Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_11.3355.705ON94944721e-62
Suva_11.3325.705ON1111113802e-48
YKR095W-A (PCC1)5.705ON88943755e-48
Smik_11.3595.705ON88943633e-46
NCAS0A031805.705ON88933183e-39
Kpol_YGOB_1043.725.705ON88943044e-37
TDEL0B021505.705ON91882992e-36
Kwal_YGOB_Anc_5.7055.705ON88942792e-33
KAFR0H001905.705ON82882773e-33
KLTH0E00990g5.705ON89942767e-33
SAKL0E14982g5.705ON89942732e-32
TBLA0G010305.705ON89932722e-32
TPHA0E002005.705ON85792705e-32
NDAI0E050605.705ON86902696e-32
ZYRO0B16368g5.705ON85862568e-30
KNAG0C066205.705ON101952551e-29
KLLA0A00539g5.705ON87922481e-28
Ecym_40165.705ON125742363e-26
AFR289W5.705ON81851881e-19
CAGL0G02535g5.705ON140571801e-17
AGR088W8.260ON288735660.80
KNAG0A042408.455ON69443631.8
Kwal_33.149892.610ON121473622.5
YGR061C (ADE6)4.207ON135844622.5
TBLA0E037402.232ON250973613.0
ZYRO0B07722g4.207ON135388613.3
Kpol_1031.578.455ON68936613.4
Suva_7.3434.207ON135844604.7
SAKL0H04224g4.207ON135045604.9
Skud_2.2493.381ON66576595.6
NDAI0D041804.207ON135545587.9
KLLA0B08063g4.207ON134945588.1
NCAS0A022504.207ON135036589.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_11.335
         (94 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   186   1e-62
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   150   2e-48
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   149   5e-48
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   144   3e-46
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   127   3e-39
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   121   4e-37
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   119   2e-36
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   112   2e-33
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   111   3e-33
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   110   7e-33
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   109   2e-32
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   109   2e-32
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   108   5e-32
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   108   6e-32
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   103   8e-30
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   102   1e-29
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   100   1e-28
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    96   3e-26
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    77   1e-19
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    74   1e-17
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...    30   0.80 
KNAG0A04240 Chr1 complement(577186..579270) [2085 bp, 694 aa] {O...    29   1.8  
Kwal_33.14989 s33 (904037..907681) [3645 bp, 1214 aa] {ON} YMR04...    28   2.5  
YGR061C Chr7 complement(611889..615965) [4077 bp, 1358 aa] {ON} ...    28   2.5  
TBLA0E03740 Chr5 complement(932793..940322) [7530 bp, 2509 aa] {...    28   3.0  
ZYRO0B07722g Chr2 (603408..607469) [4062 bp, 1353 aa] {ON} highl...    28   3.3  
Kpol_1031.57 s1031 (144087..146156) [2070 bp, 689 aa] {ON} (1440...    28   3.4  
Suva_7.343 Chr7 complement(587041..591117) [4077 bp, 1358 aa] {O...    28   4.7  
SAKL0H04224g Chr8 (390622..394674) [4053 bp, 1350 aa] {ON} highl...    28   4.9  
Skud_2.249 Chr2 complement(448964..450961) [1998 bp, 665 aa] {ON...    27   5.6  
NDAI0D04180 Chr4 complement(979760..983827) [4068 bp, 1355 aa] {...    27   7.9  
KLLA0B08063g Chr2 (709756..713805) [4050 bp, 1349 aa] {ON} highl...    27   8.1  
NCAS0A02250 Chr1 complement(422615..426667) [4053 bp, 1350 aa] {...    27   9.0  

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  186 bits (472), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
          LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  150 bits (380), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 17/111 (15%)

