Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_11.3365.706ON1188118856920.0
Smik_11.3605.706ON118094443050.0
YKR096W5.706ON119594042430.0
Suva_11.3335.706ON118793941020.0
ZYRO0B16412g5.706ON137297829190.0
TDEL0B021405.706ON114794129070.0
KNAG0C066305.706ON1281102328360.0
KAFR0H001805.706ON124197627840.0
CAGL0G02541g5.706ON129595927270.0
SAKL0E15004g5.706ON119697826360.0
NCAS0A031705.706ON1319103826270.0
Kpol_1043.735.706ON126096426020.0
Kwal_55.196785.706ON117897725540.0
KLTH0E00968g5.706ON114897325300.0
Suva_9.375.706ON111795925120.0
YIL151C5.706ON111895725060.0
Skud_9.175.706ON111895324800.0
TPHA0E001905.706ON136197924400.0
Smik_9.185.706ON111895624380.0
AFR290W5.706ON121798424370.0
Ecym_40155.706ON125797724150.0
KLLA0A00528g5.706ON122998123350.0
CAGL0H06611g5.706ON128274619030.0
NDAI0E050705.706ON155638413521e-162
TBLA0E017105.706ON152641311671e-136
TPHA0D046405.706ON9629183947e-38
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_11.336
         (1188 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  2197   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1662   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1639   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1584   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1129   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1124   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1097   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1077   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1055   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1019   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1016   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1006   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   988   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   979   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   972   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   969   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   959   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   944   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   943   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   943   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   934   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   904   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   737   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   525   e-162
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   454   e-136
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   156   7e-38

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 2197 bits (5692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1095/1188 (92%), Positives = 1095/1188 (92%)

Query: 1    MPEASVQNPLRLSENGNTRSMFLSASQPQRPPFPMSVRNATTRLDLSNFQVLNPSAKRQN 60
            MPEASVQNPLRLSENGNTRSMFLSASQPQRPPFPMSVRNATTRLDLSNFQVLNPSAKRQN
Sbjct: 1    MPEASVQNPLRLSENGNTRSMFLSASQPQRPPFPMSVRNATTRLDLSNFQVLNPSAKRQN 60

Query: 61   SSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRSLKRE 120
            SSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRSLKRE
Sbjct: 61   SSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRSLKRE 120

Query: 121  NSVEVTGSYPLISKPASQSGKNNAYDKRXXXXXXXXXXXXXXXAFVDAEADGQSNNDIIG 180
            NSVEVTGSYPLISKPASQSGKNNAYDKR               AFVDAEADGQSNNDIIG
Sbjct: 121  NSVEVTGSYPLISKPASQSGKNNAYDKRSSKNLSLLNPSKSSLAFVDAEADGQSNNDIIG 180

Query: 181  NFQHKSNNREHIHDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            NFQHKSNNREHIHDG                                             
Sbjct: 181  NFQHKSNNREHIHDGDNNANNQSYNNSNNNNNNNNNNNNNNNNNNSSNNNNNNNNNNNNN 240

Query: 241  XXXXXXXXXEAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTT 300
                     EAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTT
Sbjct: 241  NINNNDDNNEAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTT 300

Query: 301  ELKSLWTIYRINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITF 360
            ELKSLWTIYRINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITF
Sbjct: 301  ELKSLWTIYRINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITF 360

Query: 361  LDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSS 420
            LDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSS
Sbjct: 361  LDVLKNFSNFMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSS 420

Query: 421  FIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYM 480
            FIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYM
Sbjct: 421  FIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYM 480

Query: 481  QLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI 540
            QLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI
Sbjct: 481  QLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI 540

Query: 541  DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLX 600
            DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYL 
Sbjct: 541  DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLK 600

Query: 601  XXXXXXXXXXXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLR 660
                                   GNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLR
Sbjct: 601  ERKDKKERKKSSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLR 660

Query: 661  RPILPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLK 720
            RPILPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLK
Sbjct: 661  RPILPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLK 720

Query: 721  SNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLA 780
            SNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLA
Sbjct: 721  SNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLA 780

Query: 781  GLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGII 840
            GLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGII
Sbjct: 781  GLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGII 840

Query: 841  FDDKDESGEKFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLE 900
            FDDKDESGEKFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLE
Sbjct: 841  FDDKDESGEKFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLE 900

Query: 901  PLSNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYT 960
            PLSNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYT
Sbjct: 901  PLSNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYT 960

Query: 961  CFDRNGEFLSASLYTRWYLPNGNNISEALVNSDIEKGDEDLFLECMKPDCPGIDFETTYF 1020
            CFDRNGEFLSASLYTRWYLPNGNNISEALVNSDIEKGDEDLFLECMKPDCPGIDFETTYF
Sbjct: 961  CFDRNGEFLSASLYTRWYLPNGNNISEALVNSDIEKGDEDLFLECMKPDCPGIDFETTYF 1020

Query: 1021 VFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQL 1080
            VFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQL
Sbjct: 1021 VFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQL 1080

Query: 1081 YYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTP 1140
            YYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTP
Sbjct: 1081 YYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTP 1140

Query: 1141 RHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
            RHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD
Sbjct: 1141 RHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1662 bits (4305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/944 (84%), Positives = 857/944 (90%), Gaps = 5/944 (0%)

Query: 250  EAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 309
            E +E+DAC+ AN+KRS IALIQKLQELY+VIVKQEIELQERCSQLTNSQTTELKSLWTIY
Sbjct: 237  ERDENDACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIY 296

Query: 310  RINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 369
            +INTEL+NNYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWVYGTITFLDVLKNFSN
Sbjct: 297  KINTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 356

Query: 370  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 429
            FMDPEVCCQFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE
Sbjct: 357  FMDPEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 416

Query: 430  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 489
            HWYTEAMKY YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ
Sbjct: 417  HWYTEAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 476

Query: 490  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFN 549
            RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYF+EKFGIDANGCNIFN
Sbjct: 477  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN 536

Query: 550  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXX 609
             EDMFIQNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPKYL          
Sbjct: 537  CEDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERK 596

Query: 610  XXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLT 669
                          GNSRN N DDDE MSST S+SD D L EFFNDIDTLRRPILPSMLT
Sbjct: 597  KTSNNDSSVTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLT 656

Query: 670  SEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTS 729
            +EAWLETLKFLNMTSLKCGMIVLRKFLHGPLG+ALPH+LPWIYFII+ CLKSNQL+DP S
Sbjct: 657  NEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPIS 716

Query: 730  KDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNES 789
            K+FW++I+KR+FPWDT+VTFMNVLIAYLLDNE  N IIG+LC++Y  LNL+ LL SFNE+
Sbjct: 717  KEFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNEN 776

Query: 790  EELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGE 849
            E+LPEIW CWGTLWFD ICQKN HSISS+DNFQEIGI+DYMALD+PTDGIIFDDKDE+GE
Sbjct: 777  EDLPEIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGE 836

Query: 850  KFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNT 909
            KFWKRACRIIFLFRE+SR+FP+GVIV +DPL+ CSS QS+ ILR+LVYKLEPL+NIRS+ 
Sbjct: 837  KFWKRACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSV 896

Query: 910  PILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFL 969
            P+L+ LE+  DISEARS+ N DL+AVPELSV +GDNIFHY GYKKLRPDYTCFD+NGEFL
Sbjct: 897  PVLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFL 956

Query: 970  SASLYTRWYLPNGNNISEALVNSDIEKGDEDLFLECMK---PDC--PGIDFETTYFVFDA 1024
            SASLYT WY+PN NN  E  ++   E+ +E LFLECMK   P+   P IDF+TTYFVFDA
Sbjct: 957  SASLYTSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDA 1016

Query: 1025 TSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYED 1084
            TSWLRHSARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY ED
Sbjct: 1017 TSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCED 1076

Query: 1085 KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSN 1144
            KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESI KAQEKLENA QP+++    N
Sbjct: 1077 KVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFN 1136

Query: 1145 YVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
            YVVLISDDDTMKKKAEEK+I+TLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1137 YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

 Score =  197 bits (502), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/199 (54%), Positives = 135/199 (67%), Gaps = 5/199 (2%)

Query: 1   MPEASVQNPLRLSENGNTRSMFLSASQPQRPP----FPMSVRNATTRLDLSNFQVLNPSA 56
           MP+ SVQNP+RLSEN NTRS+FLS SQPQRP     FP  V NATTRL+LS+FQVLNPS 
Sbjct: 1   MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60

Query: 57  KRQNSSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRS 116
           KRQNS+SV +DIN SKRRI+ S+F + ED  +DST SE+T   HSR   S ++    K S
Sbjct: 61  KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120

Query: 117 LKRENSVEVTGSYPLISKPASQSGKNNAYDKRXXXXXXX-XXXXXXXXAFVDAEADGQSN 175
           ++ EN VEVT S  L+SKP ++  KN  Y+KR                AFVD E+DGQSN
Sbjct: 121 MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180

Query: 176 NDIIGNFQHKSNNREHIHD 194
           N I+ NFQ +S+N E++ D
Sbjct: 181 NGIVSNFQRESSNSENVCD 199

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1639 bits (4243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/940 (85%), Positives = 855/940 (90%), Gaps = 1/940 (0%)

Query: 250  EAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 309
            E EE+D+C+ A++KRS IALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY
Sbjct: 256  EREENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 315

Query: 310  RINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 369
            +INT+L+NNYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWVYGTITFLDVLKNFSN
Sbjct: 316  KINTDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 375

Query: 370  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 429
            FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE
Sbjct: 376  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 435

Query: 430  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 489
            HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ
Sbjct: 436  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 495

Query: 490  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFN 549
            RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYF+EKFGIDANGCNIFN
Sbjct: 496  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN 555

Query: 550  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXX 609
             EDMF+QNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPKYL          
Sbjct: 556  AEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERK 615

Query: 610  XXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLT 669
                          GNSRNDN DDDEIMSST SISDHD LAEFFNDIDTLRRPILPSMLT
Sbjct: 616  KSSNNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLT 675

Query: 670  SEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTS 729
            +EAWLETLKFLNMTSLKCG+IVLRKFLHGPLGIALPHILPWIYFII+ CLKS+QLSDP S
Sbjct: 676  NEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVS 735

Query: 730  KDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNES 789
            K+FWMIIVKR FPWDT+VTFMNVLI YLLDN+  N IIG+LC  Y  L+L+ LLE FNE 
Sbjct: 736  KEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEG 795

Query: 790  EELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGE 849
            EELPEI  CWGTLWFDTIC+KN HSISS+DNFQEIGIKDYMALD+PTDGIIFD+KDE+GE
Sbjct: 796  EELPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGE 855

