Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_11.3345.702ON1885188586310.0
Suva_11.3315.702ON1898190062820.0
YKR095W (MLP1)5.702ON1875185662310.0
Smik_11.3585.702ON1878188159580.0
ZYRO0G06600g5.702ON1820176525130.0
TDEL0B021905.702ON1810177424720.0
SAKL0E14916g5.702ON1779141322150.0
NCAS0A032005.702ON1788191521010.0
Ecym_40185.702ON1769137320980.0
CAGL0G02497g5.702ON1780181819720.0
Kwal_55.196975.702ON1760137119000.0
KLTH0E01056g5.702ON1771139618110.0
NDAI0E050405.702ON1973172717410.0
AFR286W5.702ON1758174716750.0
KLLA0A00594g5.702ON1748140216660.0
TBLA0E017305.702ON1820138112101e-136
Suva_9.395.702ON168218749771e-107
Smik_9.205.702ON168213799681e-106
Skud_9.195.702ON168013849261e-100
YIL149C (MLP2)5.702ON167915519221e-100
NCAS0G002305.702ON173512147673e-81
KAFR0D022205.702ON167412627055e-74
KNAG0C065905.702ON165110086886e-72
KAFR0H002105.702ON145411036482e-67
KNAG0L021405.702ON160812315081e-50
Kpol_1043.705.702ON13214614401e-42
NDAI0F002905.702ON15545854122e-39
TPHA0E002305.702ON12847423102e-27
TPHA0D046105.702ON11834792216e-17
Kpol_2001.755.702ON1006911114e-04
NCAS0B013108.636ON48759830.71
KLTH0D10274g8.636ON471167811.2
KLTH0E09790g2.159ON622112791.9
ZYRO0F09570g5.414ON835229802.0
NDAI0D029304.46ON960156792.1
CAGL0L04356g5.503ON963241792.5
TBLA0I028904.237ON1098214792.5
KLTH0D11902g8.704ON819105782.6
KLTH0D09504g8.604ON718212782.8
Suva_10.4054.46ON916222774.3
KLTH0G12562g8.310ON72568764.4
KNAG0M014305.161ON71879764.4
ZYRO0C00814g7.21ON71382764.6
Kpol_1045.736.16ON962108757.0
TPHA0J015708.761ON1018136757.7
Skud_7.5795.80ON59736747.7
Ecym_55145.414ON854113748.0
CAGL0F08151g5.80ON59836748.0
TBLA0E044108.259ON1422115748.8
TBLA0A079103.38ON849181748.8
YGR246C (BRF1)5.80ON59636749.2
Suva_7.5415.80ON60036739.8
NCAS0A080305.619ON19936719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_11.334
         (1885 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...  3329   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...  2424   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...  2404   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...  2299   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   972   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   956   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   857   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   813   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   812   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   764   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   736   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   702   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   675   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   649   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   646   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   470   e-136
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   380   e-107
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   377   e-106
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   361   e-100
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   359   e-100
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   300   3e-81
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   276   5e-74
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   269   6e-72
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   254   2e-67
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   200   1e-50
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   174   1e-42
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   163   2e-39
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   124   2e-27
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    90   6e-17
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    47   4e-04
NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {O...    37   0.71 
KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {...    36   1.2  
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    35   1.9  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    35   2.0  
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    35   2.1  
CAGL0L04356g Chr12 (507792..510683) [2892 bp, 963 aa] {ON} highl...    35   2.5  
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    35   2.5  
KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {...    35   2.6  
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    35   2.8  
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    34   4.3  
KLTH0G12562g Chr7 (1066299..1068476) [2178 bp, 725 aa] {ON} simi...    34   4.4  
KNAG0M01430 Chr13 (249807..251963) [2157 bp, 718 aa] {ON} Anc_5....    34   4.4  
ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON...    34   4.6  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...    33   7.0  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    33   7.7  
Skud_7.579 Chr7 complement(957174..958967) [1794 bp, 597 aa] {ON...    33   7.7  
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    33   8.0  
CAGL0F08151g Chr6 complement(806209..808005) [1797 bp, 598 aa] {...    33   8.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    33   8.8  
TBLA0A07910 Chr1 (1951391..1953940) [2550 bp, 849 aa] {ON} Anc_3...    33   8.8  
YGR246C Chr7 complement(982482..984272) [1791 bp, 596 aa] {ON}  ...    33   9.2  
Suva_7.541 Chr7 complement(937649..939451) [1803 bp, 600 aa] {ON...    33   9.8  
NCAS0A08030 Chr1 (1586013..1586612) [600 bp, 199 aa] {ON} Anc_5....    32   9.9  

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 3329 bits (8631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1726/1885 (91%), Positives = 1726/1885 (91%)

Query: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60
            MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN
Sbjct: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60

Query: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120
            LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL
Sbjct: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120

Query: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180
            ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE
Sbjct: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180

Query: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240
            TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR
Sbjct: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240

Query: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300
            SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ
Sbjct: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300

Query: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360
            RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE
Sbjct: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360

Query: 361  CLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420
            CLR                     DFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV
Sbjct: 361  CLRLSSITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480
            INSFKERTDM             HTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL
Sbjct: 421  INSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480

Query: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540
            CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI
Sbjct: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540

Query: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXX 600
            ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKM      
Sbjct: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKV 600

Query: 601  XXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660
                         ISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL
Sbjct: 601  EELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660

Query: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720
            LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS
Sbjct: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720

Query: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780
            ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL
Sbjct: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780

Query: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840
            RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK
Sbjct: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840

Query: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900
            IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI
Sbjct: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900

Query: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960
            NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD
Sbjct: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960

Query: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020
            EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES
Sbjct: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020

Query: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080
            KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE
Sbjct: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080

Query: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140
            LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG
Sbjct: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140

Query: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200
            PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER
Sbjct: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200

Query: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260
            SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS
Sbjct: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260

Query: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320
            ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM
Sbjct: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320

Query: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380
            QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE
Sbjct: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380

Query: 1381 GEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXXXXXXX 1440
            GEKVAEDNNRSEMIKRSQEDA             NAISYSSTVRKLNEEIAT        
Sbjct: 1381 GEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQ 1440

Query: 1441 XXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTREVNKKIQEAQERLNQPSS 1500
                    TAAGHRDEDLSNIVESM               TREVNKKIQEAQERLNQPSS
Sbjct: 1441 GQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSS 1500

Query: 1501 VNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXX 1560
            VNIDEMKKQW                  LKKRIRLPT                       
Sbjct: 1501 VNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKL 1560

Query: 1561 XXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE 1620
                 SISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE
Sbjct: 1561 EEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE 1620

Query: 1621 LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP 1680
            LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP
Sbjct: 1621 LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP 1680

Query: 1681 PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLL 1740
            PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFN      GAFNPFTSPSPKKLL
Sbjct: 1681 PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSKSSSSGAFNPFTSPSPKKLL 1740

Query: 1741 QKDDVQKETSNNKTDPPTHLAPSFNIPATRVXXXXXXXXXXDTNDEELTVNEPGQKISSA 1800
            QKDDVQKETSNNKTDPPTHLAPSFNIPATRV          DTNDEELTVNEPGQKISSA
Sbjct: 1741 QKDDVQKETSNNKTDPPTHLAPSFNIPATRVLTSSSSTLSTDTNDEELTVNEPGQKISSA 1800

Query: 1801 INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNESKKIK 1860
            INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNESKKIK
Sbjct: 1801 INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNESKKIK 1860

Query: 1861 TDDEEEGKVNNEEKSEKDNDITGPE 1885
            TDDEEEGKVNNEEKSEKDNDITGPE
Sbjct: 1861 TDDEEEGKVNNEEKSEKDNDITGPE 1885

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 2424 bits (6282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1311/1900 (69%), Positives = 1529/1900 (80%), Gaps = 17/1900 (0%)

Query: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60
            MSD+   M+STQN+E   ERLN IASFFDCSLEQVKSID DI+T LN+KL+QFNELKSEN
Sbjct: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60

Query: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120
            +QITV+ DELKTNS KKI+ LKTEME+VLRQNDEIRKERNDTS+KFE +Q EK  LSNEL
Sbjct: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120

Query: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180
            ES+KRKL+DL+EEKKEIQS+QQRTLKILDERLKE+EM K  +N +++EC+ LRST++ELE
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240
            TKQQTYI+NDLNS+S+LER+TQELNLLQSNKDWLEKELSSK++QYLSYRQ+T+  ISEIR
Sbjct: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240

Query: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300
            ++LNR++NDFQLEKTNNDVL+QKNNELS  LQEK+L +K LSDS N+EK++FS EI LKQ
Sbjct: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300

Query: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360
            RLIDLLE+QLNAVKEEL + R+S+ S+V SDDS++LISENE LLKDL+LTK KL QCE+E
Sbjct: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360

Query: 361  CLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420
            CLR                     DFILLKKQ IKEKRAKE LQNQIESFIVELEHKVP+
Sbjct: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480
            INSFKERTD              HTSNEKNAKI+EL +KNEK+A+ +++IHIL++QRLDL
Sbjct: 421  INSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480

Query: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540
            CRQ+QYLL+TNSVSNDSKGPLRKEEIKFIQNILQND+S TTESDSQKI+T RLVEFR++I
Sbjct: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540

Query: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXX 600
            +LQEKN+ELLR+TRNLADKLESNE KSK  L  IEN+TINEAKEAIL+LQS+K+      
Sbjct: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600

Query: 601  XXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660
                            Q +S NNSVIQQLT+TKRELESQ QDLQARISQ+TREST+NMSL
Sbjct: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660

Query: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720
            LNKE+QD+YDSKS +SIELG+EKSSRILAEERFKLLSNTLDL KAENDQLRKRS +LQ++
Sbjct: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720

Query: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780
            ISKQDSKT ETLN+Y+SCKSKLS  ET LSNLKLE+ LKI+ EK+LKQEL +LSSEKTSL
Sbjct: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSL 780