Query: 1   MTSKREMSLDYTLVEQVFQ-----------------ELQIPFETEGQASIATKVLSPDPI 43
           M S+REM LD+TLVE++F+                 EL+IPFETE QA+IAT+VLSPDPI
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 44  LKPQDFQVDYSSEKNIMLVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
           LKPQDFQ DYSSE N+ML RFRSIDDRVLRVGVSSVIDSIKTI+ET+DELS
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  149 bits (375), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 84/94 (89%), Gaps = 6/94 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          MTSKRE SLD+TL      EL+IPFETE QA+IATKVLSPDPILKPQDFQVDYSSEKN+M
Sbjct: 1  MTSKREKSLDHTL------ELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVM 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
          LV+FRSIDDRVLRVGVSS+IDSIKTIVE +D LS
Sbjct: 55 LVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  144 bits (363), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 72/94 (76%), Positives = 83/94 (88%), Gaps = 6/94 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          M+SKREM L +TL      EL++PF+TE QA IAT+VLSPDPILKPQDFQ+DYSSEKN+M
Sbjct: 1  MSSKREMPLHHTL------ELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVM 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
          LV+FRSIDDRVLRVGVSSVIDSIKT+VE +DELS
Sbjct: 55 LVQFRSIDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  127 bits (318), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 72/93 (77%), Gaps = 6/93 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          M + REMSLDY L       L+IPF T  QA IA KVL PDPILKPQDFQV+Y S+ NI+
Sbjct: 1  MKNGREMSLDYVL------NLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNIL 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93
           V FR IDDRVLRVGVSSVIDSIKTI+ETIDEL
Sbjct: 55 AVHFRGIDDRVLRVGVSSVIDSIKTIIETIDEL 87

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  121 bits (304), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 76/94 (80%), Gaps = 6/94 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          M ++R + +D+TL      + +IPFET  QA IA +VL PDPILKPQDFQV YSS  N++
Sbjct: 1  MKTQRTIEMDHTL------DFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLL 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
          +++F+SIDDRVLRVGVSSVIDS+KTI+ET+DELS
Sbjct: 55 IMKFKSIDDRVLRVGVSSVIDSVKTIIETMDELS 88

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 6/88 (6%)

Query: 7  MSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRS 66
          MSL+++L      +L+IPF+T  QA+IA +VL PDPILKPQDFQVDY++  N+++V F+S
Sbjct: 1  MSLNHSL------KLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQS 54

Query: 67 IDDRVLRVGVSSVIDSIKTIVETIDELS 94
          IDDRVLRVGVSSVIDSIKTIVETIDEL 
Sbjct: 55 IDDRVLRVGVSSVIDSIKTIVETIDELG 82

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  112 bits (279), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 69/94 (73%), Gaps = 6/94 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          M S R ++L YTL       L++PF+ + QA+ A +VL PDPILKPQDF V+Y+S  N +
Sbjct: 1  MKSSRPLNLAYTLY------LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNL 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
           V F  +DDRVLRVGVSSVI+SIKTIVETIDE S
Sbjct: 55 CVLFEGVDDRVLRVGVSSVIESIKTIVETIDEFS 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  111 bits (277), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 68/88 (77%), Gaps = 6/88 (6%)

Query: 7  MSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRS 66
          M+LD+TL      +L+IPFE   QA+IA  VL PDPIL+PQDFQV Y +  N+ +  F S
Sbjct: 1  MNLDHTL------KLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFES 54

Query: 67 IDDRVLRVGVSSVIDSIKTIVETIDELS 94
          IDDRVLRVGVS+VIDS+KTI+ET+DELS
Sbjct: 55 IDDRVLRVGVSNVIDSLKTIIETMDELS 82

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  110 bits (276), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 67/94 (71%), Gaps = 6/94 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          M   R+  L YTL       L++PF+T  QA  A KVL PDPILKPQDF V+YSS+ + +
Sbjct: 1  MKGTRQSDLAYTLY------LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNL 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
           V F  +DDRVLRVGVSSVI+SIKTI+ETIDE S
Sbjct: 55 CVSFEGVDDRVLRVGVSSVIESIKTIIETIDEFS 88

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  109 bits (273), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 55/94 (58%), Positives = 69/94 (73%), Gaps = 6/94 (6%)

Query: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          M + R+MSLD+ L       L+IP ET  QA IA K L PDP+LKP+DFQV+YS+    +
Sbjct: 1  MKNTRQMSLDHHLY------LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKL 54

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
           V F+SIDDRVLRVGVSSVI+S+KTI+ET+DE  
Sbjct: 55 CVSFKSIDDRVLRVGVSSVIESVKTIIETMDEFG 88