Query: 850  KFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNT 909
            KFWKRACR IFLFRELSR+FPIGVI+ NDPLI  SS Q++ IL +LV+KLEPL NI +N 
Sbjct: 856  KFWKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNI 915

Query: 910  PILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFL 969
            P+L ALE+ +DISEARS+NN DL+AVPELSVN GDNIFHY GYKKLR DYTCFD+NGEFL
Sbjct: 916  PVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFL 975

Query: 970  SASLYTRWYLPNGNNIS-EALVNSDIEKGDEDLFLECMKPDCPGIDFETTYFVFDATSWL 1028
            SASLYT WY+PN NN + E  +N + EK +E LFLEC+K D P IDF+TTYFVFDATSWL
Sbjct: 976  SASLYTTWYVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEIDFKTTYFVFDATSWL 1035

Query: 1029 RHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLP 1088
            RHSARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYE+KVLP
Sbjct: 1036 RHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLP 1095

Query: 1089 LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVL 1148
            LRFTGNVATHIEENLEFEEQITWRTHVDEFVIES+ KAQEKLE+A +P ++PR  NYVVL
Sbjct: 1096 LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVL 1155

Query: 1149 ISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
            ISDDD MKKKAEEKEIKTLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1156 ISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

 Score =  205 bits (522), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 115/199 (57%), Positives = 136/199 (68%), Gaps = 5/199 (2%)

Query: 1   MPEASVQNPLRLSENGNTRSMFLSASQPQRPP----FPMSVRNATTRLDLSNFQVLNPSA 56
           MPE SVQNPLRLSEN NTRSMFLSASQ QRP     FP  VRN T  L LS+FQVLNPS+
Sbjct: 1   MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60

Query: 57  KRQNSSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRS 116
           KRQNS+SVY+DINSSKRRI+  RF D+E   ND T  ERT +  S   PSPRY +S KR+
Sbjct: 61  KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120

Query: 117 LKRENSVEVTGSYPLISKPASQSGKNNAYDK-RXXXXXXXXXXXXXXXAFVDAEADGQSN 175
           LKRENSV +T S  LISK  S++G + A++K                 AFVDA +D QS 
Sbjct: 121 LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180

Query: 176 NDIIGNFQHKSNNREHIHD 194
           ++I+G FQ KSNN + I+D
Sbjct: 181 SEIVGGFQRKSNNSQEIND 199

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1584 bits (4102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/939 (82%), Positives = 837/939 (89%)

Query: 250  EAEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 309
            E EE +  R AN+K+SSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY
Sbjct: 249  EQEESNVYRPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIY 308

Query: 310  RINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 369
            RINTEL+NNYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWVYGTITFLDVLKNFSN
Sbjct: 309  RINTELVNNYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSN 368

Query: 370  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 429
            FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE
Sbjct: 369  FMDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAE 428

Query: 430  HWYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 489
            HWYTEAMKY+YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ
Sbjct: 429  HWYTEAMKYVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQ 488

Query: 490  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFN 549
            RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYFVEKFGIDANGCNIFN
Sbjct: 489  RAFVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFN 548

Query: 550  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXX 609
            PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPK+L          
Sbjct: 549  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERK 608

Query: 610  XXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLT 669
                           NSRN+N+D+DEIMSST SIS+ D L EFFNDIDTLRRPI+ SMLT
Sbjct: 609  KSSNNESSITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLT 668

Query: 670  SEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTS 729
            +EAWLE+LKFLNMTSLKCGMIVLRKFLHGPLGIALPH LPWIYFII+ CLKS+QLSDP S
Sbjct: 669  NEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPIS 728

Query: 730  KDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNES 789
            K+FW++IVKR+FPWDT+VTFMN+LIA +LDNE  +PIIG LC +Y  LNLA LL+ F E 
Sbjct: 729  KEFWIVIVKRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEK 788

Query: 790  EELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGE 849
            EELPEIW CWGTLWFDTICQKN +SISSDD+F+E+GIKDYMALD+P DGIIFD  DE+GE
Sbjct: 789  EELPEIWGCWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGE 848

Query: 850  KFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNT 909
            KFWKRACR IFLFRELSR+F IGVI++N+  I  SS QS+ IL NL YKLEPLS + S+ 
Sbjct: 849  KFWKRACRTIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSI 908

Query: 910  PILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFL 969
            P L  LE  +D+ E RS+NNIDL+AVPELSV  G +IF+YTGYKKL P+YTCFD+NGEFL
Sbjct: 909  PTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFL 968

Query: 970  SASLYTRWYLPNGNNISEALVNSDIEKGDEDLFLECMKPDCPGIDFETTYFVFDATSWLR 1029
            SASLYT WY+PNG+N  E  +NS+ EK +E  FLEC+K D   ID  TTYFVFDATSWLR
Sbjct: 969  SASLYTSWYVPNGSNNPETNINSNCEKENEGQFLECLKSDDREIDLNTTYFVFDATSWLR 1028

Query: 1030 HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPL 1089
            HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYE+KVLPL
Sbjct: 1029 HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPL 1088

Query: 1090 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLI 1149
            RFTGNVATHIEENLEFEEQITWRTHVDEFVIESI KAQEKLENA Q  V+    NYV+LI
Sbjct: 1089 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILI 1148

Query: 1150 SDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
            SDDDTMKKKAEEK+IKTLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1149 SDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

 Score =  236 bits (601), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 144/198 (72%), Gaps = 5/198 (2%)

Query: 1   MPEASVQNPLRLSENGNTRSMFLSASQPQRPP----FPMSVRNATTRLDLSNFQVLNPSA 56
           MPE SVQNPLRLSENGN RSMFLSASQPQRP     FPMSV NA  RLDLSNFQVLN SA
Sbjct: 1   MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAA-RLDLSNFQVLNSSA 59

Query: 57  KRQNSSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRS 116
           KRQNS+SV  DINSSKRRI+   FLD+E   N S+ SE+T + +SRP PS RY  SPKR+
Sbjct: 60  KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119

Query: 117 LKRENSVEVTGSYPLISKPASQSGKNNAYDKRXXXXXXXXXXXXXXXAFVDAEADGQSNN 176
           L+RENSVEVT S PLISKPAS +GK+ AYDK                A+V+AE DGQS+N
Sbjct: 120 LQRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLLNMSKSSLAYVEAEPDGQSSN 179

Query: 177 DIIGNFQHKSNNREHIHD 194
           +II NFQHK    + IH+
Sbjct: 180 EIIENFQHKETESDDIHN 197

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/978 (57%), Positives = 695/978 (71%), Gaps = 66/978 (6%)

Query: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321
            SKRSS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+IN++LINNYVT
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381
            F+TTALLPSQ   D+LIG+EIVEIYRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441
            HVF+S+S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 501
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR 649

Query: 502  NSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 561
            N+ LIEYLKHSE MLLPSFLES DLQ VV+ YF  KFG D+N  NIF+   MF QNPD+ 
Sbjct: 650  NTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYL 709

Query: 562  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 621
            +YFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELP++L                      
Sbjct: 710  RYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSS 769

Query: 622  XXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFL 680
                   ++   D + +             FF +I+TLR P  +PS L  E W E+L ++
Sbjct: 770  TMAIDDLEDEQSDRMSTPEG----------FFGNIETLRFPYSVPSNL--EIWNESLNYI 817

Query: 681  NMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRV 740
            NMTSLKC M+VL+KFL GPL +ALPH +PW YFII+   K   L+  +S+ FW+  V R+
Sbjct: 818  NMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRI 877

Query: 741  FPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWG 800
            FPW+TIV+F+NVLIAY+LDN   + ++  LC +Y ++ L  LL+ FN +E LPE+W CWG
Sbjct: 878  FPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWG 937

Query: 801  TLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIF 860
            TLWFDTIC K    +   ++ + +GIK++M LDAP DGI FD  DESGE FWKRACRIIF
Sbjct: 938  TLWFDTICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIF 994

Query: 861  LFRELSRTFPIGVIVSNDPLIKCSSSQSSI--ILRNLVYKLEPLSNIR---------SNT 909
            LF+ L+  FPIG+ +S    + C  +  S   IL++  +KL   S+           S T
Sbjct: 995  LFKGLAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTT 1054

Query: 910  PI-LTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEF 968
             I L  L+N+++I E  S  NI +  +P LSV  G++IF Y GY++L PDY  +D+NGEF
Sbjct: 1055 AIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEF 1114

Query: 969  LSASLYTRWYLPNGNNISEALV--NSDIEKGDE--------DLFLECMKPD-CPGIDFE- 1016
            LSASLYT WY  N  N +  +    SD++   +         +F + M+P  C G   + 
Sbjct: 1115 LSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDL 1174

Query: 1017 -------------TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKD 1063
                         TTYFV D T+WLRH   I+KLA + +LKFAICLTTF ELRFLRK KD
Sbjct: 1175 FLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKD 1234

Query: 1064 ENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESI 1123
            ENV+EAATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE++
Sbjct: 1235 ENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAV 1294

Query: 1124 KKAQEKLENAG-------------QPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTK 1170
             KAQ K +                + H       +VVL++DD  M+KKA++++++T STK
Sbjct: 1295 YKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTK 1354

Query: 1171 FVFSLCTKLGEKRHLCTD 1188
            FVFSLC  +G +  +CT+
Sbjct: 1355 FVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1124 bits (2907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/941 (59%), Positives = 692/941 (73%), Gaps = 40/941 (4%)

Query: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321
            SK+SS AL+QKLQ++YKVIVKQEIELQERCSQLTNSQTTELK LW IY++N++LINNYVT
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381
            FITTALLP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441
            HVF+S+S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKYIY 
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 501
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHR 472

Query: 502  NSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 561
            NS LIEYLKHSE MLLPSFLES DLQ VV+ YF +KFG+D N  NIF+   MF QNPD  
Sbjct: 473  NSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQL 532

Query: 562  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 621
            KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                      
Sbjct: 533  KYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSS 592

Query: 622  XXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPIL--PSMLTSEAWLETLKF 679
                      D++E + S+ S+     + +FF++ID+L  P L  PS+   E W  +LK+
Sbjct: 593  AMA------IDEEEYIDSSFSLGAQ--VQQFFDNIDSLTSPYLFPPSL---EVWNCSLKY 641

Query: 680  LNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKR 739
            LN+TSL C MIVL+KFL GP+ +ALPH+LPW YFIIA   K   ++D  S++FW+ +V R
Sbjct: 642  LNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNR 701

