TVFG+ G   + L D + E  G+++    NE +A+YAA  Y  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDFTV 124
             ++   G G + AL GI  S +    +L + G  S  AQ +   Q L   +L       
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG--SSEAQHRGGFQELDQVSL----LKP 118

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDTP 184
           + + S  ++ +     D+ T     D      Y T    YL +P NL+   V    L  P
Sbjct: 119 YVKFSGQLNSSN---IDVLT----YDALRLVQYTTAGATYLDIPGNLIGSTVKKDSL-PP 170

Query: 185 IDMSLKPN---DAESEKEVIDTIMALVKDAKNP--VILADACCSRHDVKAETKKLIDLTQ 239
           +     P    D  + +EV D I       KNP  V++     + H    E ++ +D  Q
Sbjct: 171 VKNIYVPKSSPDPSAVQEVTDLIR------KNPENVLVVVGKGAVH-ASQEIRQFVDRFQ 223

Query: 240 FPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLS--------- 290
            P   TPMGKG + + HP    + V +    A   A++ A ++L +GA L+         
Sbjct: 224 LPFLPTPMGKGVVPDSHP----LNVSS----ARSRALQEAKVVLVLGARLNWILHFASAP 275

Query: 291 -----------DFNTGSFSY-SYKTKNIVEFHSDHIKIR--NATFPGVQMKFVLQKLLTT 336
                      D +T +  + ++K++++  +    + +R   A+      + +   L + 
Sbjct: 276 KWNPDALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQSN 335

Query: 337 IADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGIN 396
           IA  A   K                S+ L    ++  L   + +   +I   G +     
Sbjct: 336 IARNAAKLK---------SQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKA 386

Query: 397 QTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIST 456
           + +FP + Y + ++  G+               +  +P K V++  GD +   +  +I T
Sbjct: 387 RVSFPTD-YPLQRLDAGT-NATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIET 444

Query: 457 MIRWGLKPYLFILNNDG 473
             R GL   + ++NN G
Sbjct: 445 ATRSGLALIVIVMNNGG 461

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 135/311 (43%), Gaps = 32/311 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E +++ +V+TVFG PG   L + D I+E +   +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + SA          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMITDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLNVDAK 179
                  +S + ++   M+ ++   P  I+         +  PV + LP      +V A 
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPK-----DVTAA 268

Query: 180 LLDTPIDM-SLKPND--AESEKEVIDTIMA--------LVKDAKNPVILADACC-SRHDV 227
           +L  PI   S  P+D  A+  K   D   +        LV  AK P++   A   +  D 
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVAKKPILYVGAGIFNNPDG 328

Query: 228 KAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGA 287
               K+L +  Q P   T  G G+ D++  +   + +G         A+++ADLIL+VGA
Sbjct: 329 PRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVGA 387

Query: 288 LLSDFNTGSFS 298
              D  T + S
Sbjct: 388 RFDDRVTCNIS 398

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 139/310 (44%), Gaps = 30/310 (9%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E +++  V+T+FG PG   L + D IY  +  ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKL 180
                 +S + ++   M+  +   P  I+      T     PV + LP      +V A +
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTASV 259

Query: 181 LDTPIDM-SLKPNDAESE--KEVID--------TIMALVKDAKNPVILADACCSRHDVKA 229
           L +PI M S  P++   E  + V+D            L+  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-KKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGAL 288
           +  K+L +  Q P   T  G G+ D+  P+   + +G     A   A+++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 379 FDDRVTGNVA 388

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 434 PKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNN 471
           P   VI   GD SL +T+ E+ST ++ G    + +LNN
Sbjct: 542 PNALVIDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 133/311 (42%), Gaps = 32/311 (10%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT G+   E + + NV+TVFG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL--NVDAK 179
                 +S + ++   M+  +   P  I+       +++RP  +     LVDL  +V A 
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPV-----LVDLPKDVTAA 259

Query: 180 LLDTPIDMSLK-PNDAESE----------KEVIDTIMALVKDAKNPVILADA-CCSRHDV 227
           +L  PI +    P+ A S+           E I     L+  AK PV+   A   +  + 
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEG 319