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 8/93 (8%)

Query: 3  SKRE--MSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60
          SKR+  M +++TL       L IPF T  QA IA +VL PDPIL+PQDFQV Y+S+ N +
Sbjct: 2  SKRDNNMQMEHTLT------LNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNEL 55

Query: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93
          ++ F+SIDDRVLRVGVSSVIDS+KTI+ET DEL
Sbjct: 56 VMEFQSIDDRVLRVGVSSVIDSVKTIIETFDEL 88

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score =  108 bits (270), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 52/79 (65%), Positives = 68/79 (86%)

Query: 15 EQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLRV 74
          +Q  ++L IPFET  QASIA +VL PDP L+P++F+VDYSS+ + ++V F+S+DDRVLRV
Sbjct: 4  KQSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRV 63

Query: 75 GVSSVIDSIKTIVETIDEL 93
          GVS+VIDSIKTI+ETIDEL
Sbjct: 64 GVSNVIDSIKTIIETIDEL 82

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  108 bits (269), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 10/90 (11%)

Query: 8  SLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDY----SSEKNIMLVR 63
          +LDYTL      E++IPF  E  A+IA +VLSPDPILKP+DFQV+Y    +   N++LV+
Sbjct: 3  TLDYTL------EIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVK 56

Query: 64 FRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93
          F+SID+RVLRVGVSSV+DSIKTI+ET+DEL
Sbjct: 57 FQSIDERVLRVGVSSVLDSIKTILETMDEL 86

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  103 bits (256), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (75%), Gaps = 6/86 (6%)

Query: 8  SLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSI 67
           LD+ L       L IPF  +  + +A KVL PDPIL+P+DFQV+Y S+ N++ + F+S+
Sbjct: 3  HLDHNL------HLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSV 56

Query: 68 DDRVLRVGVSSVIDSIKTIVETIDEL 93
          DDRVLRVGVSSVIDS+KTIVETIDEL
Sbjct: 57 DDRVLRVGVSSVIDSVKTIVETIDEL 82

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  102 bits (255), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 68/95 (71%), Gaps = 8/95 (8%)

Query: 1  MTSK--REMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKN 58
          MT+K  R  +LD+TL       L +PFET  QA IA++VL PDPILKPQDF V Y+++  
Sbjct: 1  MTTKTARPAALDHTLT------LNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGP 54

Query: 59 IMLVRFRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93
           +  RF   D RVLRVGVSSVIDS+KTI+E++DEL
Sbjct: 55 CLEARFCGRDARVLRVGVSSVIDSLKTIIESLDEL 89

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 69/92 (75%), Gaps = 6/92 (6%)

Query: 3  SKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLV 62
          +K + S +++L       L+IPFE+  QA +A KVL PDPI+KP+DFQV YS++   ++ 
Sbjct: 2  NKGDTSFEHSL------HLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLIC 55

Query: 63 RFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94
           F S+D+R+LRVGV+SVI+SIKTIVETIDEL 
Sbjct: 56 DFESVDERILRVGVNSVIESIKTIVETIDELC 87

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 95.5 bits (236), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 58/74 (78%)

Query: 21  LQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLRVGVSSVI 80
           L++PFE   QA IA +VL  DP+L+P+DF+VDY+ +   +LV F SID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 81  DSIKTIVETIDELS 94
           +SIKT+VET+DE S
Sbjct: 111 ESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 77.0 bits (188), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 57/85 (67%), Gaps = 6/85 (7%)

Query: 9  LDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSID 68
          +D+TL       L +PFE+   A IA + L+PDP+L+P++  V ++S+   + ++  +ID
Sbjct: 1  MDHTL------HLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAID 54

Query: 69 DRVLRVGVSSVIDSIKTIVETIDEL 93
           RVLRV  +S+ +++KT+VET DEL
Sbjct: 55 ARVLRVATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 73.9 bits (180), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 45/57 (78%)

Query: 17 VFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLR 73
          ++++L +PFET   A IA +VL PDPIL+P+DFQV+Y ++  ++ + F++IDDRVLR
Sbjct: 27 IYRDLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 30.0 bits (66), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 40   PDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLRV 74
            PD I     F+VD+S E    L++ R IDDR+ +V
Sbjct: 1884 PDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKV 1918