Query: 740  VFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCW 799
            +FPW+TIV F+NVLIAY LDN   +  I  LC +  T+ L  L+E FN +E+LPE+W CW
Sbjct: 702  IFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCW 761

Query: 800  GTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRII 859
            G LWFD IC K+   +   D+++  GIKD+M LD P DGI FD  DESG KFWKRACR+I
Sbjct: 762  GLLWFDAICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVI 818

Query: 860  FLFRELSRTFPIGVIVSNDPLIKCSSSQS-SIILRNLVYKLEPLSNIRSNTPILTALENS 918
            FLF+ ++  F   ++VS+   + C  +   + +L++  +KL   +   SN    + L+N+
Sbjct: 819  FLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRD-TFYNSN----SVLQNT 873

Query: 919  VDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRW- 977
            +++ E  S  N D+   P+LSV   ++IF Y GYK+L  D +C+DR GEF+S SLYT W 
Sbjct: 874  IEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWG 933

Query: 978  YLPNGNNISEALVNSDIEKGDEDLFLECMK----------PDCPGIDFETTYFVFDATSW 1027
               + N I ++         + DLF+E +           P+C  ++ + T+FV DATSW
Sbjct: 934  NETSKNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPEC-KMNGKDTFFVLDATSW 992

Query: 1028 LRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVL 1087
            LRH A ++KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY E+++L
Sbjct: 993  LRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRIL 1052

Query: 1088 PLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVV 1147
            PLRFTGNVATHIEE+LEFEEQITWR+HVDEFV E+IKKAQ +L          R  ++VV
Sbjct: 1053 PLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQEN------RDFHHVV 1106

Query: 1148 LISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
            L++DD  M++KA++  I TLST+FVF+ C  +G +  +CT+
Sbjct: 1107 LVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/1023 (55%), Positives = 699/1023 (68%), Gaps = 99/1023 (9%)

Query: 251  AEEDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYR 310
            A++ DA  ++ +++SS AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+
Sbjct: 273  ADQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYK 332

Query: 311  INTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNF 370
            INT+LINNY TFITTALLPSQP  D+LIG+EIVEIYRIERRLWVYGTITFLDVLKNFSNF
Sbjct: 333  INTDLINNYTTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNF 392

Query: 371  MDPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEH 430
            MDPEVC QFITHVF+SLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEH
Sbjct: 393  MDPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEH 452

Query: 431  WYTEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQR 490
            WY EAMK+ Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR
Sbjct: 453  WYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQR 512

Query: 491  AFVERN-NGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFN 549
             FV+RN  GN RN  LI+YLKHSE MLLPSFL S DLQ VV++YF ++FGID +  NIF+
Sbjct: 513  TFVDRNTGGNYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFD 572

Query: 550  PEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXX 609
             +DMF Q P   ++FFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPKYL          
Sbjct: 573  TQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKN 632

Query: 610  XXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLA-----EFFNDIDTLRRPI- 663
                            + +D   D+    +  +  DH+  A     E+ ++I+TL+  I 
Sbjct: 633  KSKSTSTADVSSTAPKTVDDQATDN---VNEGTNDDHELTATLSGPEYLDNIETLKYAIE 689

Query: 664  LPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQ 723
             P + T   W+++L F+NMTSLKC MIVL+KFLHGPL IALPH LPW  FIIA  +K N+
Sbjct: 690  TPDICT---WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNE 746

Query: 724  LSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLL 783
            L +  +  FW I++KR+FPWDTI +F+NVL+AY+LDN     II ELC +Y  ++L  +L
Sbjct: 747  LENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDML 806

Query: 784  ESFNESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDD 843
              FN+SE+LPE+W CWGTLW+D IC KN+      D F   GI D+M LD P DGI FD 
Sbjct: 807  AHFNKSEDLPEVWKCWGTLWYDAICNKNS---VDADTFAGFGIGDHMFLDFPIDGIEFDA 863

Query: 844  KDESGEKFWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSS-IILRNLVYKLEPL 902
            +DE+G KFWKRA R+IFLF+ +S+ F  G+ +S++  + C + +++   LR   +KLE  
Sbjct: 864  EDETGAKFWKRALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESY 923

Query: 903  SNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCF 962
                 + P  +     + + E  S  N D  A P LSV  G+NIF Y GY+ L  D   F
Sbjct: 924  -----DEPTSSKFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSF 978

Query: 963  DRNGEFLSASLYTRWYL--------------------------PNGNNISEAL------- 989
            D+NGE +S+S+YT W +                           NG  IS +L       
Sbjct: 979  DKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTT 1038

Query: 990  ---VNSDIEKG--DEDLFLECMKPDCP--------------------------GIDFETT 1018
               V  D + G  + DLF + M    P                           +D   T
Sbjct: 1039 TSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKT 1098

Query: 1019 YFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIR 1078
            +F+FDATSWLRH A I+K+A N +LKF +CLTTFQELRFLRKSKDENV+EAA R IIT+R
Sbjct: 1099 FFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMR 1158

Query: 1079 QLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQ--- 1135
            QLY E+++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++ KAQ+K   AG+   
Sbjct: 1159 QLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQ 1218

Query: 1136 -------PHVTP---RHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHL 1185
                   P   P   +  +YV L+++D  MK+KA+++ IKT ST FVFSLC+KLG    L
Sbjct: 1219 PEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDL 1278

Query: 1186 CTD 1188
            CT+
Sbjct: 1279 CTN 1281

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1077 bits (2784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/976 (55%), Positives = 689/976 (70%), Gaps = 60/976 (6%)

Query: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321
            +K++S  LI+KLQ +YK+IVKQE+ELQ+RCSQLT SQTTELK+LW+IY++NT+LINNY+T
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381
            FITTALLPSQ L D+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441
            HVF+SLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNL 500
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516

Query: 501  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDF 560
            RNS LI+YLKHSE MLLPSFLE+ DLQ VV++YF ++FG+D N  NIF  +DMF Q P  
Sbjct: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576

Query: 561  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXX 620
             +++FRHAP+FA+SHILQ+VGFG PKNPFA+LF+LP +L                     
Sbjct: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTM 636

Query: 621  XXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKF 679
                 S + N+    I++++A +++ + + E+F++ID+LR PI  P++L    WL++L+ 
Sbjct: 637  -----SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL---VWLKSLEH 688

Query: 680  LNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKR 739
            LNMTSLKC +IVLRKFL GPL IALPH+LPW YFIIAT LK+    + +S  FW I+++R
Sbjct: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748

Query: 740  VFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTL-NLAGLLESFNESEELPEIWNC 798
            + PW+T+ +F+NVL+AY+LDN      I +LC  Y    N   LL+ FN +E LPEIW C
Sbjct: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKC 808

Query: 799  WGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRI 858
            WGTLWFD I  K A +    D F  +GI+D+M LD P DGI FD+ DE+GE FW RA RI
Sbjct: 809  WGTLWFDVISNKRALNA---DTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRI 865

Query: 859  IFLFRELSRTFPIGVIVSNDPLIKCSSS--QSSIILRNLVYKLEPLSNIRSNTPILTALE 916
            +FLF+ ++     G+ VS    + C       + IL++  +K+E       +    + + 
Sbjct: 866  VFLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTIN 925

Query: 917  NSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTR 976
              + + E   + N+D  A P LSV  G+NIF Y GYKKL  +   FDRNGE +S+S+YT 
Sbjct: 926  KLLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTA 985

Query: 977  WYLPNGNNISEALVN----------------------------SDIEKGDEDLFLEC-MK 1007
            W + N N+++ +  N                            +  E  ++D   E  M 
Sbjct: 986  WVIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMN 1045

Query: 1008 PDCPG---------------IDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTF 1052
            P+                  I+   TYFVFDATSWLRH A I+KL+ N +L FA+CLTTF
Sbjct: 1046 PEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTF 1105

Query: 1053 QELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWR 1112
            QELRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR
Sbjct: 1106 QELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWR 1165

Query: 1113 THVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFV 1172
            +HVDEFVIE++ KAQ K  +A +     +  N+VVL++DD  MK+KA+E+ IKT +T F+
Sbjct: 1166 SHVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFI 1225

Query: 1173 FSLCTKLGEKRHLCTD 1188
            FS+C KLG + ++CT+
Sbjct: 1226 FSVCRKLGIQDNVCTN 1241

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1055 bits (2727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/959 (54%), Positives = 697/959 (72%), Gaps = 50/959 (5%)

Query: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317
            ++ NS + + AL+QKLQ++YK IV+QE+ELQE+C+QLT+SQTT+L S+W+IYRIN EL+ 
Sbjct: 359  KANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVT 418

Query: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377
            NYVTFI+TALL SQ  +DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC 
Sbjct: 419  NYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCS 478

Query: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437
            QFITHVF+S+STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A+K
Sbjct: 479  QFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALK 538

Query: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497
            Y Y +GKLYYHMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER +
Sbjct: 539  YTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGS 598

Query: 498  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQN 557
             N RNS LIEYLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF P D+F+QN
Sbjct: 599  NNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQN 658

Query: 558  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXX 617
            P+  KYFFRHAP+FA+SHILQ VGFG+ KNPFA+LF+LPK+L                  
Sbjct: 659  PENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTK----- 713

Query: 618  XXXXXXGNSRNDNNDDDEIMS----STASISDHDFLAEFFNDIDTLRRPILPSMLTSEAW 673
                    S  +   ++ +MS    ST S+   D   ++F+++++++ P LP     + W
Sbjct: 714  --------SSGEPTSNESVMSLDNISTDSLISSD---QYFSNLESMQHPYLPPP-RYDIW 761

Query: 674  LETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFW 733
            L++L +LN+T+++CG+IVLRKFLHGP  +ALPH++ W YFII+ CLKS  L D  S+ FW
Sbjct: 762  LKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFW 821

Query: 734  MIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELP 793
               ++R+ P ++IV+F+NVLIAY LDN   + +I  +  +  +++L  LL  FN +EELP
Sbjct: 822  SSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELP 881

Query: 794  EIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWK 853
            E+W CWGTLWFD I  K   S +  +++++IG+ D++  D+P DGI+FD KDE+GEKFWK
Sbjct: 882  EVWKCWGTLWFDAITDK---SNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWK 938

Query: 854  RACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSI--ILRNLVYKLEPLSNIRSNTPI 911
            RA RIIFLF++++ TF IG+ +S+   + C      +  IL +  +K+E   ++ +   +
Sbjct: 939  RALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIE--QHLLNGNTV 996