Query: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840
             IMVTQLQTLQKERE+LLDE +KSCQNKI+ ++ A NELK E   KDQ+I QLEEDN SK
Sbjct: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840

Query: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900
            IEWYQNKIETL+KD++SVM+ +NEKQ E+E+ QY++KSLEKEIEENKIRLHTYNV+DE+I
Sbjct: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900

Query: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960
            NDDSLR+ELE SKINLT+AYSQIQEYKKLYE+T +SL+EM+S+LDESN+AFSNQIQ+LTD
Sbjct: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960

Query: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020
            EK +LEDKVSLL+EQ  NLNNELDLQ   MEK+K EFKK I+ILQNNNKEIE VK+EYES
Sbjct: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYES 1020

Query: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+GQV+TL L+R +
Sbjct: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080

Query: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140
             E  LKENE +W SQK+SLLEQLDLSNSRIEDLSSQNKLLY+QIELYT  GN   DA++G
Sbjct: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140

Query: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200
              LNNDIL+TLRRERDILDTKV VAERDAKMLRQKI+L+DVELQ+ARTKL NS+VEN++R
Sbjct: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200

Query: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260
            S I+QQHD +MEKLNQLNLLRESN TLRNEL++ + KNKELQSEL +L+  IAPIESEL+
Sbjct: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260

Query: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320
            ALK+S+QEKEQEIRL KEEVHRWKKRSQDI+EKHQQLSS DYEKLE+E+ESLKAQLEDK 
Sbjct: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320

Query: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380
            QQG ++EE+FNRLRRQAQEKLK SKL+Q++  EQLNELKDAK+ALE+SLN+AN RIQELE
Sbjct: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380

Query: 1381 GEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXXXXXXX 1440
              KVAE+ N+  MIK+ QED              NAISY STV+KLNEEI          
Sbjct: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQ 1440

Query: 1441 XXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTREVNKKIQEAQERLN---- 1496
                     AAG   +DLS +VESM               TREVN+KI+E QE       
Sbjct: 1441 RQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEET 1500

Query: 1497 --QPSSVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXX 1554
              +PS++NIDE+KKQW                  LKKRIRLPT                 
Sbjct: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEK 1560

Query: 1555 XXXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSIS 1614
                       SIS S +ME + QKQLE R+QEKQKELE+EYN+KLQEKL+E+  S  IS
Sbjct: 1561 EFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIIS 1620

Query: 1615 VNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIK 1674
             ++KD+LRA+IEA+LREE N ELQ +KKKSFEEGKQQA MKTTLLERKLAKMESQLSE K
Sbjct: 1621 SDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680

Query: 1675 QSAESPPKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSP 1734
            QS +SPPKH + +PNPLLGLPRKIEENSN P+N LLSGEKLLK N      G FNPFTSP
Sbjct: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSP 1740

Query: 1735 SPKKLLQKDDVQKETSNNKTDPPTHLAPSFNIPATRVXXXXXXXXXXDTNDEELTVNEPG 1794
            SP K LQ D+ ++E S+N+T+PPTHLAPSFNIPAT+           DTNDEE TVNE  
Sbjct: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGLNSSSSTLSTDTNDEERTVNE-- 1798

Query: 1795 QKISSAINSLSQTGSEQNQE--EELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEF 1852
            Q+ ++A + + Q    + QE  E L EI   +++++KSNKRPIDEV ELKDDDDE + + 
Sbjct: 1799 QEENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDS 1858

Query: 1853 TNESKKIKTDD-------EEEGKVNNEEKSEKDNDITGPE 1885
            TNE+KKIKTD+       +E+GKV+  +++E+ ND   PE
Sbjct: 1859 TNEAKKIKTDNEEEKEQQKEQGKVDVNDQNEEKNDNPSPE 1898

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 2404 bits (6231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1288/1856 (69%), Positives = 1500/1856 (80%), Gaps = 3/1856 (0%)

Query: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60
            MSD    M+S QN E + ERLN IASFF CSLEQVKS D D++  LN+KL+QFNELKSEN
Sbjct: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60

Query: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120
            L++TVSFDELK +SLKKIDGLKTEMENV+R+ND+IRKERNDT  KFE ++NEK++LS+EL
Sbjct: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120

Query: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180
            E VKRKL+DLTEEKKE QSNQQRTLKILDERLKE+E+ +VENNR+N+EC+ LRST+++LE
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180

Query: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240
            TKQQ YITNDLNSR+ELERKTQEL LLQSN DWLEKEL SK+EQYLSYRQ+TD  I +IR
Sbjct: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240

Query: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300
            +ELNRL+NDFQ+E+TNNDVLKQKNNELS SLQEK+L++K LSDSLN+EKQEFS E++LKQ
Sbjct: 241  NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ 300

Query: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360
            RL+DLLE+QLNAVKEEL SIR+ +++ V +DDS+K   ENE LLK+L+LTKEKLAQCE E
Sbjct: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKE 360

Query: 361  CLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420
            CLR                     DFI LKKQ IKE+R KE LQNQIE+FIVELEHKVP+
Sbjct: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480
            INSFKERTDM             HTSNEKNAK++ELN KN+K+ +CEND+  LT+QRLDL
Sbjct: 421  INSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480

Query: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540
            CRQ+QYLLITNSVSNDSKGPLRKEEI+FIQNI+Q D+S  TESDSQK++T RLVEF+N+I
Sbjct: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540

Query: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXX 600
            +LQEKN ELL++ RNLADKLES E KSKQ+L KIE++T+NEAKEAI++L+SEKM      
Sbjct: 541  QLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRI 600

Query: 601  XXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660
                         +  + +S++N  I+QLT+TKR+LESQVQDLQ RISQITREST+NMSL
Sbjct: 601  EELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660

Query: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720
            LNKEIQD+YDSKSDISI+LGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKR D LQ++
Sbjct: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720

Query: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780
            I KQDSKTHETLNEY+SCKSKLS+ ET L NLK EQKL++  EK+LKQEL+KLS EK SL
Sbjct: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSL 780

Query: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840
            RIMVTQLQTLQKEREDLL+E RKSCQ KI+E+E+A +ELK ETS KD HI QLEEDN S 
Sbjct: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840

Query: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900
            IEWYQNKIE LKKD +SV+  V+ KQT+IEKLQYKVKSLEKEIEE+KIRLHTYNVMDETI
Sbjct: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900

Query: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960
            NDDSLRKELE SKINLT+AYSQI+EYK LYE+T+QSL++ NSKLDES + F+NQI++LTD
Sbjct: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960

Query: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020
            EK +LEDK+SLLKEQ FNLNNELDLQK  MEK+K +FKK I+ILQNNNKE+E VKSEYES
Sbjct: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020

Query: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080
            KLSKIQ+DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+GQVKTL LSR +
Sbjct: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080

Query: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140
            LEN LKENEKSW+SQK+SLLEQLDLSNSRIEDLSSQNKLLY+QI++YTAA   V ++ NG
Sbjct: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140

Query: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200
            P LNN IL+TLRRERDILDTKVTVAERDAKMLRQKI+LMDVELQDARTKL+NSRVE +  
Sbjct: 1141 PGLNN-ILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENH 1199

Query: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260
            SSI+QQHD IMEKLNQLNLLRESNITLRNELEN + K KELQSEL KLK+ +APIESEL+
Sbjct: 1200 SSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELT 1259

Query: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320
            ALKYSMQEKEQE++LAKEEVHRWKKRSQDILEKH+QLSS+DYEKLESE+E+LK +LE+K 
Sbjct: 1260 ALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKE 1319

Query: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380
            +QG EAEE+FNRLRRQAQE+LKTSKL+Q++LTEQ+N L+DAK  LE SL++AN RI+EL+
Sbjct: 1320 RQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQ 1379

Query: 1381 GEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXXXXXXX 1440
              KVA+ NN+ E I++ QEDA             +  SY ST+  LNEEI T        
Sbjct: 1380 NAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQ 1439

Query: 1441 XXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTREVNKKIQEAQERLNQPSS 1500
                      + +   DLSNIVESM               T+EVN+KI EAQERLNQPS+
Sbjct: 1440 RQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSN 1499

Query: 1501 VNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXX 1560
            +N++E+KK+W                  LKKRIRLPT                       
Sbjct: 1500 INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKV 1559

Query: 1561 XXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE 1620
                 S+  S +++ +L+KQLE +VQEKQKELE+EYN+KLQE+LK+V HSS IS +E+D+
Sbjct: 1560 EERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDK 1619

Query: 1621 LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP 1680
            LRAEIE++LREE N+ELQ +KKKSF+EGKQQA MKTTLLERKLAKMESQLSE KQSAESP
Sbjct: 1620 LRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESP 1679

Query: 1681 PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLL 1740
            PK  NNV NPLLGLPRKIEENSNSPFN LLSGEKLLK N      G FNPFTSPSP K L
Sbjct: 1680 PKSVNNVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKLN-SKSSSGGFNPFTSPSPNKHL 1738

Query: 1741 QKDDVQKETSNNKTDPPTHLAPSFNIPATRVXXXXXXXXXXDTNDEELTVNEPGQKISSA 1800
            Q D+ ++E+  NKTDPPTHL PSFNIPA+R           DTNDEELT N P QK SS 
Sbjct: 1739 QNDNDKRESLANKTDPPTHLEPSFNIPASRGLISSSSTLSTDTNDEELTSNNPAQKDSSN 1798

Query: 1801 INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNES 1856
             N  S+  +E+ +E E  +     EE+TKSNKRPIDEV ELK+D+D D+ E  NES
Sbjct: 1799 RNVQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDED-DTTENINES 1853

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 2299 bits (5958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1258/1881 (66%), Positives = 1487/1881 (79%), Gaps = 13/1881 (0%)