>KNAG0A04240 Chr1 complement(577186..579270) [2085 bp, 694 aa] {ON}
           Anc_8.455 YDR234W gene spans a gap in the genome
           sequence
          Length = 694

 Score = 28.9 bits (63), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 34  ATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLRVGV 76
           ATKV +P  I+   D  +  +SEKN  L ++R+I++   + G+
Sbjct: 71  ATKVANPKQIVNTLDHDIQNTSEKN--LTKYRNIENFAGKHGI 111

>Kwal_33.14989 s33 (904037..907681) [3645 bp, 1214 aa] {ON} YMR047C
           (NUP116) - Nuclear pore complex protein that is member
           of GLFG repeat-containing family of nucleoporins and is
           highly homologous to Nup100p [contig 98] FULL
          Length = 1214

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 12/73 (16%)

Query: 23  IPFETEGQASIATKVLSPDPILKPQD--FQVDYSSEKNIMLVR--------FRSIDDRVL 72
           +P  T G +SI T   S + IL   +  F  D  S KN+++ R        F+  DD+VL
Sbjct: 922 VPANT-GASSIFTND-SDELILSSNNALFNPDKKSFKNLIINRKKMEETADFKQDDDQVL 979

Query: 73  RVGVSSVIDSIKT 85
           R+  SS  DS++T
Sbjct: 980 RITFSSDGDSVET 992

>YGR061C Chr7 complement(611889..615965) [4077 bp, 1358 aa] {ON}
           ADE6Formylglycinamidine-ribonucleotide
           (FGAM)-synthetase, catalyzes a step in the 'de novo'
           purine nucleotide biosynthetic pathway
          Length = 1358

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 10  DYTLVEQVFQELQIPFETEGQASIATKVLSPDPILK--PQDFQV 51
           D ++ E++ +  + PF   G A+   K++  DP+LK  P D ++
Sbjct: 599 DLSIFEEICKRERAPFAVVGHATAEQKLIVEDPLLKTTPIDLEM 642

>TBLA0E03740 Chr5 complement(932793..940322) [7530 bp, 2509 aa] {ON}
           Anc_2.232 YIL129C
          Length = 2509

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 7/73 (9%)

Query: 12  TLVEQVFQELQIPFETEGQA---SIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSID 68
           +L+  + Q+LQ+  ET       ++A   ++P  +     FQ+    E NI  +R RS+D
Sbjct: 621 SLLLGISQKLQLRPETWVSGFKLNVAVLSVAPHELFSKYWFQL---IEGNIDQIRTRSLD 677

Query: 69  DRVL-RVGVSSVI 80
           DRV+  VG+S +I
Sbjct: 678 DRVIFAVGLSRLI 690

>ZYRO0B07722g Chr2 (603408..607469) [4062 bp, 1353 aa] {ON} highly
           similar to uniprot|P38972 Saccharomyces cerevisiae
           YGR061C ADE6 Formylglycinamidine-ribonucleotide
           (FGAM)-synthetase catalyzes a step in the 'de novo'
           purine nucleotide biosynthetic pathway
          Length = 1353

 Score = 28.1 bits (61), Expect = 3.3,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 8   SLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILK--PQDFQVDYSSEKNIMLVRFR 65
           S D  + E++ +  + P+   GQA+   +++  DP+LK  P D ++     K   + +  
Sbjct: 597 SGDLPVFEEICRRERAPYAVVGQATAEQRLIVEDPLLKDTPIDLEMPILFGKPPKMSQQT 656

Query: 66  SIDDRVLRVGVSSVIDSIKTIVETIDEL 93
           +  +  L     SVI S+K  +E +  L
Sbjct: 657 TTQNLKLNSPDLSVIPSVKDALERVLHL 684

>Kpol_1031.57 s1031 (144087..146156) [2070 bp, 689 aa] {ON}
           (144087..146156) [2070 nt, 690 aa]
          Length = 689