Query: 912  LTALENS----VDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGE 967
               +EN     ++++E  ++ NI + A P +S+   +NIF YTGYK++ P+   FD+NGE
Sbjct: 997  QVEIENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGE 1056

Query: 968  FLSASLYTRWY-----LPN----------GNNISEALVNSDIEKGDEDLFL---ECMKPD 1009
              SA+ YT WY     +P           G++   +  + D+E+    +F    E     
Sbjct: 1057 LRSAANYTSWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSL 1116

Query: 1010 CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEA 1069
              G++ ETT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRKSKDENVMEA
Sbjct: 1117 LDGLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEA 1176

Query: 1070 ATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEK 1129
            A R II IRQLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVIESI KAQ+K
Sbjct: 1177 AARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKK 1236

Query: 1130 LENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
                   +     S + VL+SDD+ MK+KA EKEI+T +T+FVF+LC+++G+ R +CT+
Sbjct: 1237 FLQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/978 (53%), Positives = 676/978 (69%), Gaps = 77/978 (7%)

Query: 263  KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322
            K +S AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT++K+LW IY++N ELINNY++F
Sbjct: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299

Query: 323  ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382
            ITTALLPSQP  DLLIGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359

Query: 383  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ Y Y H
Sbjct: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419

Query: 443  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 502
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479

Query: 503  SLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 562
              ++EYLKHSE MLLPSFLESP+LQ VV+++F ++FG+  N  + F+ + +FIQ+ +  +
Sbjct: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539

Query: 563  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXX 622
            YFF HAP+FA+SHILQ+VGFG+P+NPFAILFELPK+L                       
Sbjct: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD 599

Query: 623  XGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLN 681
             GN            SS+ S+ DH     +F +ID+ R P   P  +  + W ++L +LN
Sbjct: 600  DGNG-----------SSSISV-DH-----YFENIDSHRVPYSFPQDI--QIWQQSLSYLN 640

Query: 682  MTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVF 741
            +TS++C M VL+KFLH PL  ALPH+LPW +F+++  ++ + LS    K FW++ ++R+F
Sbjct: 641  LTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIF 700

Query: 742  PWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGT 801
            PW+++V+F+N L+A+LLDN      + +LC +Y  ++L  L+E F  SEELPE+W CWGT
Sbjct: 701  PWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGT 760

Query: 802  LWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFL 861
            LWFDTI  K+    SS    Q  GI+D++ LDAP DGI FD  DESG KFWKRACR+IF+
Sbjct: 761  LWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFM 817

Query: 862  FRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSVDI 921
            F+ +++ F  G+ VS+ P+       +   L+   +K E L     N   L + +N + +
Sbjct: 818  FKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKV 876

Query: 922  SEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT-----R 976
             E  S  N +  AVP LS+  G++IF + GY+++ PDY CF++NG+ ++ SLYT     R
Sbjct: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936

Query: 977  WYLPNG----------NNISEALVNSD-----------IEKGDEDLFLECMKPD------ 1009
              +  G          N +  A  NS            +E  +      CM P       
Sbjct: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996

Query: 1010 ---------CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1060
                         D   TYFV DATSWLRH A ++KLA N +LKFAICLTTFQELRFLRK
Sbjct: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056

Query: 1061 SKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1120
            SKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFVI
Sbjct: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116

Query: 1121 ESIKKAQEKLE-------NAGQPHV--TPRHS---NYVVLISDDDTMKKKAEEKEIKTLS 1168
            E++ K+Q K +       + GQ ++   P+     N+VVL++DD  M+ KAE  +I   S
Sbjct: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFS 1176

Query: 1169 TKFVFSLCTKLGEKRHLC 1186
            ++F+F+ C +LG  + +C
Sbjct: 1177 SRFMFAFCNQLGYNQKVC 1194

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/1038 (54%), Positives = 685/1038 (65%), Gaps = 124/1038 (11%)

Query: 263  KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322
            K++  AL++KLQ++YKVIVKQEIELQERCSQLT SQTT+LK+LWTIY++N +LINNYVTF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 323  ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382
            ITTALL SQ   DL IG+EI+EIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 383  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442
            VF+SLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+ YNH
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 443  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 502
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 503  SLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI-------------------DAN 543
              LIEYLKHSE MLLP+FLE+ +LQ VV+ YF EKFGI                   +  
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 544  GCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXX-- 601
              ++F   DMFIQNP+  KYFFRHAP+FA+SHILQ+VGFG+PKNPFA+LFELPKYL    
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 602  ---------XXXXXXXXXXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEF 652
                                            NS    +D + + S   ++ +     EF
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSD--NVMNQVTSEEF 711

Query: 653  FNDIDTLRRP-ILPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWI 711
            F +I+ LR    +P+ L  E W+ +L  +N+ SLKC MIVL+KFLHGPL IALPH+LPW 
Sbjct: 712  FQNIEQLRFDYFIPNSL--EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 712  YFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEAL-------- 763
            YFII+  LK   L+   SK FW+ I+K +FPW+ I+ F+NVL+ Y LDN  L        
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 764  ------NPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISS 817
                  N  I +LC+KY T+  A LL+ FNE+E+LPE+W CWGTLWFDTI  KN      
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDA-- 887

Query: 818  DDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSRTF-PIGVIVS 876
             D+F+ +GIKD+M LD P DGI +  +DE+GE FWKR  RIIFLF+ ++  F  +G+ VS
Sbjct: 888  -DSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVS 946

Query: 877  ----------NDPL--------IKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENS 918
                      N P+         K + S +  +  NL  +LE    I +NT I+  +   
Sbjct: 947  YNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELE----IYTNT-IINRITEF 1001

Query: 919  VDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWY 978
            VDI E   + N++    P  S+ + ++IF YTGYKKL P+   FD+NGEF S S+YT W 
Sbjct: 1002 VDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWP 1061

Query: 979  LPNGNNISEALVNSDIEKGDE--DLFLECMKPD-----------------------CPGI 1013
            +     I     N++    DE  DLF   +  D                           
Sbjct: 1062 MDYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPF 1121

Query: 1014 DFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRG 1073
            +   TYFVFDATSWLRH A I+KLA N +LKFA+CLTTFQELRFLRKSKD NV+EA+TR 
Sbjct: 1122 NRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRA 1181

Query: 1074 IITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKL--- 1130
            IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++ KAQEK    
Sbjct: 1182 IITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKS 1241

Query: 1131 ---------ENAGQPHVTP--------RHSN---YVVLISDDDTMKKKAEEKEIKTLSTK 1170
                      N G+   T           SN   YVVLI+DDD+M+ KA+ K I T  T+
Sbjct: 1242 KTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQ 1301

Query: 1171 FVFSLCTKLGEKRHLCTD 1188
             VFS+C+ +G    +CT+
Sbjct: 1302 VVFSVCSMMGIDEGVCTN 1319

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/964 (53%), Positives = 666/964 (69%), Gaps = 75/964 (7%)

Query: 263  KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322
            ++SS AL+QKLQ++YK+I+KQE+ELQERCSQLTNSQTTE+K+LW IY++N +LINNYVTF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 323  ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382
            ITTAL PSQ   DLLIG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 383  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442
            VF+S+S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 443  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 501
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 502  N-SLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNI--FNPEDMFIQNP 558
            N  LL++YLKHSE MLLP+F+ESPDLQ VV+ YF+EKFGID N  N+  F P  MFIQN 
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 559  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXX 618
            D  K++FRHA +FA++ ILQ+VG+G PKNPFA+LF LPKYL                   
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK-------- 663

Query: 619  XXXXXGNSRNDNNDDDEIMSSTASISDHDFLA-----------EFFNDIDTLR-RPILPS 666
                    +N    +D   ++ +S+S  +++            +FFN+ID L     +P+
Sbjct: 664  -------PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPN 716

Query: 667  MLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSD 726
             ++   W ++LK+ N T+ KC MIVL+KFL+GPL +ALPHILPW+YF+I+  L+  +  D
Sbjct: 717  SIS--LWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQD 774

Query: 727  PTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESF 786
                +FW   +KR+FPW+++V F+NVL+AY++DN   N  + ELC +YG+LNL  LL +F
Sbjct: 775  TAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNF 834

Query: 787  NESEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDE 846
            N +E+LPE+W C G+LWFD I +K   +  + D++ E GIKDY  LD P DGI FD+ DE
Sbjct: 835  NANEDLPEVWKCRGSLWFDIIDEK--RNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDE 892

Query: 847  SGEKFWKRACRIIFLFRELSRTF-PIG--VIVSNDPLIKCSSSQSSIILRNLVYKLEPLS 903
             G KFWKR+ R+IFLFR +   F   G   I  N P+I       +  L    +KL   S
Sbjct: 893  IGIKFWKRSVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKS 952

Query: 904  NIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFD 963
            +      +L +    +D       NN D  A+P LS+  G+NIF Y GYK++  DY  FD
Sbjct: 953  DDIMFDDMLVSNFEEID------SNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFD 1006

Query: 964  RNGEFLSASLYTRWYL-----PNGNNISEALVNSDIEKGD----EDLFLECMKPDCPGID 1014
            +NG+ +S S Y  W +      NG  +S    +S+    D    ++LF +C  P+   +D
Sbjct: 1007 KNGDLISTSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVD 1066

Query: 1015 -------------------FETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQEL 1055
                               +E TYF+ DATSWLRH A ++K+A N +LKF+ICLTTFQEL
Sbjct: 1067 EFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQEL 1126

Query: 1056 RFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHV 1115
            RFLRKSKDENV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HV
Sbjct: 1127 RFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHV 1186

Query: 1116 DEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSL 1175
            DEFVIE++ KA+ K +     ++       +VL++DD  MK KA EK  KT ST+FVF++
Sbjct: 1187 DEFVIEAVIKAETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAI 1243

Query: 1176 CTKL 1179
               L
Sbjct: 1244 SNYL 1247

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/977 (51%), Positives = 657/977 (67%), Gaps = 79/977 (8%)

Query: 259  SANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINN 318
            S +S  +S AL+QKLQ++Y+ IVKQE+ELQERC+QLT SQTT+LK+LW IY+IN ELINN
Sbjct: 234  SPSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINN 293

Query: 319  YVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 378
            YV FITTALLPSQP  DLLIGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQ
Sbjct: 294  YVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQ 353

Query: 379  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 438
            FITHVF+S+STM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ +
Sbjct: 354  FITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSH 413

Query: 439  IYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 498
            I+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ERN G
Sbjct: 414  IFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGG 473

Query: 499  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNP 558
            N RNSL++EYLKHSE MLL SFLESP+LQ VV+S+F  KFG+  +  + FNP DMF+Q+ 
Sbjct: 474  NHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDG 533