Query: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60
            M D  + +KS QN +   ERL  IASFF  S EQV+SI++D+I  LN+KL+QFNELKSEN
Sbjct: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60

Query: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120
            LQITVSFDELKTNS KKID LK EMEN+++QND IRKER+DT  K E  +NEK ++SNEL
Sbjct: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120

Query: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180
            ES+KR+ +DL EEKKE+Q NQQRTLKILDERLKE+E+A+ +NNR++NEC+ LRST+++LE
Sbjct: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180

Query: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240
            TKQQ  IT+DLNSR+ELERK QELN+LQS  DWLEKEL SK+EQYLSYR++TD  I EIR
Sbjct: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240

Query: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300
            +ELN L++DFQ+EKT NDVL QKN+ELS SLQEK+L++K+LSD L++EKQEFSTEI LKQ
Sbjct: 241  NELNHLRSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQ 300

Query: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360
            RL+DLLE+QLNAVKEEL S R  ++SN    DS+K +SE E L+K+L+LTKE+LAQC+SE
Sbjct: 301  RLVDLLESQLNAVKEELDSTRGLETSN----DSKKHMSEKEDLVKELQLTKEELAQCKSE 356

Query: 361  CLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420
            C+R                     DFILLKKQ IKEKRAKE LQNQIESFI+ELEHKVP+
Sbjct: 357  CIRLSSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480
            INSFKERTD              HTSNEKNAKIREL+ K+EK+ +CENDI  L +QRLDL
Sbjct: 417  INSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476

Query: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540
            CRQVQYLLITNSVS DSKGPLRKEEI FIQNILQND+   TE+DSQKI+T RLVEFR++I
Sbjct: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536

Query: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXX 600
            ELQEKNTELL+I RNLAD+LESNE +SKQ+L KIE++TINEAKEAIL+L++EK       
Sbjct: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKV 596

Query: 601  XXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660
                         +S + +S  NS IQQL +TKR LE Q+QDLQ+ ISQITREST+NMSL
Sbjct: 597  EELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656

Query: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720
            LNKEIQD+YDSKSDISI+LGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKR D LQS+
Sbjct: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716

Query: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780
            I KQDSKT ETLNEYISCKSKL++ ET L NLK EQKLKIDSE++LKQE+ KLSSEKT L
Sbjct: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776

Query: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840
            RIMVTQLQTLQKERE+LLDE RKS QNKI+E+E A+NELK E SHKDQ I QLEEDN S 
Sbjct: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836

Query: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900
            IEWYQNKIE LKKDN+S++  +N+KQ EIEKLQ+KVKSLEKEI+ENKIRLHTYNV+D TI
Sbjct: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896

Query: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960
            NDDSLRKELE SKI+LT+AYSQIQEYK+LYE+ A+SL++M+SK +ES++ FSN+I++LT+
Sbjct: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956

Query: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020
            EK +LE+K+SLLKEQ FNLNNELDLQ   M+++K EF+K I+ILQNNNKE+E VKSEYES
Sbjct: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016

Query: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYR QV TLTLSR++
Sbjct: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076

Query: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140
            LE+ LKENE+SWTSQ+++L+EQL+ SNSRIEDL+SQNKLLY+QIELYT A  GV D  + 
Sbjct: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136

Query: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200
            P LN+ IL++LRRERDILDTKVTVAERDAKMLRQKI+LMD+ELQ+ARTKL+NSR+E ++R
Sbjct: 1137 PALNS-ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKR 1195

Query: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260
             +I+QQH+ IMEKLNQLNLLRESNITLRNELEN +++ + LQSEL KLK+ IAPIESEL+
Sbjct: 1196 PTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELA 1255

Query: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320
            ALKYSMQEKEQE+RL KEEVHRWKKRSQDILEKH+Q+SS+DYEKLE E++SLK +L++K 
Sbjct: 1256 ALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKT 1315

Query: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380
            +QG EAEERFNRLRRQAQE+LKTSKL+ +TLTEQ+N+LK+AK+ LE+SL+DANT+I+ELE
Sbjct: 1316 RQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELE 1375

Query: 1381 GEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXXXXXXX 1440
              K  +DNN+ + IKR Q+DA              A  Y ST++KLNEEI T        
Sbjct: 1376 NAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQ 1435

Query: 1441 XXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTREVNKKIQEAQERLNQPSS 1500
                    +   +   DLS IVESM               T+EVN+KI EAQERLNQPS+
Sbjct: 1436 RRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSN 1495

Query: 1501 VNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXX 1560
            +NIDE+K +W                  LKKRIRLPT                       
Sbjct: 1496 INIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKV 1555

Query: 1561 XXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE 1620
                  +S S QM+   QKQ EIR+QEKQKELED+YN    EKLKE+SHS+SIS++E+D+
Sbjct: 1556 EERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYN----EKLKELSHSNSISIDERDQ 1611

Query: 1621 LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP 1680
            LRAEIE K+R+EL++ELQ++KKKSFEEGKQQA MKTTLLERKLAKMESQLSE K+  ESP
Sbjct: 1612 LRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESP 1671

Query: 1681 PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLL 1740
             KH N+  N LLGLPRKIEENS+S FN LLSGEKLLK N      G FNPFTSPSP K  
Sbjct: 1672 SKHVNHTQNQLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKSS 1731

Query: 1741 QKDDVQKETSNNKTDPPTHLAPSFNIPATRVXXXXXXXXXXDTNDEELTVNEPGQKISSA 1800
            QK D Q+E + NK DPPTHL PSFNIPA R           DTNDEELT NE  Q  SS 
Sbjct: 1732 QKVDDQRELTTNKADPPTHLTPSFNIPAGRGLISSSSTLSTDTNDEELTGNE--QNNSSD 1789

Query: 1801 INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNESKKIK 1860
             N+  + G E+ +E+E  E K   E +T S+KRPIDEV ELKDDDDE SAEF+NE KK+K
Sbjct: 1790 GNTQLEAGIEKAEEKEFAEKKKEVEGETTSHKRPIDEVRELKDDDDEVSAEFSNEPKKVK 1849

Query: 1861 TDDEEE--GKVNNEEKSEKDN 1879
            TDDEEE   KV+NE K E +N
Sbjct: 1850 TDDEEEEKAKVDNERKDEGEN 1870

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1765 (38%), Positives = 1023/1765 (57%), Gaps = 113/1765 (6%)

Query: 21   LNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDG 80
            L  +++F+    +Q+  ID  I+T L  K++ FNELKS+NL++ V+ DE+KT S K+ +G
Sbjct: 23   LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEG 82

Query: 81   LKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSN 140
            LK E+EN+++ ND IR ER+    +      +K ++ NE+ES++ KL+DL +E++ ++ +
Sbjct: 83   LKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQD 142

Query: 141  QQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERK 200
            ++  + +L+E++KE+E  + E+ ++ ++ + LR  V+ELET  Q   + +L  +SE++  
Sbjct: 143  KREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTI 202

Query: 201  TQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVL 260
            TQ L +LQ N  WLE+E++SK+EQ +S R++ D  +  + SE    KN+ QLEK+ N V+
Sbjct: 203  TQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVI 262

Query: 261  KQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSI 320
              KN EL+ SLQEK++++K+LSDSL  EKQEF+ E+++KQ+LIDLLE Q+ +++ EL + 
Sbjct: 263  TTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNAS 322

Query: 321  RKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRXXXXXX----------- 369
               D+  + +   R   +ENE L+++L   KE   + E E LR                 
Sbjct: 323  LDKDNVELLASGERN--TENEKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDD 380

Query: 370  ---XXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKE 426
                              D  +LKK+ IKE+  KE+LQ Q+ESFIVELE+K+PVINSFKE
Sbjct: 381  INNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKE 440

Query: 427  RTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQY 486
            RT M             HTSNEK  + RE    ++K+   E+ IH LTRQR DL  QVQ+
Sbjct: 441  RTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQF 500

Query: 487  LLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKN 546
            LL+  SV  DS G L  EE+ FI+ I+ ND+   +ESDSQ++++ RLVEF N+  LQEKN
Sbjct: 501  LLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPN-SESDSQRVISERLVEFNNIATLQEKN 559

Query: 547  TELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXX 606
             ELL+  R LA+KLES E    + +   EN TI EAKEAI+SLQ                
Sbjct: 560  MELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKE 619

Query: 607  XXXXXXXISKQASSFNNSVIQQLTKTKRELES---QVQDLQARISQITRESTQNMSLLNK 663
                    S+  S  N S+    T+  R   S   +++ L+AR++ +T ES+QN  +LN 
Sbjct: 620  CDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNN 679

Query: 664  EIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISK 723
            EI ++Y SK+ ISIEL KE+SS+ L EER KL+ +TL+LT+ EN QL KRS +LQS   +
Sbjct: 680  EIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDR 739

Query: 724  QDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIM 783
            QDS+T ET+NE I+C SKL+V ET ++NL+ E++L   SE++ ++   KLS E+ SLRIM
Sbjct: 740  QDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIM 799

Query: 784  VTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEW 843
            V+QLQTLQ ERE  L E + + +  ++ +E+   + +     K +    +E    ++I+W
Sbjct: 800  VSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQIQW 859

Query: 844  YQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMD----ET 899
            YQ+K++++  ++  +   +  K   +  L+ +V+ LEK++EE++ R+ +Y V+     ET
Sbjct: 860  YQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSGSEVET 919

Query: 900  INDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLT 959
              + SLRKELE +KINL++ Y++I +YK L  +T +SL ++        +    Q+++L 
Sbjct: 920  SPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQLQVETLQ 979

Query: 960  DEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYE 1019
            +EK  L+D V+ L E    L   L       E +K   +K IA L+  +K    +K EY+
Sbjct: 980  NEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKGSHQLKEEYD 1039

Query: 1020 SKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRS 1079
            +++ K+Q DL+QQ  +AN AQ NYE+ELQK ++VSKTISELREQ    R  +  L  S  
Sbjct: 1040 AQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDRIAITRLKNSEE 1099