Query: 228 KAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGA 287
               K L    + P   T  G G+ D++ P    + +G         AV+++DLI++VG 
Sbjct: 320 PRILKDLSQRAKIPVTTTIQGLGAFDQEDPLSLDM-LGMHGCATANLAVQNSDLIIAVGT 378

Query: 288 LLSDFNTGSFS 298
              D  TG+ S
Sbjct: 379 RFDDRVTGNIS 389

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 113/522 (21%), Positives = 205/522 (39%), Gaps = 95/522 (18%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           LT  +Y    LKQ  ++TVFG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  IKGMSCIITTF-GVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           + G   ++    G G + AL GI  S +    ++ + G  S +++  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMITDIATAPAEIDRCIRTTYVTQRPV---YLGLPANLVDLN-- 175
               ++S      + T  +  I    A  +      +  Q P+   Y+  P NL++ N  
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFN---AYNFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 176 VDAKLLDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNP--VILADACCSRHDVKAETKK 233
           V A+    P+ +  +   +     V +    +++++ N   VIL       H    +  K
Sbjct: 176 VQAQPATNPVSIPRRVRCSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFHK---DINK 232

Query: 234 LIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFN 293
            I+    P   TPM KG + + H     + V +    A  +A++ A+++L +GA L+   
Sbjct: 233 FINTFNLPFLPTPMAKGILPDSH----NLNVSS----ARSKALKDANIVLVLGARLNWIL 284

Query: 294 TGSFSYSYKTKNI-VEFHSD--HIKIRNATFPGVQMKFVLQKLLTTIADAAK----GYKX 346
               S  +  K I ++  +D  ++ + N T   + +   L   + +++DA       +K 
Sbjct: 285 HFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLNWKY 344

Query: 347 XXXXXXXXXXXXXXXSTPLKQE--------------WMWNQLGNFLQEGDVVIAETGTSA 392
                             L+++               ++  L   + E   V+   G ++
Sbjct: 345 EKGISDEMRGIILKNQFKLQEKEQRLIKDKDLLNYNVVYGALRKLMDESKTVLVTEGANS 404

Query: 393 FGINQTTFPNNT------------------YGISQVLWGSIXXXXXXXXXXXXXXEEIDP 434
             I + +FP++                   YGI+  L                   E+  
Sbjct: 405 MDIARISFPSSVPKQRLDAGTNATMGIGLGYGIAACL------------------NELRN 446

Query: 435 KKR---VILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDG 473
            KR   VIL  GD +   +  EI T +R+ L   + ++NN G
Sbjct: 447 GKRGKDVILIQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 130/308 (42%), Gaps = 32/308 (10%)

Query: 7   GKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKG 66
           G+   E +++ NV+TVFG PG   L + D IY  +   +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISAQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMITDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLNVDAKLLDT 183
              +S + ++   M+  +   P  I+      T     PV + LP      +V A +L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPK-----DVTAAILRS 241

Query: 184 PI------------DMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAE- 230
           PI             ++ +  D +  + + D    L+  A+ PV+   A         E 
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLADA-SRLINMAQKPVLYVGAGILNSTRGPEF 300

Query: 231 TKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLS 290
            ++L +  Q P   T    G+ D++  +   + +G     A    V++ADLI+++GA   
Sbjct: 301 LRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFD 359

Query: 291 DFNTGSFS 298
           D  TG+ +
Sbjct: 360 DRVTGNIA 367

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 125/294 (42%), Gaps = 33/294 (11%)

Query: 4   LTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYAR 63
           L + +Y  + L+Q  V+TVFG+ G   + L D +   +G+++    NE +A+YAA  Y  
Sbjct: 3   LPIPEYFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGY 61

Query: 64  IKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDF 122
           + G    ++   G G + AL GI  S +    ++ + G                L  G F
Sbjct: 62  LTGKPGVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAGS------------SEDLHKGGF 109

Query: 123 TVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
               ++S  +S+       + T P  I+     TY   R    G P  +  ++    L+ 
Sbjct: 110 QELDQVSL-LSDHLKFTGKLTTDPDVIEL---VTYNAMRLTTTGTPG-VTYIDFPGSLIS 164