Query: 559  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXX 618
            +  KYFFRHAP+FA+SHILQ VGFG+PKNPFA+LFELPK+L                   
Sbjct: 534  ERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSF- 592

Query: 619  XXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETL 677
                                ++   + H   +E+  ++D+ R     P  L    W E+L
Sbjct: 593  --------------------TSIETTSHLSPSEYLENVDSPRYAYEFPEDLA--IWRESL 630

Query: 678  KFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIV 737
              +N+TS +C  IV +KFL GPL +A+ H+LPW YF+++  LK + L     K FW+ +V
Sbjct: 631  SHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLV 690

Query: 738  KRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWN 797
            +++FPW++IV F+N+L+A++LDN      I  LC +  +++   L+E F+E E+LPEIW 
Sbjct: 691  RQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWR 750

Query: 798  CWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACR 857
            CWG LWFD I  K   S   D +    G KD+   D P DGI FD+ DE GEKFWKRACR
Sbjct: 751  CWGALWFDVIADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACR 807

Query: 858  IIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALEN 917
            +IF+F+ +++ F +G+ +S           +   L+N  +  E    I + + I + + N
Sbjct: 808  LIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE---EIPAQSQIQSFVRN 864

Query: 918  SVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRW 977
             + + E  +  N+D    P  S+  G++IF + GY+++  DYTCF+++G  +S SLYT  
Sbjct: 865  QIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSG 924

Query: 978  YLPNG------------------NNISEALVNSDIEKGDEDLFLECMKPD---------- 1009
             L  G                  +N  E    +++E+ + D    CM P+          
Sbjct: 925  KLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKF 984

Query: 1010 ------CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKD 1063
                  C   D   +YFV DATSWLRH A +FKLA N +L+F ICLTTFQELRFLRKSKD
Sbjct: 985  PFGDLSC-NCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKD 1043

Query: 1064 ENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESI 1123
            E+V+EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++
Sbjct: 1044 ESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAV 1103

Query: 1124 KKAQEKLE-------NAGQPHVT-----PRHSNYVVLISDDDTMKKKAEEKEIKTLSTKF 1171
             KAQ+K E        AG   +      P H  +V L+SDD  M+ KA  + I+T ST+F
Sbjct: 1104 YKAQKKFEAINAQAKEAGHDFIATTDEEPFH--FVALVSDDTNMRVKAHTQRIQTFSTRF 1161

Query: 1172 VFSLCTKLGEKRHLCTD 1188
            +F++C ++G     CT+
Sbjct: 1162 MFAVCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/973 (51%), Positives = 664/973 (68%), Gaps = 77/973 (7%)

Query: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321
            S ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++NTELINNYV 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381
            FITTALLPSQP  DLLIGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFIT
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441
            HVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ +I+ 
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 501
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN R
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446

Query: 502  NSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 561
            NSL++EYLKHSE MLL SFLESP+LQ VV+S+F  KFGI +N  + F+ + +F+Q+ +  
Sbjct: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506

Query: 562  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 621
            KYFFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK+L                      
Sbjct: 507  KYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSM- 565

Query: 622  XXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFL 680
                         E  S T+ I       E+   +D+ R     P+ L    W ++L  +
Sbjct: 566  -------------EAPSPTSPI-------EYLESVDSPRFVYEFPTDLA--IWQQSLSHI 603

Query: 681  NMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRV 740
            N TS+KC  +VL+KFLHGPL  A  H+LPW YF+++  ++ ++L  P  KDFW+ + ++V
Sbjct: 604  NTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQV 663

Query: 741  FPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWG 800
            FPW++IV F+N++IA+ LDN      I  LC ++ ++++  L++ F+++E+LPE+W CWG
Sbjct: 664  FPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWG 723

Query: 801  TLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIF 860
             LWFD I  K   S   D+      ++D+M  D P DGI FD+ DE+G +FWKRACR++F
Sbjct: 724  ALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780

Query: 861  LFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLE-PLSNIRSNTPILTALENSV 919
            +F+ +++ F +G+ +++ PL    S  +   L+N  +K E P  +  S   I T +    
Sbjct: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE 840

Query: 920  DISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYL 979
            +ISE     N+D  A P  S+  G ++F   GY++L  D+TCF++ G  ++ SLYT   L
Sbjct: 841  NISE----RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSL 896

Query: 980  PNGN-------NISEALVNSDIEKGD----------EDLFLE-CMKPD------------ 1009
              G        N      + ++ K D          E ++L+ CM P+            
Sbjct: 897  EKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPF 956

Query: 1010 ----CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1065
                C   D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRKSKDE+
Sbjct: 957  GDLSC-NCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDES 1015

Query: 1066 VMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKK 1125
            V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ K
Sbjct: 1016 VVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1075

Query: 1126 AQEKLE-------NAGQ---PHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSL 1175
            AQ K E         G    P       +++ L+SDD  M+ KA  + I+T S++F+F++
Sbjct: 1076 AQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAV 1135

Query: 1176 CTKLGEKRHLCTD 1188
            C ++G   H CT+
Sbjct: 1136 CNQIGLAHHACTN 1148

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/959 (51%), Positives = 657/959 (68%), Gaps = 64/959 (6%)

Query: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317
            R   S + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IY++NTELI 
Sbjct: 195  RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIK 254

Query: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377
            NY+ FI TALL +QP++DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCC
Sbjct: 255  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCC 314

Query: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437
            QFIT+ F+ +S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 315  QFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 374

Query: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497
            YIY  GKLYYH++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++
Sbjct: 375  YIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSS 434

Query: 498  GNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550
            GN        RNS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF +KFG D NG ++F+ 
Sbjct: 435  GNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFST 494

Query: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXX 610
            +DMF QNP+  +Y+FRHAP+FA+S ILQ++GFG PKNPFA+LF+LPK+L           
Sbjct: 495  KDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKK 554

Query: 611  XXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670
                                    EI        D      +F +IDTL           
Sbjct: 555  SGAA--------------------EIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNI 594

Query: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730
              WL++L ++NMTS++C + VL KFLH PL +ALPH L W++FIIA   K   ++     
Sbjct: 595  GIWLDSLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVT 654

Query: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790
             FW+  ++R  PW+++VTF NVL+ Y+LDN  L+P + +   K+ +L L  L+E FNE+E
Sbjct: 655  AFWIHFLRRTMPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNENE 712

Query: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850
             LPE+W CWG+LWFD + + +   I         G++D++  D+P DGI+FD KDE GEK
Sbjct: 713  NLPEVWKCWGSLWFDAVKKCDVMEIP--------GVQDHLFFDSPLDGIVFDKKDEIGEK 764

Query: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQSS--IILRNLVYKLEPL-SNIR 906
            FW R+ R I   + +++ FP +G+ V+    + C  +  S    L+NL +KL+P   +  
Sbjct: 765  FWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAF 824

Query: 907  SNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNG 966
            ++   L  L ++++I+E     NIDL A P+LSV SG++IF YTGY +L  DY CFD+NG
Sbjct: 825  NDNNELDELYDTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNG 884

Query: 967  EFLSASLYTRWY-LPNGNNI---SEALVNS---DIEKGDEDLFLECMKPDCPGIDFE--- 1016
             F SA +YT+W  + NG  +   SE+L +S   D+      +  + +       D +   
Sbjct: 885  GFNSAFIYTQWSNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSC 944

Query: 1017 TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1076
            + YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 945  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1004

Query: 1077 IRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLE----- 1131
            IRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  +     
Sbjct: 1005 IRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTI 1064

Query: 1132 --NAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
              N G      R   + VL++DDD M +KA++K IKT +TK++FSL +KLG    LCT+
Sbjct: 1065 DKNKG------RSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/957 (51%), Positives = 659/957 (68%), Gaps = 60/957 (6%)

Query: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317
            R   S + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTELI 
Sbjct: 196  RQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIK 255

Query: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377
            NY+ FI TALL +QP++DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCC
Sbjct: 256  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCC 315

Query: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437
            QFI + F+S+S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 316  QFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 375

Query: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497
            YIY  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++
Sbjct: 376  YIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSS 435

Query: 498  GNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550
            G+        RNS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF +KFG D NG ++F+ 
Sbjct: 436  GSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDT 495

Query: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXX 610
            +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPKYL           
Sbjct: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKR 555

Query: 611  XXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670
                           + +  +  D  +SS +   + D L   FNDI T            
Sbjct: 556  SEAT----------ETSSYTDPFDVQISSESYFQNIDALNSSFNDIPT----------NL 595

Query: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730
              WL++L  +NMTS++C + VL KFLH PL +ALPH L W++FI+A   K   ++     
Sbjct: 596  NIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVV 655

Query: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790
             FW+  ++R  PW++IVT  NVL+ Y+LDN  L+P + +   K+ +L L  L+E +NE+E
Sbjct: 656  AFWIHFLRRTMPWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENE 713

Query: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850
             LPEIW CWGTLWFD I + +   I         G++D++  D+P DGI+FD+KDE GEK
Sbjct: 714  NLPEIWKCWGTLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEVGEK 765

Query: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEPL--SNI 905
            FW R+ R + L + +++ FP +G+ VS    + C  +       L+NL +KL+     N 
Sbjct: 766  FWMRSVRAVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNY 825

Query: 906  RSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRN 965
              N   L  L ++++I+E     N+D  A P LSV SG++IF YTGY +L PDY CFD+N
Sbjct: 826  NDNNE-LDDLYDTIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKN 884

Query: 966  GEFLSASLYTRWY-LPNGNNISEA------LVNSDIEKGDEDLFLECMKPDCPGIDFE-- 1016
            G F SA +Y++W  + NG  +  +      + N+++    E +F + +     G D    
Sbjct: 885  GGFNSAFIYSQWSNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYN 944

Query: 1017 -TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGII 1075
             T YFV DATSWLRH A IFKLA+N  LKFAICLTTFQELR+LR SKD+ V+EAATR +I
Sbjct: 945  CTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVI 1004

Query: 1076 TIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQ 1135
            TIRQLY E K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++ +    
Sbjct: 1005 TIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQ---A 1061

Query: 1136 PHVTPRHSN----YVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
              +T  + N    + VL++DDD M +KA+++ IKT +TK++FSL +KLG    LCT+
Sbjct: 1062 ERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/953 (51%), Positives = 657/953 (68%), Gaps = 52/953 (5%)

Query: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317
            R   S + +   I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYR+NTELI 
Sbjct: 196  RQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIK 255

Query: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377
            NY+ FI TALL +QP++DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCC
Sbjct: 256  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCC 315