Query: 1080 ELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARN 1139
            ++  +L++NEKSW++QK+    QL+ S   +EDLS+QN LLY+QIEL++       D  N
Sbjct: 1100 QVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFSKDN---SDGVN 1156

Query: 1140 GPTLN-NDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVEND 1198
            G T    +IL  LRRERDIL TK+TV++R+ + LR  +  ++ EL   + +L+  + E  
Sbjct: 1157 GETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKRQLSQFQKEIT 1216

Query: 1199 ERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESE 1258
              S ++ QH+ I+E+LNQLNLLRESNITLRN  E  +KKN+ELQ EL +L+E I P+ESE
Sbjct: 1217 THSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESE 1276

Query: 1259 LSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLED 1318
            L+ L  S+ EK+Q++ L KEE +RWK+RSQ+IL KH ++   D+++L+ +V  L+ +L++
Sbjct: 1277 LNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDE 1336

Query: 1319 KMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQE 1378
              ++  E ++RFNRL++QA EKL +SK+ Q TL+ QLNEL++AK  LE        ++ E
Sbjct: 1337 TNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHE 1396

Query: 1379 LEGEKVAEDNNRSEMIKRSQE---DAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXX 1435
            L+ E++    N +E ++  Q+   DA                      +KLN+EI +   
Sbjct: 1397 LQ-ERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDS--L 1453

Query: 1436 XXXXXXXXXXXXXTAAGHRDEDLSNIVESMXXX------------XXXXXXXXXXXXTRE 1483
                         TA G   EDLSN+VESM                           T +
Sbjct: 1454 KLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFLKEKTEELKKLEEEKHTLQ 1513

Query: 1484 VNKKIQEAQERLNQPSSVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXX 1543
            VN       E   QP  VN +E+K+QW                  LKKRIRLPT      
Sbjct: 1514 VN-----GNEPQQQP--VNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPT------ 1560

Query: 1544 XXXXXXXXXXXXXXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEK 1603
                                              +++++  V++K+  LE+ Y +KL+E 
Sbjct: 1561 ----------------------------------EERIKQVVEKKKAALEELYKKKLEES 1586

Query: 1604 LKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKL 1663
               +  S   + + K +L  +++ K   E    +Q VKKK+FEEGKQQA MK+TLLERK+
Sbjct: 1587 KSSLESSDGNNSDLKKQLEKDLQEKFEAE----VQAVKKKAFEEGKQQAAMKSTLLERKI 1642

Query: 1664 AKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEENS----NSPFNTLLSGEKLLK-- 1717
            +K+ESQL     S +      ++VP P   LP KI+E S     S  N L+SGEK+LK  
Sbjct: 1643 SKLESQLHGKVDSPDKSSSETSSVPKP--NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLD 1700

Query: 1718 -----FNXXXXXXGAFNPFTSPSPK 1737
                 FN      G  NPFTS SP+
Sbjct: 1701 PSKPTFNFSSFSGG--NPFTS-SPQ 1722

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1774 (37%), Positives = 1027/1774 (57%), Gaps = 107/1774 (6%)

Query: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITR--LNEKLIQFNELKS 58
            MS++  L+ S+    G  E    IA F   S +++K +  D +    L  KL +FN L+S
Sbjct: 1    MSEKETLVGSS----GTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQS 56

Query: 59   ENLQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSN 118
             NL++  + DELK     K+D LK E E ++R+ND  ++ RN    +   L  EK     
Sbjct: 57   NNLRLHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALG 116

Query: 119  ELESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVE 178
            ++E+VK +L +  E+K  ++SN+Q  +K+L+E++ E+E +KVE+    N+ +NLR  ++E
Sbjct: 117  QMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLME 176

Query: 179  LETKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISE 238
             + + QT   N L  +SELE   Q++ +L  + +WLEKE++SK+EQ + YRQ  D  + +
Sbjct: 177  TQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQK 236

Query: 239  IRSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIAL 298
               E+ RLKND+QLEK++ + L +KN E+S  LQ K+ ++K LSD LNTEKQEFS E++L
Sbjct: 237  SLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSL 296

Query: 299  KQRLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCE 358
            KQ+L+DL + QL + KEEL+     +  N T  D+ +  ++    + DL   +++L +  
Sbjct: 297  KQKLLDLQDEQLQSFKEELRLTE--EKHNSTEADNLQ-STQQARFMDDLAQVRQQLEESN 353

Query: 359  SECLRXXXXXXXXX---------XXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIES 409
             E LR                              D  +LKKQ IKE+  KE LQ QIES
Sbjct: 354  HERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIES 413

Query: 410  FIVELEHKVPVINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCEND 469
            F+VELE+KVPVINS KER+               HTS+EK  K REL     KI + E +
Sbjct: 414  FVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEIN 473

Query: 470  IHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKIL 529
             H L RQR DL RQVQ+LL   ++ NDS+GPL  +E+ FI+ I++N+N  + ESDSQ I+
Sbjct: 474  THTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENP-SNESDSQSII 532

Query: 530  TGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSL 589
            T RLVEF+++  LQE+NTELL+  R LAD+LE  E  S   +  +E KTI+EAKEAI++L
Sbjct: 533  TERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITL 592

Query: 590  QSEKMXXXXXXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQ 649
            Q                       +S+ + SF+N       K  +E +  ++ L+ ++S 
Sbjct: 593  QERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQELIKSLEDKLST 652

Query: 650  ITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQ 709
            +T E+++N  LLN+EI+++Y SK+ ++I   KE+SSR LAE+R KLL +TL++TK EN +
Sbjct: 653  LTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAE 712

Query: 710  LRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQE 769
            L +RS  LQS +SKQ+++  ET+N+YISC+SKLSV E   +NL  E+ L   S  SL++E
Sbjct: 713  LIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRRE 772

Query: 770  LDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQH 829
            + K+S E+ SL +MVTQLQTLQ ERE+LL E++ S +  I ++E   +ELK E S KD  
Sbjct: 773  IQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNE 832

Query: 830  IMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIR 889
            I   E+   ++ +W+Q KI+ +  D   + + +  K   + +L+ +V  L+K+IEE+  R
Sbjct: 833  IKASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSR 892

Query: 890  LHTYNVMDETINDDS----LRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLD 945
            + +Y  +++  N ++    LRK+LE + I L  AYSQ +E+K++  +  ++L+ ++++ +
Sbjct: 893  IASYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFE 952

Query: 946  ESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQ 1005
            E  EA  +  +    EK+ LE  VS LK+    LNNE  LQKN  E++K E  K +  L+
Sbjct: 953  ERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLE 1012

Query: 1006 NNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLH 1065
            ++   +  VK EY+ KL ++Q DL+QQT YAN AQ NYE+ELQKHA+VSK IS+LR ++ 
Sbjct: 1013 SSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQ 1072

Query: 1066 TYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIE 1125
            + R +++ L  S  + + +L+  EKSW +QK  L   +D    +++++SSQNKLL++Q+E
Sbjct: 1073 SGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVE 1132

Query: 1126 LYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQD 1185
            L + +     + +  P  ++++L++LRRERDIL+TK+TV++R+ K+L QK   ++ EL +
Sbjct: 1133 LLSKSEREF-ENKLLPG-SSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAE 1190

Query: 1186 ARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSEL 1245
            AR KL   +  +   S I +QH+ IME+LNQ+NLLRESN+TLRN +    +KN +LQSEL
Sbjct: 1191 ARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSEL 1250

Query: 1246 VKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKL 1305
              L+  I P+ SELS  + S++EK+Q I L  +E  RWK+RS DIL +H+++   +Y KL
Sbjct: 1251 NHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKL 1310

Query: 1306 ESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVAL 1365
            E E+ +LK +LE K ++ T+  +RF RL++QA EKL  SK+ Q  L+ ++NEL+  K  +
Sbjct: 1311 EEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKM 1370

Query: 1366 ERSLNDANTRIQELE---GEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSST 1422
            E  L +  T++  LE    E+ +E  N +E ++   +DA                S    
Sbjct: 1371 EEILKETQTKVLNLEKLLTERDSESAN-NEDLRHELDDALERCKEIEVKLGETVGSSEGL 1429

Query: 1423 VRKLNEEIATXXXXXXXXXXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTR 1482
              +LNEEI +                T  G   + LSN+VESM               T 
Sbjct: 1430 TSQLNEEINS-LKEQVRIFKEKENDSTLEG--SQGLSNVVESMKKAFEEEKIKFIQEKTE 1486

Query: 1483 EVNKKIQEAQERLN-------QP-SSVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIR 1534
            E NKK +E + +L+       +P S+ +++ +KKQW                  LKKRIR
Sbjct: 1487 EYNKKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIR 1546

Query: 1535 LPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELED 1594
            +PT                                 E+++ +L K        ++ ELE+
Sbjct: 1547 MPTE--------------------------------ERIKKVLDK--------RKTELEE 1566

Query: 1595 EYNEKLQEKLKEVS-HSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQAT 1653
            E+    Q +LKE +         E++EL+ ++E++   +  + L + KKK+FEEGKQQA 
Sbjct: 1567 EF----QRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAA 1622

Query: 1654 MKTTLLERKLAKMESQLSEIKQSAESP-PKHANNVPNPLLGLPRKIEEN--SNSPFNTLL 1710
            MK+TLLERK++K+ESQL+    S+ +P P+ A       +GLP KI+E+   N    T  
Sbjct: 1623 MKSTLLERKISKLESQLN----SSNNPTPEKAAATS---VGLPTKIDESRTENMATGTPA 1675

Query: 1711 SGEKLLKFNXXXXXXGAF--------NPFTSPSP 1736
             GEK+LK +       AF        NPFTS  P
Sbjct: 1676 FGEKVLKLS----DKPAFSFQPSSKSNPFTSALP 1705