Query: 183 TPIDMSLKPNDAES------EKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLID 236
             I+ S  P  + S      + E +  ++ L+   +N  IL        +   E +KLI+
Sbjct: 165 ESIERSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLIN 224

Query: 237 LTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLS 290
               P   TPM KG + + HP          +  A  +A++ A+++L +GA L+
Sbjct: 225 DYNLPFLSTPMAKGVVPDSHPLN--------ASSARSKALKEAEIVLVLGARLN 270

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/280 (20%), Positives = 117/280 (41%), Gaps = 29/280 (10%)

Query: 14  LKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           LKQ  +  VFG+ G   + L +K+ E  G+R+    NE + +YAA  Y  +      ++ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++     +L + G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDTPIDMSLKP 191
           +     M+             ++T  +     YL +P  L++++    L   P+D+    
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDIQHVR 179

Query: 192 NDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGS 251
           +  +S +  +     L++D +N +++    C+ +      +  ++  + P    PM KG 
Sbjct: 180 SGPDSSR--VQGAAKLLQDGRNILVVVGRGCAEY--PGVVRSFLERYRLPFLPVPMAKGI 235

Query: 252 IDEQHPRYGGVYVGTLSKPAVKE-AVESADLILSVGALLS 290
           + + H          L+    +  A++ A+++L +GA L+
Sbjct: 236 VPDSH---------ELNVNGCRSLALKRAEIVLVLGARLN 266

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 127/291 (43%), Gaps = 29/291 (9%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           ++  + L++  ++TVFG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDFT 123
              ++   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLD 182
            F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++     +  D
Sbjct: 122 PFLKFTGKLTPDNVDMVTQKA-----LNHCIQGTAGVS---YIDVPADFIESEKPLEGND 173

Query: 183 ---TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQ 239
                + M L P     +   I  I+ L+   ++  IL            E ++LI+   
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSHEIRRLINKFN 233

Query: 240 FPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLS 290
            P   TPM KG + +  P    + V +    A  +A+++AD++L +GA L+
Sbjct: 234 LPFLPTPMAKGIVPDSSP----LNVSS----ARSQALKTADVVLVLGARLN 276

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 111/509 (21%), Positives = 205/509 (40%), Gaps = 66/509 (12%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYARIK 65
           +Y  E L++  ++TVFG+ G   + L D +   +G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGNGDF 122
               +I   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  PGVLLIVG-GPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVD----LNVD 177
           + F + +  ++ +   MIT  A     ++ CI+ T       Y+ +PA+ ++    L  +
Sbjct: 121 SPFLKFTGKLAPDNIRMITQKA-----LNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 178 AKLLDTPIDMSLKPN----DAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKK 233
             + D  + + L PN    D    KEV+  I+   ++    VI   A  + H+V+    +
Sbjct: 173 CHIGDE-LPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVR----R 227

Query: 234 LIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFN 293
           LI+    P   TPM KG + +  P    + V +    A  +A+++AD++L +GA L+   
Sbjct: 228 LINKFNIPFLPTPMAKGIVPDSSP----LNVSS----ARSQALKTADIVLVLGARLNWIL 279

Query: 294 TGSFSYSYKTKNI-VEFHSDHIKI-RNATFPGVQMK------FVLQKLLTTIADAAKGYK 345
               S  + +++I ++F S+   +  N   PG  +         +  L+  +      +K
Sbjct: 280 HFGASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWK 339

Query: 346 XXXXXXXXXXXXXXXXSTPLKQE----------WMWNQLGNFLQEGDVVIAETGTSAFGI 395
                           +  LK+E           ++  L   + +    +   G +   I
Sbjct: 340 YSGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDI 399

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIS 455
            + +FP N     + L                  +   P+  V+L  GD +   +  EI 
Sbjct: 400 ARVSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIE 457

Query: 456 TMIRWGLKPYLFILNNDGYTIEKLIHGPK 484
           T +R  L   + ++NN G     + HG K
Sbjct: 458 TAVRCQLALVIVVMNNSG-----IYHGEK 481