Query: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437
            QFI + F+S+S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 316  QFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 375

Query: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497
            YIY  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++
Sbjct: 376  YIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSS 435

Query: 498  GNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550
                      RNS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF +KFG D NG +IF+ 
Sbjct: 436  AGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDT 495

Query: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXX 610
            +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPKYL           
Sbjct: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKK 555

Query: 611  XXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670
                                  DD+I SS +   + D L   F+DI        P+ L  
Sbjct: 556  SGATEVPQYRDPF---------DDQI-SSESYFQNIDSLTSNFDDI--------PTNLN- 596

Query: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730
              WL++L  +NMTS++C + VL KFLH PL +ALPH L W++FI+A   K   ++     
Sbjct: 597  -IWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVS 655

Query: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790
             FW+  ++R  PW+++V   NVL+ Y+LDN  ++P +     ++ +L L  L+E FNE+E
Sbjct: 656  GFWIHFLRRTMPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENE 713

Query: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850
             LPEIW CWG+LWFD I + +   I         G++D++  D+P DGI+FD+KDE GE+
Sbjct: 714  NLPEIWKCWGSLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGER 765

Query: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQSS--IILRNLVYKLEPL-SNIR 906
            FW R+ R I + + +++ FP +G+ V+    + C  +  S    L+N  +KL+    N  
Sbjct: 766  FWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDH 825

Query: 907  SNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNG 966
            ++   L  L ++++I+E   + N DL A P LSV SG+NIF YTGY +L PDY CFD+NG
Sbjct: 826  NDNNELDELYDTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNG 885

Query: 967  EFLSASLYTRWY-LPNGNNI---SEAL---VNSDIEKGDEDLFLECMKPDCPGIDFE--- 1016
             F SA +Y++W  + NG  +   SE++    N+++    E +F + +       D     
Sbjct: 886  GFNSAFIYSQWSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNC 945

Query: 1017 TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1076
            + YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 946  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1005

Query: 1077 IRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQP 1136
            IRQLY E K++PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +     
Sbjct: 1006 IRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLI 1065

Query: 1137 HVTPRHSN-YVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
                  +N Y VL++DDD M  KA++K IKT +TK++FSL +K+G    LCT+
Sbjct: 1066 DKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/979 (49%), Positives = 661/979 (67%), Gaps = 76/979 (7%)

Query: 263  KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322
            ++SS  L+QKLQ++YK IVKQEIELQERC +LTNSQTTELK+LWTIYR+N+EL++NY+TF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 323  ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382
            ITTA+ P+QP  D  IG+EI+EIY+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 383  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442
            VF+S+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++ Y H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 443  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 500
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 501  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGC--NIFNPEDMFIQNP 558
             + LL++Y+KH E  LLP+F ES +LQ VV+ YF++KFG+D N    N+F    MF+QN 
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 559  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXX 618
            D FK F+R++ +FA+S ILQIVG+G  K+PF++LFELPKYL                   
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 619  XXXXXGNSRNDNNDDDEIMSSTASISDHD-FLA--EFFNDIDTLRRP-ILPSMLTSEAWL 674
                    R        + ++  ++ +++ FL   EFF +IDT+  P  +P+  + + W 
Sbjct: 738  ITQPRLYHR-------WVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPN--SVDIWN 788

Query: 675  ETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWM 734
             +L++ N  S+KC MIV +KFLH P  IALPH LPW YFII+  L+ ++  +    +FW+
Sbjct: 789  HSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWV 848

Query: 735  IIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPE 794
              V+R+FPW++IV F+NVL+AY++DN     I+ ELC  Y +++L  LL  FNE+EELPE
Sbjct: 849  EFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPE 908

Query: 795  IWNCWGTLWFDTICQ-------KNAHSISSDD----NFQEIGIKDYMALDAPTDGIIFDD 843
            +W C G+LWFDTI +       KN   I+  D    +++  G+KDY   D P DG  FD+
Sbjct: 909  VWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDE 968

Query: 844  KDESGEKFWKRACRIIFLFRELSRTFP--IGVIVSNDPLIKCSSSQSSIILRNLVYKLEP 901
             DE GE+FWKRA R+IFLF++L+ ++    G+I+S +  +  +  +    +  +  +L  
Sbjct: 969  SDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPV-FNRRKDEYKVNTVCQELLE 1027

Query: 902  LSNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTC 961
             S   + +     L++ ++  E   + N D +  P LS+  GD+IF Y GYK++ P++  
Sbjct: 1028 FSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYS 1087

Query: 962  FDRNGEFLSASLYTRWYLPN----------------------GNNISEALVNSDIEKGDE 999
            FD+NG+F+S S +  W + N                      GN+ + A  N+D    + 
Sbjct: 1088 FDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNND-PMNEL 1146

Query: 1000 DLFLECMKPDCPGI----------DFET-------TYFVFDATSWLRHSARIFKLAQNRL 1042
             +F EC  P    +          D +T       TYF+ DATSWLRH A I+K+A +++
Sbjct: 1147 LVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATSKI 1206

Query: 1043 LKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEEN 1102
            LKFAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY+E+ +LPLRFTGNVATHIEE+
Sbjct: 1207 LKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEH 1266

Query: 1103 LEFEEQITWRTHVDEFVIESIKKAQEK----LENAGQPHVTPRHSNY-VVLISDDDTMKK 1157
            LEFEEQITWR+HVDEFVIE++ KA+EK    L +          S + ++L++DD TMK 
Sbjct: 1267 LEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDITMKN 1326

Query: 1158 KAEEKEIKTLSTKFVFSLC 1176
            KA +++IKT ST+F+FS+ 
Sbjct: 1327 KAMDRKIKTFSTRFIFSMA 1345

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/956 (50%), Positives = 641/956 (67%), Gaps = 54/956 (5%)

Query: 256  ACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTEL 315
              R   S + +   I+KLQE+YK+IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL
Sbjct: 194  VVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTEL 253

Query: 316  INNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 375
            I NY+ FI TALL +QP++DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEV
Sbjct: 254  IKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEV 313

Query: 376  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 435
            CCQFI + F+S+S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+
Sbjct: 314  CCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTES 373

Query: 436  MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 495
            MKYIY  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R
Sbjct: 374  MKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDR 433

Query: 496  -------NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIF 548
                   N    +NS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF  KFG D NG ++F
Sbjct: 434  GSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVF 493

Query: 549  NPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXX 608
            + +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LPKYL         
Sbjct: 494  DTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREK 553

Query: 609  XXXXXXXXXXXXXXXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSML 668
                            + +          S  +   + D L+  F+DI T          
Sbjct: 554  KRSSATETPQYRDPFHDKK----------SPESYFQNIDALSSNFDDIPT---------- 593

Query: 669  TSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPT 728
                WLE+L  +NMTS++C + VL KFLH P  IALPH L W+YF++A   +   ++   
Sbjct: 594  NLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQ 653

Query: 729  SKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNE 788
               FW+  ++R  PW+++V+  NVL+ Y+LDN  L+P + +    + +  L  L+E FNE
Sbjct: 654  VIAFWIHFLRRTMPWNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNE 711

Query: 789  SEELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESG 848
            +E LPEIW CWG+LWFD I + +   I         G++D++  D+P DGI+FD+KDE G
Sbjct: 712  NENLPEIWKCWGSLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIG 763

Query: 849  EKFWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEPL-SN 904
            E+FW R+ R I L + +++ FP +G+ V+    + C  +       LR   +KL+     
Sbjct: 764  ERFWVRSVRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEG 823

Query: 905  IRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDR 964
              ++   L  L  +++I+E     N+DL A P LSV  G++IF YTGY +L PDY CFD+
Sbjct: 824  NNNDNNELDELYETIEINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDK 883

Query: 965  NGEFLSASLYTRWYLPNGNNISEALVNSDI-EKGDEDLFLECMK----------PDCPGI 1013
            NG F SA +Y++W    GN +   + N  I +  D DL L   K           +C   
Sbjct: 884  NGGFNSAFIYSQWS-NVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDEN 942

Query: 1014 DFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRG 1073
            D  T YFV DATSWLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR 
Sbjct: 943  DNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRS 1002

Query: 1074 IITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENA 1133
            +ITIRQLY E K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  +  +  
Sbjct: 1003 VITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTE 1062

Query: 1134 GQ-PHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188
                    ++  + VL++DDD M KKA++K IKT +TK++FSL +KLG    LCT+
Sbjct: 1063 RMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/984 (50%), Positives = 656/984 (66%), Gaps = 95/984 (9%)

Query: 259  SANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINN 318
            +  +K+SS AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IY++N ELI+N
Sbjct: 275  AVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDN 334

Query: 319  YVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 378
            Y  FITTALLP+QP  DLLIG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ
Sbjct: 335  YFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 394

Query: 379  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 438
            FI +VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY
Sbjct: 395  FIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKY 454

Query: 439  IYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 498
             + HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G
Sbjct: 455  TFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSG 514

Query: 499  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNP 558
            + RN+ L+EYLKH+E MLLPSFLES +LQ+VV+++F +KFG+ +N  + F+P  +F+Q+ 
Sbjct: 515  HHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDS 573

Query: 559  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXX 618
            +  K+FFRHA  +A+SH+LQ+VGFG+P+NPFA+LFELPK+L                   
Sbjct: 574  ERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHL------------------- 614

Query: 619  XXXXXGNSRNDNNDDDEIMSSTA-----SISDHDFLA---EFFNDIDTLRRPILPSMLTS 670
                    R D  +  +  SST+     SI D    A   EFF  ID+ +  I       
Sbjct: 615  ------KERKDRREKRKSKSSTSTQYDTSIDDDCAFAAPSEFFETIDSTKY-IYKFPDDI 667

Query: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730
              W E+L + N+T++KC MIVLRKFLHGPL  ALPH+LPW YF+ AT  +   +     +
Sbjct: 668  NIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIR 727

Query: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790
             FW+ +V+++FP++TI+TF+NVL+ Y+ +    N    E   ++  ++LA L+  F E+E
Sbjct: 728  RFWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENE 787

Query: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850
            ELPE+W CWGTLWFD +   N   I++  +    G+KD+M +D+P DGI FD  DESGEK
Sbjct: 788  ELPEVWECWGTLWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEK 844

Query: 851  FWKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTP 910
            FWKR  R+I LFR L+   P+G       L + S  ++    R+LV+K E   +   +  
Sbjct: 845  FWKRCARVILLFRALALECPVG-------LREISGGRN---WRSLVFKFEEPPSEWCDM- 893