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1413 (39%), Positives = 890/1413 (62%), Gaps = 47/1413 (3%)

Query: 21   LNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDG 80
            +  I+SF +    +V ++D  ++ +L+ K  QF +LK++NL+ +V+ DELK++S ++ + 
Sbjct: 18   VTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEA 77

Query: 81   LKTEMENVLRQNDEIRKERNDT-SAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQS 139
             K ++E +    + +RKE++     KF+ + +EK   S E+  +K +L +L ++ +  +S
Sbjct: 78   FKLQLEKINENTESLRKEKDAFEDEKFKLI-DEKANASKEVNLLKSQLTELKQQNEIFRS 136

Query: 140  NQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELER 199
            ++Q  +++L+E++ ++E ++ E  +     + LR  V+ELE + QT+ +NDL  ++E++R
Sbjct: 137  SKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQR 196

Query: 200  KTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDV 259
             TQE+NLL+SN  WLEKEL+SKSE++ SYRQR ++ +    SELN ++++ ++E++++  
Sbjct: 197  LTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQT 256

Query: 260  LKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKS 319
            LK + N+LS  LQ+K+ +LK+L DS + EKQEF+ E+ LKQRLIDLLE Q+ + K EL+S
Sbjct: 257  LKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELES 316

Query: 320  IRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLR---------------- 363
             R    SN    D+     E E ++++L  TK+KL   ES+ ++                
Sbjct: 317  ARNKSVSNSDHVDA-----EREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERG 371

Query: 364  XXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINS 423
                                 D  LLKK+ I+E+R KEQLQ Q+E+F++ELEHKVPV+NS
Sbjct: 372  AGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNS 431

Query: 424  FKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQ 483
            FKERT+M              TS +K  K  EL     KIA  E  IH L RQR DL  Q
Sbjct: 432  FKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQ 491

Query: 484  VQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQ 543
            VQ+LLI  SV NDS GPL  EE  FI+ I+ N +    E D+Q+I++ RLV F +++ELQ
Sbjct: 492  VQHLLIQVSVRNDSNGPLTPEETNFIKKII-NSSESPVEQDAQRIISERLVRFESMVELQ 550

Query: 544  EKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQS-----EKMXXXX 598
            EKN ELL   RNLADKLE+ E +SK    ++E++T+ EAKEAIL+LQ      E      
Sbjct: 551  EKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEII 610

Query: 599  XXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNM 658
                            S   S+ N+S  + L       E ++++L+  +S +T ES +N+
Sbjct: 611  AKERDAFKILASDKGTSNGPSNVNSSENRHLVLA----EEKIKELENHLSSLTEESAKNI 666

Query: 659  SLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQ 718
             LLN+EI  +Y +++D S+ L KE+SSRILAE+R KL+SNTL++TK END+LRKR  SLQ
Sbjct: 667  KLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQ 726

Query: 719  SSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKT 778
             +I KQDSKT +T+   ISCKS+LS  ++ L+N + E+ L    +++LK+E + LS E+ 
Sbjct: 727  ENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERN 786

Query: 779  SLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNT 838
            ++RI++TQLQTLQ ERE LL+E +K+ Q K N++E   ++   +   K + I        
Sbjct: 787  NMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKD 846

Query: 839  SKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMD- 897
            S+ +WYQ K + L ++ ++    ++ K T+I+ L+ KV+SL  ++EE++ R+  +N ++ 
Sbjct: 847  SQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNY 906

Query: 898  -ETIND--DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQ 954
             E++    ++LR+ELE ++I L +AYSQ+++YK + +S+ +S   +   L++S   ++ +
Sbjct: 907  SESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEK 966

Query: 955  IQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETV 1014
            I++LT E+   +D+V +LK+Q  NLNNEL+ QK++ E +  ++ + +  L+    E++ +
Sbjct: 967  IETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNM 1026

Query: 1015 KSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTL 1074
            K+EYE K+SKIQ+DL+QQT YANTAQ NYEQELQKHADVSK IS LR +   Y+ + +TL
Sbjct: 1027 KAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETL 1086

Query: 1075 TLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGV 1134
              +    +  L+++E SW  Q     ++L L++ RIEDL++Q+K+LY+QI+ + + G   
Sbjct: 1087 RNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQID-FLSKGKPT 1145

Query: 1135 GDARNGP--TLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNN 1192
                  P  T   ++L +LRRE+DIL+TK+ V+ R+ K+LRQK+ L++ +L+ +R +L+ 
Sbjct: 1146 SSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSK 1205

Query: 1193 SRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEII 1252
             +      S+ ++  + IM +LNQLNLLRESNITLRNE +   ++++EL++EL  L   +
Sbjct: 1206 LQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKV 1265

Query: 1253 APIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESL 1312
             P+ES+++ L+ S++EK+ +I L  EE  RWK+RSQDIL K++++   +++KL  +V  L
Sbjct: 1266 QPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSEL 1325

Query: 1313 KAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLN-- 1370
            + +++ K  +  E + RF RL++QA EKL  +K  Q TLT QLN+LK  K  LE  L   
Sbjct: 1326 QQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQ 1385

Query: 1371 -----DANTRIQELEGEKVAEDNNRSEMIKRSQ 1398
                 +  ++I ++E  K +E N+  E ++ SQ
Sbjct: 1386 KEEVKNLESKITDIEKNKSSEKNDLQEQLENSQ 1418

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 122/269 (45%), Gaps = 67/269 (24%)

Query: 1489 QEAQERLNQPSSVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXX 1548
            Q A ++L+ P  VNIDE+KK+W                  LKKRIRLPT           
Sbjct: 1529 QLATQKLDPP--VNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPT----------- 1575

Query: 1549 XXXXXXXXXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVS 1608
                                         ++++   V++K+ ELE E+   +Q+K +E++
Sbjct: 1576 -----------------------------EEKINKIVEKKRLELEAEFEANVQKKAEEIA 1606

Query: 1609 HSSSISVNEKDELRAE-------IEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLER 1661
             S S S +   E+  +       ++ +++++ ++++  +KK++FEEGKQQA+MK+T LE+
Sbjct: 1607 KSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEK 1666

Query: 1662 KLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEENSNSPF----NTLLSGEKLLK 1717
            K+AK+E+Q   IK    + P + N+   P    P   +    +P       +L G K L 
Sbjct: 1667 KIAKLETQ---IKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPG-KPLP 1722

Query: 1718 FNXXXXXXG---------AF-NPFTSPSP 1736
            FN      G         +F NPF S  P
Sbjct: 1723 FNPAHFAFGMPFGQTTSNSFQNPFNSQPP 1751

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/1915 (33%), Positives = 1027/1915 (53%), Gaps = 189/1915 (9%)

Query: 10   STQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDE 69
            ST  +    E L +I SF    +EQ+ +I+T I++ L  K+ QF EL+S++L+  VS +E
Sbjct: 2    STAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEE 61

Query: 70   LKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLND 129
            L+  S  +I+ L+T++E+++ QN    +E+     +    + E  QLS+  ++++ +L +
Sbjct: 62   LQKTSQGRINDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKE 121

Query: 130  LTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITN 189
            + E+   +Q   Q T+K+LD ++ + E+ K    +  N+ R   +   +LE + Q+   N
Sbjct: 122  IQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYN 181

Query: 190  DLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKND 249
            D  + + + + +Q+L  +   K+ LE EL +K ++   Y     A I  +R +++ L+N+
Sbjct: 182  DSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENN 241

Query: 250  FQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQ 309
              + K+ ND LK++N  +S++L EK   ++ L++  NTEK+E   E++LKQ +ID+L+TQ
Sbjct: 242  CSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQ 301

Query: 310  LNAVKEELKSIRKSDSSNVTSDDSR---------KLISENESLLKDLRLTKEKLAQCESE 360
            +  ++++   I  +    V +D+ R         KLI     L K+L   +    Q ES 
Sbjct: 302  VQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNKELEERRNITMQTESS 361

Query: 361  CLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420
             L                      D   +KK+ I+E+  KE+LQNQ+E FIVELE KVP 
Sbjct: 362  TL----------------SNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPT 405

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480
            INSFK+RTDM             +   EKN    EL+   +     + +   LT+QR DL
Sbjct: 406  INSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDL 465

Query: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540
              Q+QY+LI  SV NDS GPL  EE++FIQ+IL N+ S    SDSQ++++ RLV F+N++
Sbjct: 466  AHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNE-SNEESSDSQQVISERLVTFQNIV 524

Query: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXX 600
            ELQ+KN +LL+  R LA KLE  E   +     +E + I+EAKEAI+SLQS         
Sbjct: 525  ELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQS--------- 575

Query: 601  XXXXXXXXXXXXXISKQASSFNNSV--IQQLTKTKRELESQ-----------VQDLQARI 647
                         +  +  + N+ +   + L K   ++E++           +++L+ R+
Sbjct: 576  ---------YNTKLEDKIKTLNDELDCYKSLPKPDTKVETEHLRLNEENTDLIKELETRL 626

Query: 648  SQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAEN 707
            +    ES +  + LN EI DI  + S    E   E++SR LAE+R KL+ N+L L+K EN
Sbjct: 627  ATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVEN 686

Query: 708  DQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLK 767
            +QL+KR + LQ    KQD +T ETL EY+SCK  LS ++  L+ ++ +  +   +EKSLK
Sbjct: 687  EQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLK 746

Query: 768  QELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKD 827
             ++  +S E+  L+ +V+QLQ+LQ ERE + +  +   Q +++ VE    ++  +  +KD
Sbjct: 747  DDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKD 806

Query: 828  QHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENK 887
            + I +LE +  S+IEWYQNKI+ +K+  D+  + + EK  EI +L Y++K L+K+++ ++
Sbjct: 807  REIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASE 866