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 108/506 (21%), Positives = 200/506 (39%), Gaps = 52/506 (10%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L++  ++TVFG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGN 119
             K    ++   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKP-GVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDA 178
              + F + +  ++ +   MIT  A     ++ CI+ T       Y+ +PA+ ++     
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQKA-----LNYCIQGTAGVS---YIDVPADFIEYEKPL 169

Query: 179 KLLD---TPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLI 235
           +  D     + M L PN    +   I  ++ L+   KN  IL            E ++L+
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLV 229

Query: 236 DLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P    + V +    A  +A++ AD++L +GA L+     
Sbjct: 230 NTFNLPFLPTPMAKGIVPDSSP----LNVSS----ARSQALKIADIVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNI-VEFHSDHIKI-RNATFPGVQMK------FVLQKLLTTIADAAKGYKXX 347
             S  + +++I ++F S+   +  N   PG  +         +  L+  +      +K  
Sbjct: 282 GTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYS 341

Query: 348 XXXXXXXXXXXXXXSTPLKQE----------WMWNQLGNFLQEGDVVIAETGTSAFGINQ 397
                         +  L++E           ++  L   + +   ++   G +   I +
Sbjct: 342 GVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 TTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEISTM 457
            +FP  T    + L                  +   P+  V+L  GD +   +  EI T 
Sbjct: 402 ISFP--TDAPRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 IRWGLKPYLFILNNDG-YTIEKLIHG 482
           +R  L   + ++NN G Y  EK I G
Sbjct: 460 VRCQLALVIVVMNNSGIYHGEKDIEG 485

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 91/498 (18%), Positives = 187/498 (37%), Gaps = 85/498 (17%)

Query: 14  LKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM-SCIIT 72
           LKQ  V  VFG+ G   + + +   E  G+R+ G  NE + +YAA  Y  + G    ++ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVG------------VPSISAQAKQLLLHHTLGNG 120
             G G + AL G+  S+     +L + G            +  +S  ++    +  +  G
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAGSSENEYYEGFQELDQLSVMSRWCKFYGRINTG 129

Query: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180
           + +  H +       TAM               +T+ +     Y+ +P  L++    +  
Sbjct: 130 NLS--HLV------YTAM---------------KTSMLQNAVTYIDIPGGLIEEKAKSS- 165

Query: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240
            + P  M +       + + +  +  +++  K  +++     + +   AE +  ++  Q 
Sbjct: 166 DELPKKMEIAHIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQL 223

Query: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKE-AVESADLILSVGALLS--------- 290
           P   TPM KG + + H          L+    +  A++SA+++L +GA L+         
Sbjct: 224 PFLPTPMAKGIVPDTH---------ELNVNGARSLALKSAEVVLILGARLNWILHFGLEP 274

Query: 291 -----------DFNTGSFSYSYKTKNIVEFHSD---HIKIRNATFPGV-QMKFVLQKLLT 335
                      D +  +   +         HSD    I+  +   P   +   V +K+L+
Sbjct: 275 KWSDDACFIQVDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILS 334

Query: 336 TIADAAKGYKXXXXXXXXXXXXXXXXSTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGI 395
            I    K  K                 + L+   ++ +L  F+ +   ++   G +   I
Sbjct: 335 KIHSNGKAMK---------EKEIIPEGSALRYHGVYAKLREFIDDKSTIMVLEGANTMDI 385

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIS 455
            + +FP  +Y   ++  G+               +  +P K V+   GD +   +  E+ 
Sbjct: 386 ARVSFP-TSYQKHRLDAGT-SATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELE 443

Query: 456 TMIRWGLKPYLFILNNDG 473
           T+ R  L   + ++NN G
Sbjct: 444 TIARNKLGIVVVVMNNGG 461

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 136/308 (44%), Gaps = 46/308 (14%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           MS +++  Y+   LK+ +++TVFG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK-----QLLLH 114
           Y  +      ++T  G G + AL GI  S   +  ++ + G   I +Q K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + ++ + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LNVDAKLLDT-----PI---DMSLKPND---AESEKEVIDTIMALVKDAKNPVILADACC 222
            +V   + D+     PI    ++  PND    E+ K + D +    +D    VI+     
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRK--RDQNMLVIVGKGAI 223