Query: 911  ILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLS 970
             L       D  E  S  N+D  A P   +    +I    GY+ L PDY CF+RNG+ ++
Sbjct: 894  YLEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMIT 953

Query: 971  ASLYT-----------------RWYLPNGNNISEAL--VNSDIEKGDEDLFLECMK-PDC 1010
             SLYT                 +  L NG  +S      NS I++ ++ +  E ++   C
Sbjct: 954  GSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHC 1013

Query: 1011 PG----------------IDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQE 1054
                               D   TYFV DAT+WLRH   ++KLA N +LKFAICLTTFQE
Sbjct: 1014 KNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQE 1073

Query: 1055 LRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTH 1114
            LRFLRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+H
Sbjct: 1074 LRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSH 1133

Query: 1115 VDEFVIESIKKAQEKLENAGQ----------PHVTPRHSNYVVLISDDDTMKKKAEEKEI 1164
            VDEFVIE+I KAQ+K                P    +  N++ L++DD  M+ KA  + I
Sbjct: 1134 VDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNI 1193

Query: 1165 KTLSTKFVFSLCTKLGEKRHLCTD 1188
            K  ST+F+FS+C +LG  +++CT+
Sbjct: 1194 KAFSTRFMFSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/977 (50%), Positives = 651/977 (66%), Gaps = 85/977 (8%)

Query: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321
            SK SS  L++KLQE+YK IVKQE ELQERCSQLT SQTT+LK+LW IY++N ELI+NY T
Sbjct: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375

Query: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381
            FITTALLP+QP  DLLIGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435

Query: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441
            +VF+S+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + 
Sbjct: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495

Query: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 501
            HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ R
Sbjct: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555

Query: 502  NSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 561
             S ++EYLKH+E MLLPSFLE+ + Q VV+++F +KFG   +  N F+P  +F+Q+ +  
Sbjct: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERL 614

Query: 562  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXX 621
            K+FFRHA  +A+SHILQ+VGFG+P+NPFA+LFELPK +                      
Sbjct: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCI---------KERKERKEKRKSK 665

Query: 622  XXGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTSEAWLETLKFLN 681
               ++++D + DD  +             +FF  +++ +     S      W E+L ++N
Sbjct: 666  STASNQSDMSIDDTFLGDP---------VQFFETLNSTKTAYRFSQ-DLNIWKESLNYVN 715

Query: 682  MTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVF 741
             TS++C M+VLRKFL+  L  ALPH+LPW YF++A  L+ + + +  SK FW++ ++++F
Sbjct: 716  KTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIF 775

Query: 742  PWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGT 801
            PW++I  F+NVL+ Y+ D +     I E  + Y  + L  LLE F E+E+LPE+WNCWGT
Sbjct: 776  PWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGT 835

Query: 802  LWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFL 861
            LWFD I   N+  +S+  +    G+KD+M LDAP DGI FD  DESGEKFWKR  R+I L
Sbjct: 836  LWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILL 892

Query: 862  FRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKL-EPLSNIRSNTPILTALENSVD 920
            FR ++  FP G    N           S   ++LV+K  EP +  +     L +      
Sbjct: 893  FRGIAYQFPFGFTEFN----------GSDDWKSLVFKFNEPPAEWKEQ--YLGSFSKEYG 940

Query: 921  ISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYLP 980
              E+ S  N DL + P   +  G +I    GYK+L PDY CF++NG+ ++ SLYT     
Sbjct: 941  EFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSE 1000

Query: 981  NGNNI---------------SEALVNSD-------IEKGDEDLFLECMK----------P 1008
             G+ +               +E LV S+       ++K +  +  E +K           
Sbjct: 1001 GGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWE 1060

Query: 1009 DC-PGIDFE------TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKS 1061
             C P  D +       TYFV DAT+WLRH   ++KLA + LLKFAICLTTFQELRFLRKS
Sbjct: 1061 QCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKS 1120

Query: 1062 KDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIE 1121
            KDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE
Sbjct: 1121 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1180

Query: 1122 SIKKAQEKL-------ENAGQPHVTPRHS---NYVVLISDDDTMKKKAEEKEIKTLSTKF 1171
            +I KAQ K        + +G+  +T       N++ L++DD  M+ KA  + I+  STKF
Sbjct: 1181 AIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKF 1240

Query: 1172 VFSLCTKLGEKRHLCTD 1188
            +F++C ++G  + +CTD
Sbjct: 1241 MFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/981 (49%), Positives = 641/981 (65%), Gaps = 96/981 (9%)

Query: 269  LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTALL 328
            L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  Y+IN ELI+NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 329  PSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS 388
            PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 389  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH 448
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 449  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 508
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 509  LKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRHA 568
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+P  +FIQ+ +  K+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 569  PSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXXXGNSRN 628
              F+QSHILQ+ GFG+PKNPFA+LFEL K+L                          S +
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKST------------KSTS 630

Query: 629  DNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKC 687
            + + D    SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct: 631  EGSLDPVEFSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC 684

Query: 688  GMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIV 747
            GMIVLR+FL+GP+  ALPH+LPW+ FII+  ++ +Q++D T K FW++ ++R+FPWD+++
Sbjct: 685  GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI 744

Query: 748  TFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDTI 807
            TFMN LI Y +     N  I    S Y  +N   LL S  E+E LPE W+CWG+LWF+TI
Sbjct: 745  TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI 804

Query: 808  CQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFR---- 863
             +K+   +++    +  G+ D + LD+PT+GI FDD DE G K+W+R CR + LF     
Sbjct: 805  SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861

Query: 864  -ELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSVDIS 922
             E    +  G    N           +   +NLV++    +N + +  +      S    
Sbjct: 862  WEACDGYGHGCKKLN---------PEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFE 912

Query: 923  EARSKNNI---DLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYL 979
            +    +N+   D       S+  G +I +  G+K + PDY CF++NG+ ++ASLYT+  L
Sbjct: 913  KFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL 972

Query: 980  PNGN-------NISEALVN------------SDIEKGDEDLFLECMKPD----------- 1009
               N       N ++ L N            S I+K ++      M PD           
Sbjct: 973  ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF 1032

Query: 1010 -----CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDE 1064
                 C   D   T+FV DAT+WLRH A I+KLA + +LKFAICLTTFQELRFLRKSKDE
Sbjct: 1033 LGNLNCQA-DTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDE 1091

Query: 1065 NVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIK 1124
            +V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++I 
Sbjct: 1092 SVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIA 1151

Query: 1125 KAQEK-----------------LENAGQPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTL 1167
            KAQ+K                 L   GQ   + +  N+V L++DD  M+ KA++  I+T 
Sbjct: 1152 KAQDKFNVLNNDAIEKGKDCIPLSEDGQ---STQRFNFVSLVTDDFNMRNKAQQLGIRTF 1208

Query: 1168 STKFVFSLCTKLGEKRHLCTD 1188
            ST+FVF++C +LG +  +CT+
Sbjct: 1209 STRFVFAICRELGRETGVCTN 1229

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/746 (48%), Positives = 499/746 (66%), Gaps = 38/746 (5%)

Query: 264 RSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFI 323
           RS+ ALI KLQ++YK I+ QE+ELQ  CS +T+SQTT+LK +W +Y+IN EL+NNYV FI
Sbjct: 271 RSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFI 330

Query: 324 TTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 383
           TTALLPSQ   DLLIGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI HV
Sbjct: 331 TTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHV 390

Query: 384 FVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHG 443
           F+S++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY Y  G
Sbjct: 391 FISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG 450

Query: 444 KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNS 503
           KLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   +  N 
Sbjct: 451 KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNV 510

Query: 504 LLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKY 563
            +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN +  K+
Sbjct: 511 QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570

Query: 564 FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXXX 623
           +FRH+P FAQ+HILQ+VG+G   N FA+L+ELPK++                        
Sbjct: 571 YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGV-------- 622

Query: 624 GNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNM 682
                DN   D +    +    HD + E+FN ++ + +   LP  +  + W+++L++ N 
Sbjct: 623 -----DNMSIDTLSFQVSGNEIHD-VGEYFNSLENIDKEFTLPPNV--DIWIQSLQYTNT 674

Query: 683 TSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFP 742
           T + CGM+VL+KFL GP   ALPH+LPW+YF+I+   K   L D  S+ FW + ++R+FP
Sbjct: 675 TGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFP 734

Query: 743 WDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTL 802
           W+TI+ F+NVLIA+L DN     ++ +LC  Y  L+L  +L +F+E+EELPE+WNCWG+L
Sbjct: 735 WNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSL 794

Query: 803 WFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLF 862
           WFDTI  K+  S S     +  GIKD   LDAP DGI+FD++D++G KFWKRACRI+FLF
Sbjct: 795 WFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLF 851

Query: 863 RELSRTFPIGVIVSNDPLIKCSSSQSSIILR-------NLVYKLEPLSNI-----RSNT- 909
           +  +  F  G+ ++N  +   +S + +I  +       + ++K +P  ++      SN  
Sbjct: 852 KGYAEKFDQGLRLTN--INSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKY 909

Query: 910 -PILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEF 968
             + +     +   E+ S+NNI L AVP+LSV  G++IF Y GYKKL P Y  +D+NG  
Sbjct: 910 FQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNV 969

Query: 969 LSASLYTRWYLPN--GNNISEALVNS 992
              ++Y+ W   N  GN +   + N 
Sbjct: 970 NKGAIYSNWEAFNQLGNGLKPRMENG 995

 Score =  209 bits (531), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/203 (50%), Positives = 138/203 (67%), Gaps = 27/203 (13%)

Query: 1013 IDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATR 1072
            + + +TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAATR
Sbjct: 1080 VAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATR 1139

Query: 1073 GIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQE---- 1128
             +I IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE++ K+QE    
Sbjct: 1140 AVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMF 1199

Query: 1129 -KLENA----------------------GQPHVTPRHSNYVVLISDDDTMKKKAEEKEIK 1165
             +L N                       G  + +       VL++DD  M  KA+E+ I+
Sbjct: 1200 DELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIR 1259

Query: 1166 TLSTKFVFSLCTKLGEKRHLCTD 1188
            T ST+F+FS+C++LG K  +CT+
Sbjct: 1260 TCSTRFIFSICSQLGMKYGICTN 1282

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  525 bits (1352), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 269/384 (70%), Positives = 305/384 (79%), Gaps = 43/384 (11%)

Query: 259 SANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINN 318
           S  +K SS ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +LINN
Sbjct: 388 SITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINN 447

Query: 319 YVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 378
           Y+ FIT ALLP+Q  +DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQ
Sbjct: 448 YINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQ 507