Query: 888  IRLHTYNVMDETIND----DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSK 943
             R+  Y V++ + N     ++L+ ELE SKINL+EAY+++ +YK+      + L    + 
Sbjct: 867  SRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNT 926

Query: 944  LDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAI 1003
            ++E+ + F  +I++L  ++  L D  S+L EQ  +LNNELD Q     ++K E  K +  
Sbjct: 927  VEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNE 986

Query: 1004 LQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1063
            L   N  IE V ++YE KLS +Q+DL+QQ  YAN AQNNYEQELQKHA+++KTIS+LRE 
Sbjct: 987  LLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLRED 1046

Query: 1064 LHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQ 1123
             HTYR ++ ++  + +  E +L++NEK W  Q++S  +Q+     RIEDLSSQNKLL++Q
Sbjct: 1047 AHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQ 1106

Query: 1124 IELYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVEL 1183
            ++L + + N   + ++  T N D++++LR +RDIL T+++V E + K LR K++ ++ EL
Sbjct: 1107 VDLLSKSENSY-NQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTEL 1165

Query: 1184 QDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQS 1243
             + R KL   R + +     V++HD IM +LNQLNLLRESNITLRNE  +  +K K+LQ 
Sbjct: 1166 TNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQE 1225

Query: 1244 ELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYE 1303
            +L  L+E + P+E+E + LK  ++E EQ++   KEE +RWK+RSQDIL KH+++   ++E
Sbjct: 1226 DLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHE 1285

Query: 1304 KLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKV 1363
            KLE+E+ +LK  L DK ++  E  +RFNR+++QA E+L +SK TQ+TL +Q+ +L+D   
Sbjct: 1286 KLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENA 1345

Query: 1364 ALERSLNDANTRIQELEGEKVAEDNNRSEMIK--RSQ-EDAXXXXXXXXXXXXXNAISYS 1420
             ++  L      IQ  E EK  + N +SE +   RSQ E+A             +  S  
Sbjct: 1346 HIQSLLETERGNIQNTE-EKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSD 1404

Query: 1421 STVRKLNEEIATXXXXXXXXXXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXX 1480
                 LN+ I +                T  G    DLSN+VE M               
Sbjct: 1405 EISSHLNDVIDSLNNELTHLKESKNNEATVTGQ--PDLSNVVEEMKKSFEEEKIKFVQDQ 1462

Query: 1481 TREVNKKIQEAQERLNQPSS----------VNIDEMKKQWXXXXXXXXXXXXXXXXXXLK 1530
            T E  +K+ E  +R+   ++           +I   ++QW                  LK
Sbjct: 1463 TTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLK 1522

Query: 1531 KRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQK 1590
            +RIRLPT                                 E++ +++QK        K+ 
Sbjct: 1523 RRIRLPTE--------------------------------EKINSVIQK--------KKN 1542

Query: 1591 ELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQ 1650
            ELE EY+EK+ ++ KE+  S       +D L+ +I+ +L   ++ EL+N K K+FEEGKQ
Sbjct: 1543 ELEKEYDEKVNQRAKELLSSEENKTFIED-LKNDIKKELERNIDQELKNAKAKAFEEGKQ 1601

Query: 1651 QATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNV------PNPLLGLPRKIEENSNS 1704
            QA MKTT LE+K++K+ESQL    Q + +  ++ N+V      P+    +P K EE  + 
Sbjct: 1602 QAMMKTTFLEKKISKLESQL----QGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSK 1657

Query: 1705 P-------FNTLLS-GEKLLKFNXXXXXXG------AFNPFTSPSPKKLLQKDDVQKETS 1750
            P        N LLS G   L  N             + NPFTSP             + +
Sbjct: 1658 PQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNGSDSSNPFTSPF------------QQT 1705

Query: 1751 NNKTDPPTHLAPSFNIPATRVXXXXXXXXXXDTNDEELTVNEPGQKISSAINSLSQTGSE 1810
             N  + P    P+F                         + EP +   S      Q+ SE
Sbjct: 1706 KNDANIPAVTQPAF------------------------LLREPSEPNMSVSTISRQSTSE 1741

Query: 1811 QNQEEEL-FEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTNESKKIKTDDE 1864
             N E EL    + +A   T S+KRP  E      D +E+  +     KK KT+ E
Sbjct: 1742 TNTESELPVSSEGLA---TPSSKRPAQE------DTEEEKLDAETPKKKSKTEPE 1787

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1373 (38%), Positives = 845/1373 (61%), Gaps = 39/1373 (2%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            +A+F +    +V+ +D  ++T    K  +F+++K++N+++++S D LK N  +KI+  K 
Sbjct: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143
            ++E +L      ++E+  T  +   L NEK QLS E+  ++ ++ +  +  + I S +Q 
Sbjct: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137

Query: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQE 203
              K+L+E++ ++  +K E++R     + LR + ++LE   Q Y + +L  +SE++R  QE
Sbjct: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197

Query: 204  LNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQK 263
            LNL++SN DWL KEL SK+EQ  S+R++T++ +     ++N LK+  +  + NN  LK K
Sbjct: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257

Query: 264  NNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKS 323
              ELSN LQEK+++ K L+D LNTEK+EF+ E++LKQRLIDLLE+Q++++K +L++  +S
Sbjct: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQS 317

Query: 324  DSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRXXXX---------------- 367
             + N  S        E + LL +L  TK+ L   ++E ++                    
Sbjct: 318  ANQNGMS------TPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371

Query: 368  ----XXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINS 423
                                 D  +LKKQ ++E+R KE+LQNQ+ESF+VELEHK+P++NS
Sbjct: 372  NSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNS 431

Query: 424  FKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQ 483
            FKERTDM              T+ +++ K  ELN    KI   E+ +  L  QR DL  Q
Sbjct: 432  FKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQ 491

Query: 484  VQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQ 543
            VQYLL+  SV +D+ GPL ++E++F++ I+ +++    +SD+Q I++ RLV+F++VIELQ
Sbjct: 492  VQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAP-KSDTQGIISERLVQFKSVIELQ 550

Query: 544  EKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQS--EKMXXXXXXX 601
             KN ELL   R LADKLE  E KS+  L  +E +T+ EAKEAILSLQ   +++       
Sbjct: 551  SKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIV 610

Query: 602  XXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLL 661
                         +KQ  S  +S  Q      ++L+  + +L+ R+  +  +S  N+ LL
Sbjct: 611  SKERDAFKLANSANKQGDSAPSSTYQ-----SKKLDEHIMELEKRLKNLAEQSQDNIKLL 665

Query: 662  NKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSI 721
            N EI+ +Y +KS++++ L +E+SS++LAEER KL+ +TL LTK EN +L KRSD LQ  +
Sbjct: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725

Query: 722  SKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLR 781
             KQD KT  T++E I+ KS+LS   + L+ L  E+      E  LK E + L+ E T+ +
Sbjct: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785

Query: 782  IMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKI 841
            I+V+QLQTLQ+ER+ LL+EA+ + +  I ++E   +E +     + +   +    +TS+ 
Sbjct: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845

Query: 842  EWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM----D 897
            +W+Q K+++L +  D+    + EK   IE LQ   KSL  ++EE ++R  +Y+V+    D
Sbjct: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905

Query: 898  ETINDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQS 957
             T   ++LRK LE + INL +AYSQI++YK + + + QS  E++  L+ES   +   I  
Sbjct: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIAL 965

Query: 958  LTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSE 1017
            L  E+ +L D+++LL +Q  +LN+ELD QK++ + +K E  K ++ILQ + + ++ +KSE
Sbjct: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025

Query: 1018 YESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLS 1077
            YE K+SK+Q+DL QQ  YAN AQ NYEQELQKHADV+KTIS LRE+   Y+ +++    S
Sbjct: 1026 YEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085

Query: 1078 RSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDA 1137
             SE ++ L+ NE+SW  Q   L  QL L+  R E+L++QN+LLY+Q+EL + A +   +A
Sbjct: 1086 ASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEA 1145

Query: 1138 RNGPTL-NNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVE 1196
                +  + ++++TLRRERDIL+TK+ V+ R+ K+LRQ++ L   EL++ R + + ++  
Sbjct: 1146 AASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQAT 1205

Query: 1197 NDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIE 1256
              +     +  + IMEKLNQLNLLRESN+TLRNE +   ++++  Q+E+ KL+E + P+E
Sbjct: 1206 APDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLE 1265

Query: 1257 SELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQL 1316
            S+L +L  ++ E++Q+I L KEE  RWK+RSQDIL K++++   +++KL  EV  LK +L
Sbjct: 1266 SQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNEL 1325

Query: 1317 EDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSL 1369
            E K  +  E++ERF +LR+QA E+L   K  +  +  +   +  AK  LE  L
Sbjct: 1326 EKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAEL 1378

 Score = 53.5 bits (127), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 1628 KLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP---PKHA 1684
            KL  + +++L  V+KK+FEEGKQQ  MK  LLE K+AK+E Q ++I  +   P   P   
Sbjct: 1625 KLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDN 1684

Query: 1685 NNVPNPLLGLPRKIEENSNSPFNTLLS 1711
            NN  +P    P  I+    SPF     
Sbjct: 1685 NNNSSPQGAQPIAIKP---SPFQVAFG 1708

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1818 (33%), Positives = 980/1818 (53%), Gaps = 166/1818 (9%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            IA+F +     V+S+  ++   +  K  +F +L+S+NL+  V  +E K N   K + LK 
Sbjct: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQ---NEKIQLSNEL----ESVKRKLNDLTEEKKE 136
            E++ V+  N ++R E    S K   L+   N K+   N+L    E ++  ++   E  KE
Sbjct: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128

Query: 137  IQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSE 196
            +  +        DE++ E+E  + E      + + L   ++ELE K Q Y +++LN +SE
Sbjct: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181

Query: 197  LERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTN 256
            LER  QE+ LL+ N++WLE+EL++K++ ++ YR++TD  + +  + + +LK+D ++EK++
Sbjct: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSS 241