Query: 223 SRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLI 282
                 +  +  I+    P   TPM KG I++ +     + V +    A+K+    AD+I
Sbjct: 224 G---ASSALRHFINCFNLPFLPTPMAKGIIEDSNE----LNVSSGRSMALKD----ADVI 272

Query: 283 LSVGALLS 290
           L  GA L+
Sbjct: 273 LVFGAKLN 280

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 107/258 (41%), Gaps = 37/258 (14%)

Query: 14  LKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITT 73
           L+   V+ VFG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  + G   ++  
Sbjct: 13  LRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGYLTGKPGVLLV 71

Query: 74  FGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLH------HTLGNGDFTVFHR 127
             VG    ++ +AG Y             SI+ +   ++L       H    G F    +
Sbjct: 72  --VGGPGLIHSLAGVYN------------SINNRWPLIVLAGSNDHGHDQYRGAFQELDQ 117

Query: 128 MS--ANISETTAMITDIATAPAEIDRCIRTTY-----VTQRPVYLGLPANLVDLNVDAKL 180
           +S      + +  +T+       +D  + + Y      T+   Y+ +P NL++    A  
Sbjct: 118 ISLLKPYVKFSGKLTE-----GNVDHVLFSAYNIALQGTKGVTYVDIPGNLIE--TQAVC 170

Query: 181 LDTP--IDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLT 238
             TP  +    +P     +   +  + +L+ + ++  +L           A  ++ ID  
Sbjct: 171 AGTPGLLPPVPQPIKCSPDPHTVKRVASLILENRDKKVLVVVGKGSQGAFAAVRRFIDEF 230

Query: 239 QFPAFVTPMGKGSIDEQH 256
            FP   TPMGKG + ++H
Sbjct: 231 NFPFLPTPMGKGVVPDEH 248

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 126/295 (42%), Gaps = 29/295 (9%)

Query: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60
           M+  +   ++ + L    ++TVFG+ G   + + D I     +R+ G  NE  A+YAA  
Sbjct: 1   MTTESFPAHISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASA 60

Query: 61  YARIKGM-SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGN 119
           Y  + G    ++   G G + AL G+  S +    +L + G                L  
Sbjct: 61  YGYLTGKPGVLLVVGGPGLIHALAGVYNSISNKWPLLVLAGS------------SEDLNR 108

Query: 120 GDFTVFHRMSANISETTAMITDIATAPAE--IDRCIRTTYVTQRPV-YLGLPANLVDLNV 176
           G F    ++ A +S      + +  +     +   +R + V    V YL +P +L++ +V
Sbjct: 109 GGFQALDQI-AVLSRYVKFSSRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSV 167

Query: 177 DAKLLDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLID 236
           + +  +   +++    + +  K+ +  +  L+ +     +L        D   E +K I+
Sbjct: 168 EKEKYNCVRNIT--KVEYQPSKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIE 225

Query: 237 LTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKE-AVESADLILSVGALLS 290
             Q P   TPM KG + + HP         L+  + +  A+ SAD++L +GA L+
Sbjct: 226 RFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLALRSADIVLVLGARLN 271

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 106/509 (20%), Positives = 200/509 (39%), Gaps = 59/509 (11%)

Query: 5   TLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L++  ++TVFG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK---QLLLHHTLGN 119
             K    ++   G G + +L GI  S +    +L + G  S +   K   Q L   +L  
Sbjct: 63  NDKP-GVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDA 178
              + F + +  + S+   M+T  A     ++ CI+ T       Y+  PA+L++ N   
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTRKA-----LNHCIQGTMGVS---YIDFPADLIE-NEKK 168

Query: 179 KL-----LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKK 233
            L     L   + M L PN    +   I+ I+ L+   ++  IL            E ++
Sbjct: 169 SLAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQNRDKNILIVIGKGAVKNSHEIRR 228

Query: 234 LIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFN 293
           L+     P   TPM KG + +  P    + V +    A  +A+++AD++L +GA L+   
Sbjct: 229 LVSSFNLPFLPTPMAKGIVPDSSP----LNVSS----ARSQALKTADIVLVLGARLNWIL 280