 Score = 28.1 bits (61), Expect = 3.4,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 34  ATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDD 69
           ATK+  PD I+   D  V   SEKN  L ++R+I++
Sbjct: 70  ATKLKYPDQIVNTLDHDVQNKSEKN--LTKYRNIEN 103

>Suva_7.343 Chr7 complement(587041..591117) [4077 bp, 1358 aa] {ON}
           YGR061C (REAL)
          Length = 1358

 Score = 27.7 bits (60), Expect = 4.7,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 10  DYTLVEQVFQELQIPFETEGQASIATKVLSPDPILK--PQDFQV 51
           D ++ E + +  + PF   G A+   K++  DP+LK  P D ++
Sbjct: 599 DLSIFEDICKRERAPFAVVGHATAEQKLIVEDPLLKTTPIDLEM 642

>SAKL0H04224g Chr8 (390622..394674) [4053 bp, 1350 aa] {ON} highly
           similar to uniprot|P38972 Saccharomyces cerevisiae
           YGR061C ADE6 Formylglycinamidine-ribonucleotide
           (FGAM)-synthetase catalyzes a step in the 'de novo'
           purine nucleotide biosynthetic pathway
          Length = 1350

 Score = 27.7 bits (60), Expect = 4.9,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 23/45 (51%)

Query: 10  DYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYS 54
           D  + E++ +  + PF   G A+   K++  DP+LK     ++ S
Sbjct: 596 DVAVFEEICRREKAPFAIVGHATAEQKLIVEDPLLKSTPIDLEMS 640

>Skud_2.249 Chr2 complement(448964..450961) [1998 bp, 665 aa] {ON}
           YBR121C (REAL)
          Length = 665

 Score = 27.3 bits (59), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 12  TLVEQVFQELQIPFETEGQA-SIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDR 70
           T V ++ ++ QIPF+ +    SI  +    D +  P    +D+ S K+  +        +
Sbjct: 564 TEVSKILRKSQIPFKIDDSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTK 623

Query: 71  VLRVGVSSVIDSIKTI 86
            +R  V SVI++I+ I
Sbjct: 624 QVRGSVESVIEAIRDI 639

>NDAI0D04180 Chr4 complement(979760..983827) [4068 bp, 1355 aa] {ON}
           Anc_4.207 YGR061C
          Length = 1355

 Score = 26.9 bits (58), Expect = 7.9,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 23/45 (51%)

Query: 10  DYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYS 54
           DY + E++ Q  + P+   G A+   K++  D +LK     ++ S
Sbjct: 600 DYPIFEKICQRERAPYALVGHATAEQKLIVEDSLLKTTPIDLEMS 644

>KLLA0B08063g Chr2 (709756..713805) [4050 bp, 1349 aa] {ON} highly
           similar to uniprot|P38972 Saccharomyces cerevisiae
           YGR061C ADE6 Formylglycinamidine-ribonucleotide
           (FGAM)-synthetase catalyzes a step in the 'de novo'
           purine nucleotide biosynthetic pathway
          Length = 1349

 Score = 26.9 bits (58), Expect = 8.1,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 22/45 (48%)

Query: 10  DYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYS 54
           D    E++ +  + PF   G A+   K++  DP+LK     ++ S
Sbjct: 595 DLATFEEICKRERAPFAVVGHATAEQKLIVEDPLLKSTPIDLEMS 639

>NCAS0A02250 Chr1 complement(422615..426667) [4053 bp, 1350 aa] {ON}
           Anc_4.207 YGR061C
          Length = 1350

 Score = 26.9 bits (58), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 10/36 (27%), Positives = 21/36 (58%)

Query: 10  DYTLVEQVFQELQIPFETEGQASIATKVLSPDPILK 45
           +YT+ E++ +  + PF   G A+   +++  DP+L 
Sbjct: 598 NYTIFEEICRRERAPFALVGHATAEQRLVVEDPLLN 633

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,520,926
Number of extensions: 290959
Number of successful extensions: 806
Number of sequences better than 10.0: 39
Number of HSP's gapped: 801
Number of HSP's successfully gapped: 39
Length of query: 94
Length of database: 53,481,399
Length adjustment: 65
Effective length of query: 29
Effective length of database: 46,028,109
Effective search space: 1334815161
Effective search space used: 1334815161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)