Query: 257  NDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEE 316
             ++L +K +E +  LQ  +++ K+L D L  EKQEF  E+++K +LI L E Q+ +++  
Sbjct: 242  KEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301

Query: 317  LKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRXXXXXXXXXXXXX 376
            L+   K+  +N   ++S +++   +SL ++L L + KL   E +C+R             
Sbjct: 302  LQQKFKTAEAN--EENSSEVV---KSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVS 356

Query: 377  XXX-----------------------------XXXXXDFILLKKQYIKEKRAKEQLQNQI 407
                                                 D  +LK+Q ++EKR KE+LQNQ+
Sbjct: 357  LQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQV 416

Query: 408  ESFIVELEHKVPVINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCE 467
            ESF++ELEHK+PVINSF+ERT +             H + E   K  EL    +KI+   
Sbjct: 417  ESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDN 476

Query: 468  NDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQK 527
            + + IL RQR DL  Q+QYLLI  S+ ND+   L ++EIKFI+N++ NDN  +T +DSQK
Sbjct: 477  SQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMAST-NDSQK 535

Query: 528  ILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQ---NLLKIENKTINEAKE 584
            +++  L++F+++ +LQEKN EL++  R LA +LE NE K K    N +  +N+   EAKE
Sbjct: 536  VISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKE 595

Query: 585  AILSLQSEKMXXXXXXXXXXXXXXXXXXXISK-QASSFNNS-VIQQLTKTKRELESQVQD 642
            AIL+L+                       +S+ +  +F +S  + +  + K   E+ V+D
Sbjct: 596  AILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKD 655

Query: 643  LQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDL 702
            L+ R++Q+T +S  +   L +E+  ++   S +++++ K +S++ LAEER K+  N+++L
Sbjct: 656  LENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMEL 715

Query: 703  TKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDS 762
               EN+QLR RS  L+ S+ +QD +T +T + Y+   SK S  ET++ NL+ E  L  D 
Sbjct: 716  LSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDR 775

Query: 763  EKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVE 822
            E SLK EL   + EKT LRIMVTQLQ+LQ ERE LL+  +   + +I+EV     +L  +
Sbjct: 776  EISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQ 835

Query: 823  TSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKE 882
             S +   I ++E++  ++ EWYQ KI+   +    +   +  K  E+E+L  + K+LEKE
Sbjct: 836  LSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKE 895

Query: 883  IEENKIRLHTYNVMDETIN--------DDSLRKELEMSKINLTEAYSQIQEYKKLYESTA 934
            +E  +IR+HTY    ETIN        ++ + KELE +KI L +AYSQ++E+K L +++ 
Sbjct: 896  LEGAQIRIHTY----ETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSE 951

Query: 935  QSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKK 994
             +L+E+N+  +  +  + + I++LT+EK  +E +  +LK+Q  N+ NEL +Q  E E ++
Sbjct: 952  DALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESER 1011

Query: 995  VEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVS 1054
                + IA LQ   + IE VK  +E KL K+++DL++QT+YAN AQ NYEQELQ+HADVS
Sbjct: 1012 KRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVS 1071

Query: 1055 KTISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLS 1114
            KTISELREQ    +   K+LT     L++ + +NEK   S++     Q+DL+  RI+D++
Sbjct: 1072 KTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDIT 1131

Query: 1115 SQNKLLYNQIELYTAA----GNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAK 1170
             QN+LLYNQI+L   A     N   D  NG T    ++++LRRERDILDTK+ V E +  
Sbjct: 1132 KQNQLLYNQIDLLNRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETEKN 1188

Query: 1171 MLRQKITLMDVELQDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNE 1230
             L+QK+  +  EL++ +        E  E S ++  +  I   L QLNLLRESN+TLRNE
Sbjct: 1189 SLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNE 1248

Query: 1231 LENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDI 1290
            L+    +  ++  +L   +  + P++S L +    ++EK+ +I  A +E  RWK R +++
Sbjct: 1249 LKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEM 1308

Query: 1291 LEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQET 1350
            +EKHQ+++ +DY KLE  +   K  L++K+Q+  E  +RFNRL++QA EKL TSK  Q +
Sbjct: 1309 IEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSS 1368

Query: 1351 LTEQLNELKDAKVALERSLNDANTRIQELEGEKVAEDNNRSEM-----IKRSQEDAXXXX 1405
            L EQ++ L   K  + + L D  T   E   E ++E NN  E        R + +     
Sbjct: 1369 LQEQISNLISEKDDIRKQL-DVKT---EENSELLSELNNFREKQNDLETLREELNKEISK 1424

Query: 1406 XXXXXXXXXNAISYSSTV-RKLNEEIATXXXXXXXXXXXXXXXXTAAGHRDEDLSNIVES 1464
                     N I  SS   R  N+EI                  T A   DE  +  VE+
Sbjct: 1425 SEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDA---DEQTNRNVEA 1481

Query: 1465 MXXXXXXXXXXXXXXXTREVNKKIQEAQERLN-------QPSS---VNIDEMKKQWXXXX 1514
            +               T E NK++ E  E++        +P +   V+++ ++KQW    
Sbjct: 1482 IKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDS 1541

Query: 1515 XXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSISGSEQME 1574
                          LKKRIRLP+                                 E++ 
Sbjct: 1542 EELIQKRIAEAEDNLKKRIRLPSE--------------------------------EKIN 1569

Query: 1575 AMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEV---SHSSSISVNEKDELRAEIEAKLRE 1631
             +++K        ++ ELE E+++K+++K +++    HS+  +    +EL+  +E +L+E
Sbjct: 1570 KIIEK--------RRSELESEFDQKIRDKARDLLMNDHSNEFN----NELKEALEKELKE 1617

Query: 1632 ELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPP--KHANNVPN 1689
               DELQ  +KK+FEEGKQQATMKTTLLERK+ K+ESQ+ E ++ +E     K   N   
Sbjct: 1618 RFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTP 1677

Query: 1690 PLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLLQKDDVQKET 1749
             +  +P  +  +  S  N+  +  K+LK           +PF + S             T
Sbjct: 1678 SVKKIPETLNSSDTSFGNS--NNVKVLK---------PSSPFGATSAFN-------NPFT 1719

Query: 1750 SNNKTDPPTH---LAPSF 1764
             NN  +PP      AP+F
Sbjct: 1720 FNNNGNPPAFASAFAPTF 1737

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1371 (35%), Positives = 832/1371 (60%), Gaps = 19/1371 (1%)

Query: 11   TQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDEL 70
            +Q E   +E  + +ASF +   E + ++   +  ++  K+ +F +L++ENL+ +V+ DEL
Sbjct: 8    SQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDEL 67

Query: 71   KTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDL 130
            +++S  K+   K ++ ++L++ + +R E      +      E+ +  N+ ++++ +   L
Sbjct: 68   RSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEAL 127

Query: 131  TEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITND 190
             ++K+ +++N+    ++L+E++ ++   + E  R   E R LR   +ELE + + Y + +
Sbjct: 128  EQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEE 187

Query: 191  LNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDF 250
            L  +++  + +Q+++LL +N +WLE +L+ K+ ++ +YRQRT + ++ +   L   + D 
Sbjct: 188  LKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDL 247

Query: 251  QLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQL 310
            Q        L+++N +  + L+ +   +K L+D L + KQEF+ E++LKQRL++LLE Q+
Sbjct: 248  QAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQV 307

Query: 311  NAVKEELK---SIRKSDSSNVTSDDSR---KLISENESLLKDLRLTKEKLAQCESECLRX 364
            +A+K EL+   S + S  +  T   S+   +L+ + + L ++  L  +KL Q   + L  
Sbjct: 308  SALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQL-EESELKIQKLEQTVEQLL-- 364

Query: 365  XXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSF 424
                                D  +LKKQ I E+R KE LQNQ+E+F+VELE+KVP+++SF
Sbjct: 365  --SADEKTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSF 422

Query: 425  KERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQV 484
            K+R D+               S +K+    +L     +I   E+ I  LT+QR DL RQV
Sbjct: 423  KDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQV 482

Query: 485  QYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQE 544
            QYLLI  +V  DS GPL  EE  F++ ++  +N+   + D+Q I++ RLVEF+N++ELQ 
Sbjct: 483  QYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQP-DGDAQGIISERLVEFKNIVELQA 541

Query: 545  KNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXX 604
            KN +LL   RNLA++LE+ E K K     IEN TI EAKEAI++LQ              
Sbjct: 542  KNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVIT 601

Query: 605  XXXXXXXXXISKQASSFNNSVIQQL-TKTKRELESQVQDLQARISQITRESTQNMSLLNK 663
                      S+ +   +N  ++ +  K     + ++++L+  +S   RE+  N+ LL  
Sbjct: 602  RERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMT 661

Query: 664  EIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISK 723
            E Q++  SKS++ + + KEKSSR+LAEER K+  ++L LTK EN++L KR   L+++++K
Sbjct: 662  ENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAK 721

Query: 724  QDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIM 783
            QD++T ET++E I CKS+L+     L N   ++ L   S + LK+  ++L+ E+  L I+
Sbjct: 722  QDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTIL 781

Query: 784  VTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEW 843
            VTQLQTLQKER+ LL ++  + + KI+ +E   ++L+   S K   +      + S+  W
Sbjct: 782  VTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRW 841

Query: 844  YQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDET---- 899
            YQ KI+ L +   S  + +N K   I++LQ +   L  ++ + + +  +Y+V+++T    
Sbjct: 842  YQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVL 901

Query: 900  INDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLT 959
               D+LR ELE ++INL +A+SQ+ EYK LY ST ++L  M + L+ S +  + ++++L 
Sbjct: 902  TQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLK 961

Query: 960  DEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYE 1019
             E+  L +  ++LK+Q  NLN+ELD QKN +E  K E  K    +++N   + ++K +Y+
Sbjct: 962  KERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQ 1021