Query: 379 FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 438
           FI+HVF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+
Sbjct: 508 FISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKF 567

Query: 439 IYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 498
            Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNG
Sbjct: 568 TYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNG 627

Query: 499 NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI------------------ 540
           N RN  LIEYLKH+E MLLP+FLES DLQNVV+ YF  KFGI                  
Sbjct: 628 NHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNG 687

Query: 541 -------------------------DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSH 575
                                         +IF  +DMFIQNPD  KYFFRH+ +FAQSH
Sbjct: 688 ANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSH 747

Query: 576 ILQIVGFGEPKNPFAILFELPKYL 599
           ILQ+VGFG+PKNPFA+LFELPK+L
Sbjct: 748 ILQLVGFGDPKNPFALLFELPKFL 771

 Score =  409 bits (1051), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 249/582 (42%), Positives = 336/582 (57%), Gaps = 105/582 (18%)

Query: 651  EFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILP 709
            EFF +ID L+ P  +P   T E WLE+LK +N+ SLKC +IVL+KFL+GP+ IALPH+L 
Sbjct: 867  EFFENIDLLQFPYKIPQ--TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924

Query: 710  WIYFIIATCLK-SNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDN---EALNP 765
            WI+FII+  LK  N ++D  SK FW   +K + PW++IV F+NVL+ YLLDN   E    
Sbjct: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984

Query: 766  IIGELCSKYGTL---NLAGLLESFNESEELPEIWNCWGTLWFDTICQKNAHS-------- 814
            II  L +KY ++   +L  +L+ FN++E LPEIW CWGTLWFD IC KN +S        
Sbjct: 985  IIS-LSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQN 1043

Query: 815  -------------------ISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRA 855
                                 +D   + +GI+D+  LD P DGI F   DE G  F+KR+
Sbjct: 1044 NNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRS 1103

Query: 856  CRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEPL---------- 902
             R+IFL + +  TFP +G+ +S++    C +++   + IL N  +KL  L          
Sbjct: 1104 IRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQ 1163

Query: 903  -------------SNIRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSG-DNIFH 948
                          ++  N  IL+ +     I E   + N++L   P LS+  G +NIF+
Sbjct: 1164 TEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFN 1223

Query: 949  YTGYKKLRPDYTCFDRNGEFLSASLYTRWYLPNGNNISE---------------ALVNSD 993
            Y GYK+L  +   F  NGE +S S+Y+ W + + N   E                + N +
Sbjct: 1224 YLGYKRLNFNIQSFHENGEIISGSIYSSWPI-DYNKFKEQQQQQQQQEHLVNDSTMKNEN 1282

Query: 994  IEKGD---EDL-FLECMKPD--------------------CPGIDFETTYFVFDATSWLR 1029
            +  GD   ED  F E MK                         I+   T+FVFDATSWLR
Sbjct: 1283 VTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLR 1342

Query: 1030 HSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPL 1089
            H A I+KL++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPL
Sbjct: 1343 HFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPL 1402

Query: 1090 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLE 1131
            RFTGNVAT IEE+LEFEEQITWR+HVDEFVIE+I ++QE+ +
Sbjct: 1403 RFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  454 bits (1167), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 286/413 (69%), Gaps = 76/413 (18%)

Query: 263 KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322
           K+S+  LIQKLQ +YK+IV QE+ELQ++C++L+ SQ+T+LK LW+IY++N +LINNY+ F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 323 ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382
           I T+L PSQ ++D LIG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITH
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 383 VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442
           VF S+S MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+ ++H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 443 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----- 497
           GKLYYH+STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ERN+     
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 498 ------------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFG 539
                              N +   LIEYLKHSE MLLP+FLE+  L+ VV++YF   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 540 ----------------------------------------------------IDANGCNI 547
                                                               +  N  N+
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 548 FNPEDMFIQ-NPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYL 599
           FN  ++F Q N D  KYFF+++ +FA+SHILQ++GFG+PKNPFA+LF+LPKYL
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  258 bits (660), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 194/334 (58%), Gaps = 74/334 (22%)

Query: 923  EARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYLP-- 980
            E  S  N DL   P LS+   +++F Y GYK+  PD++ FD+NGE +S SLYT   +   
Sbjct: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTI 1210

Query: 981  NGNNISEALVNSDIEKGDE----------------------------------DLFLECM 1006
            NG++ +  ++N+     DE                                  ++F + +
Sbjct: 1211 NGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKIL 1270

Query: 1007 KPDCPGID--------------FETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTF 1052
             PD   ID              F  TYFV DATSWLRH A ++KLA N +LKFAICLTTF
Sbjct: 1271 DPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTF 1330

Query: 1053 QELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWR 1112
            QELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITWR
Sbjct: 1331 QELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWR 1390

Query: 1113 THVDEFVIESIKKAQEKL---ENAGQPHVTPRHSNY-----------------VVLISDD 1152
            +HVDEFVIE+IK+AQ K     N    +VT  ++N                   VL++DD
Sbjct: 1391 SHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTDD 1450

Query: 1153 DTM-KKKAEEK---EIKTLSTKFVFSLCTKLGEK 1182
             +M KK+ EEK   +I T STKFVFSLC  L  K
Sbjct: 1451 ISMIKKRQEEKSDNDIITFSTKFVFSLCNMLVNK 1484

 Score =  224 bits (572), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 114/276 (41%), Positives = 181/276 (65%), Gaps = 17/276 (6%)

Query: 632  DDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKCGMI 690
            D+DE++ + +         +FFN++++L+    LP+ L  E W E+LK++N+ SL C +I
Sbjct: 778  DEDEMLDNLSP-------QDFFNNLESLKLSFFLPNSL--EIWNESLKYINIISLNCSII 828

Query: 691  VLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTFM 750
            VL+KFL+GPL ++LPH+LPW YFII+  L+   L +  S+ FW+  ++++FPW++IV+++
Sbjct: 829  VLKKFLNGPLFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYL 888

Query: 751  NVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE-ELPEIWNCWGTLWFDTICQ 809
            NV+I+ LLDN   N +I +L + Y   NL  LL  FNE+E ELPE+W C+G+LWFD I +
Sbjct: 889  NVIISVLLDNCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAE 948

Query: 810  KNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSRTF 869
               + I S D  + I +KD   L+ P DG+ FD+ +E+G  FWKR+CR+IFLF+ +   F
Sbjct: 949  N--YQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRF 1006

Query: 870  P--IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEP 901
                G+ +S++  + C+ S   ++ ILR   +KL P
Sbjct: 1007 NGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKLLP 1042

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  156 bits (394), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 197/918 (21%), Positives = 383/918 (41%), Gaps = 150/918 (16%)

Query: 305  LWTIYRINTELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVL 364
            L  +++++T++++ Y  FI  AL  +    DL+ G+E V   R+  RL  +     L+++
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 365  KNFSNFM----------DPEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAI 414
            +N+ N M          + +   +FI    + ++ M+ +IP K+   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 415  ALYPSSFIDWKLSAEHWY-----TEAMKYIYNHGK----------LYYHMSTVQQNTLEA 459
             L       ++L++ H Y       A+ Y  N+GK           Y+++S VQ ++L  
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 460  FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPS 519
             V L K +  + T        QL ID I  +   ++   NL+ S+    +      LL  
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYFTLLSL 381

Query: 520  FLESPD------LQNVVVSYFVEKFGID--ANGCNIFNPEDMFIQNPD--FFKYFFRHAP 569
            F  S        ++   + YF  +F  +   N  ++  P +   +  +  +  ++F +AP
Sbjct: 382  FFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAP 441

Query: 570  SFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXXXXXXXXXXXXXXGNSRND 629
             F+   I++ +   +  NPF  +++                                   
Sbjct: 442  LFSLISIVETIIMNKKLNPFFCVYK----------------------------------- 466

Query: 630  NNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTSEAWLETLKFLNMTSLKCGM 689
            ++DD EI S   S+S+   L E  +D                           T L    
Sbjct: 467  SSDDFEIKS--VSLSNWKILIEQMDD---------------------------TLLHSNK 497

Query: 690  IVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTIVTF 749
            ++ +KFL   + I+ P ILPW+ F I+   +   ++D      W  +++ + PWD IVT+
Sbjct: 498  LLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTY 557

Query: 750  MNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDTICQ 809
            +N  I  +  +   +  +  L     + +L  LL          EI  C G +WFD++  
Sbjct: 558  LNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617

Query: 810  K-NAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELSRT 868
            K    SI+++++  +     + + +A  D +I+DD D+   K W RA  II L + +   
Sbjct: 618  KIKQASITTNESLMK-----FKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVIND 672

Query: 869  FPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSVDISEARSKN 928
            +P  + VS    I+  S  +S  ++N                   +L N          N
Sbjct: 673  YPELIDVS----IRGQSLTNSSCIKN-----------------SDSLTNDYLFDWGFELN 711

Query: 929  NIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFL-SASLYTRW-YLPNGNNIS 986
            N +   + + +++  + IF ++      PD+  FD+NG+     SL + + Y+ + +  S
Sbjct: 712  NNNAVIIDD-TLHGRNRIFKFSYI----PDFQDFDKNGDITWGYSLISNYDYIYSNDFNS 766

Query: 987  EALVN------SDIEKGDEDLFLECMKPDCPGIDFETTYFVFDATSWLRHSARIFKLAQN 1040
            E   N        +     D   +  K   P +  E  YF+ D  +WL+HS ++ +    
Sbjct: 767  EEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKL--ENNYFMVDTLAWLKHSNKLKRFIAE 824

Query: 1041 RLLKFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHI 1099
              +K  + ++   +L  L+  S+ E+V  +A+R +I I  LY  +++  L+   +  +  
Sbjct: 825  EKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILKEFESPISKA 884

Query: 1100 EENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLISDDDTMKKKA 1159
             +N++  + + +       ++       ++L       +  R  N VV++SDD       
Sbjct: 885  LKNIDGSQILNFNGKFKNDLLTKENGPGQQLN-----MIELRMDN-VVVVSDDKLSLATF 938

Query: 1160 EEKEIKTLSTKFVFSLCT 1177
            ++K    +STK +FS+ +
Sbjct: 939  KKKGYNVVSTKVLFSVAS 956

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 125,565,160
Number of extensions: 5704191
Number of successful extensions: 19998
Number of sequences better than 10.0: 64
Number of HSP's gapped: 20599
Number of HSP's successfully gapped: 92
Length of query: 1188
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1067
Effective length of database: 39,606,813
Effective search space: 42260469471
Effective search space used: 42260469471
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)