Query: 294 TGSFSYSYKTKNI-VEFHSDHIKI-RNATFPGVQMK------FVLQKLLTTIADAAKGYK 345
               S  +  +++ ++F S    +  N T  G  +         +  L+  +A     +K
Sbjct: 281 QFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRPRWK 340

Query: 346 XXXXXXXXXXXXXXXXSTPLKQEWM----------WNQLGNFLQEGDVVIAETGTSAFGI 395
                           +   ++E M          +  L   +++   ++   G +   I
Sbjct: 341 YSGVNNALREKIHVNETRLQEKEKMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANTMDI 400

Query: 396 NQTTFPNNTYGISQVLWGSIXXXXXXXXXXXXXXEEIDPKKRVILFIGDGSLQLTVQEIS 455
            + +FP  T      L                  +   P+  V+L  GD +   +  EI 
Sbjct: 401 ARVSFP--TDAPRHRLDAGTNATMGIGLGYALASKASRPELDVVLIQGDSAFGFSAMEIE 458

Query: 456 TMIRWGLKPYLFILNNDGYTIEKLIHGPK 484
           T +R  L   + ++NN G     + HG K
Sbjct: 459 TAVRCQLALVIVVMNNSG-----IYHGVK 482

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 60/134 (44%), Gaps = 23/134 (17%)

Query: 164 YLGLPANLV------DLNVDAKLLDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVIL 217
           Y+ +P NL+      +  +  K++ +P+  S  P        V+  +  L+ + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 218 ADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKE-AV 276
                   +   E ++ +D  Q P   TPM KG + + HP         L+  + +  A+
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP---------LNVSSARSLAL 256

Query: 277 ESADLILSVGALLS 290
             AD++L +GA L+
Sbjct: 257 RKADVVLLLGARLN 270

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 124/289 (42%), Gaps = 31/289 (10%)

Query: 8   KYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGM 67
           +YL E L    +  VFG+ G   + L D +     +++ G  NE  A+YAA  Y  + G 
Sbjct: 6   EYLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGR 65

Query: 68  -SCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAK-QLLLHHTLGNGDFTVF 125
              ++   G G + AL G+  S +    ++ + G    S +   Q L    L     + +
Sbjct: 66  PGVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNRGGFQELDQIAL----LSKY 121

Query: 126 HRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKLLDTP- 184
            + S+ +S +     D +   A     + T  V+    YL +PAN++D  V+     +  
Sbjct: 122 VKYSSRLSNSN---VDQSFYDALRQAVLGTPGVS----YLDIPANVIDQEVEKNESFSRR 174

Query: 185 --IDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQFPA 242
               +S +P DA  ++     +  L+   ++  IL        +   + +  +D  Q P 
Sbjct: 175 HIAKISYQPTDAALQR-----VAKLLNANRDKNILCVIGKGATENAQQIRPFVDEFQLPF 229

Query: 243 FVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKE-AVESADLILSVGALLS 290
             TPM KG + + H          L+  + +  A++SAD++L +GA L+
Sbjct: 230 LSTPMAKGVVPDSH---------ALNVSSARSLALKSADIVLVLGARLN 269

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 16/94 (17%)

Query: 201 IDTIMALVKDAKNP---VILADACCSRHDVKAETKKLIDLTQFPAFVTPMGKGSIDEQHP 257
           I  + +L+K+ ++    V+L   C +        +  I+   FP   TPM KG + + H 
Sbjct: 193 IAEVTSLIKEHQDKNILVVLGKGCINS---SLALRHFIEEFNFPFLPTPMAKGILPDSH- 248

Query: 258 RYGGVYVGTLSKPAVK-EAVESADLILSVGALLS 290
                    L+  A + +A++SADL+L  GA L+
Sbjct: 249 --------RLNVSAARSQALKSADLVLVFGARLN 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,365,336
Number of extensions: 2235042
Number of successful extensions: 5929
Number of sequences better than 10.0: 135
Number of HSP's gapped: 5762
Number of HSP's successfully gapped: 154
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)