Query: 1020 SKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRS 1079
             +LSK+ +DL+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   ++ +V +L  S +
Sbjct: 1022 LELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASIT 1081

Query: 1080 ELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARN 1139
            EL+  L+ENE  W +QKQ    Q  LS+ RIEDLS+QN+LL++QI L       + D   
Sbjct: 1082 ELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELK 1141

Query: 1140 GPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDE 1199
                  +++ TL+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S+V +D 
Sbjct: 1142 SEA--RELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDT 1199

Query: 1200 RSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESEL 1259
            RS +++++  I+E+LNQ+NLLRESNITLRNEL+  S++N++L+  + +L+E + P+E+++
Sbjct: 1200 RSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDI 1259

Query: 1260 SALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDK 1319
              L+ S+  K+++I L  EEV+RWK+RSQDIL K++++   +++KL  E+   +A+    
Sbjct: 1260 LTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAAN 1319

Query: 1320 MQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLN 1370
             QQ +E E+RF RL++QA+E+L  ++ TQ TL  +L E ++++ ALE +L+
Sbjct: 1320 AQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALD 1370

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 103/241 (42%), Gaps = 70/241 (29%)

Query: 1500 SVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXX 1559
            S +I+ +KK+W                  L+KRIRLPT                      
Sbjct: 1520 SSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPT---------------------- 1557

Query: 1560 XXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKD 1619
                          E  + K +E R    ++EL++E+  KLQ++  E++    +     +
Sbjct: 1558 --------------EEKINKIIENR----KRELDEEFEAKLQQRTSELAGEKPLPATFTE 1599

Query: 1620 ELR---AEIE---AKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEI 1673
             ++    E+E   A ++ E+++E+   KKK+F+EGKQQA+MK+  LE+K+AK+E+Q    
Sbjct: 1600 VMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKIAKLEAQAKAA 1659

Query: 1674 KQSAE-----SPPKHANNVPNPLLGL----------------PRKIEENSNSPFNTLLSG 1712
             +  +     SP +   + P+P+  +                PR I   + SP     SG
Sbjct: 1660 AEKPDDTTVNSPDRKQLDKPSPIAEISHQEDKTHIAEELAEGPRPI---TTSPIPPSSSG 1716

Query: 1713 E 1713
            E
Sbjct: 1717 E 1717

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1396 (35%), Positives = 825/1396 (59%), Gaps = 42/1396 (3%)

Query: 27   FFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKTEME 86
            F      ++ ++D  ++  +  K  +F +L++ENL+ +V+ DEL+++S +K+   K ++ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 87   NVLRQNDEIRKERNDTSAKFEF----LQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQ 142
             +L++ + +R E    SA+FE     L +EK +  N+ E+++ +   L ++K+ ++S++ 
Sbjct: 82   LLLQELESLRGE----SAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKN 137

Query: 143  RTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQ 202
               ++L+E++ E+   K E +    E R LR   ++LE++ +   + DL  ++EL R +Q
Sbjct: 138  DVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQ 197

Query: 203  ELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQ 262
            EL+L +SN +WLE +L  K+ ++ +YR  T + ++ +  +L  L+ + Q     N  L++
Sbjct: 198  ELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLRE 257

Query: 263  KNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRK 322
             N  ++N L+ ++ ++K L+D+LN+EKQEF+ E++LK+RL+DLLE Q+ ++K +L+ +R 
Sbjct: 258  HNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLE-LRS 316

Query: 323  SDSSNVTSDDSRKLISENESL------LKDLRLTKEKLAQCESECLRXXXXXXXXXXXXX 376
            +         S  L + +E L      L++     +KL Q   + +              
Sbjct: 317  TAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHE 376

Query: 377  XXXXXX--XXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMXXXX 434
                      D  LLK+Q I EKR KE LQNQ+E+F+VELE KVP+++SFK+R DM    
Sbjct: 377  YPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQ 436

Query: 435  XXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVS 494
                       S +K +   +L     +I   E  I  LTRQR DL RQVQYLLI  SV 
Sbjct: 437  LAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVR 496

Query: 495  NDSKGPLRKEEIKFIQNIL-QNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRIT 553
            +DSKGPL  EEI F++ IL Q D S   E D+QK+++ RLVEFR+++ELQ KN++LLR  
Sbjct: 497  SDSKGPLTTEEIAFVRRILEQGDLS--LERDTQKVISERLVEFRDIVELQSKNSDLLRTI 554

Query: 554  RNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXXXXXXXXX 613
            RNLADKLES E +SK     +EN  I EAKEAI++LQ E                     
Sbjct: 555  RNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQ-EHAQELESRIEVLTKERDAYKA 613

Query: 614  ISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKS 673
            I    ++ N      L  +K ++ ++V DL+  +     E+ +NM +LN EIQ++   K+
Sbjct: 614  IQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKT 673

Query: 674  DISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLN 733
             ++IE+ KE++S+ LAEER K+   +L LTK EN++L KR   +Q ++ KQD+KT ETL+
Sbjct: 674  KLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLS 733

Query: 734  EYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQE----LDKLSSEKTSLRIMVTQLQT 789
              I C+SKL+  E+ L +       KI+S  S +++    +++L++E+ +L I+VTQLQT
Sbjct: 734  CLIECQSKLATLESELKS----SVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQT 789

Query: 790  LQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIE 849
            LQ ER+ LL E  KS + K++ +E   ++L+ + S KD+      + N S+ +WYQ KI+
Sbjct: 790  LQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKID 849

Query: 850  TLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDET----INDDSL 905
            +L +    V + +  +      L+ + K LE  ++E + +  +Y+V+++T       ++L
Sbjct: 850  SLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEAL 909

Query: 906  RKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINL 965
            R ELE SKI L +AYSQI+E++  Y+S  ++L  + +  +      S    ++  ++  L
Sbjct: 910  RMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDEL 969

Query: 966  EDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKI 1025
              +V  LK Q  NLNNEL  QK + + +K E +  +  LQ+  + + ++K  YE +L K+
Sbjct: 970  VGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKL 1029

Query: 1026 QDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSELENIL 1085
              DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   Y+ Q   L  S  +LE  L
Sbjct: 1030 TQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTL 1089

Query: 1086 KENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNG-VGDARNGPTLN 1144
             E++  W +QK+    QL   N RIEDL+ QN LL +Q++L     N  +G +     + 
Sbjct: 1090 DESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKV- 1148

Query: 1145 NDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSIV 1204
             +++ +LRRERDIL TK+ V++R   +  +K+  ++ EL  A+ +L++ +  + + S + 
Sbjct: 1149 RELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSIMA 1208

Query: 1205 QQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKY 1264
             +H+ ++E+LNQLNLLRESNITLR+E++  +++ +EL+ ++  L++ + P+ESEL++LK 
Sbjct: 1209 DEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKR 1268

Query: 1265 SMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGT 1324
            S++ K+ +I L  EE +RWK+RSQDIL K +++   +++KL  E+   KA+L  K  Q +
Sbjct: 1269 SVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNS 1328

Query: 1325 EAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALE---RSLNDANTRIQE--- 1378
            E E+RF RL++QA+E+L  +K  Q  L+ +L + ++A+  +E   R   D N  +QE   
Sbjct: 1329 ELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQ 1388

Query: 1379 -LEGEKVAEDNNRSEM 1393
             +E E  A+   + E+
Sbjct: 1389 RVESEAKADSTTQPEL 1404

 Score = 64.3 bits (155), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 98/219 (44%), Gaps = 51/219 (23%)

Query: 1499 SSVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXX 1558
            + V+I+ +KKQW                  L+KRIRLPT                     
Sbjct: 1522 TPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPT--------------------- 1560

Query: 1559 XXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSH-----SSSI 1613
                           E  + K +E R    + ELE E+  KLQ++  E+++     +S  
Sbjct: 1561 ---------------EEKINKIVETR----KSELEQEFEAKLQKRASELANEKPQPASFT 1601

Query: 1614 SVNEKDELRAE-IEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSE 1672
             V ++ +   E ++A L  E+++E+  V+KK+F+EGKQQA+MK+  LE+K+AK+E+Q   
Sbjct: 1602 EVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQ--- 1658

Query: 1673 IKQSAESPPKHANNVPNPLLGLPRKIEENSNSPFNTLLS 1711
            +K S       A    N     P +I E   SP    LS
Sbjct: 1659 VKASGTEAVPSAPTSKNSPTEKPVRILE--ASPLEDALS 1695

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/1727 (32%), Positives = 918/1727 (53%), Gaps = 158/1727 (9%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            +ASF D S + V+++D  I+  LN +  +FN +++E ++I+   +  K  +   I  LK 
Sbjct: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKN 83

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143
            E+  ++   + + KE+ D   K    + +KI   +ELES   +++ L E   E+QS +Q 
Sbjct: 84   ELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSKKQE 143

Query: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQE 203
             +K LD+R+ E+   +      NNE    R+ +++LE + Q    NDL+ R++LER +QE
Sbjct: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203

Query: 204  LNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQK 263
            L  +   K WLE+ L  K EQ+ SYR+++     +++ +LN +KN+    K+ N VL+++
Sbjct: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263

Query: 264  NNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELK---SI 320
             +ELSN L++   +LKN+  S N +K     E+ LKQ+LI +L++QLN ++ E     S+
Sbjct: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323

Query: 321  RKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRXXXXXXXXXXXXXX--- 377
              SD+++ +  DS     E   L   L   +E+  + E +  +                 
Sbjct: 324  TVSDTASSSRKDS-DFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDLR 382

Query: 378  -XXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMXXXXXX 436
                    D  +LKK+   E+  +E  +  +E F+ +LE ++P + +++ R         
Sbjct: 383  NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELK 442

Query: 437  XXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSND 496
                     + EK+    ELN    +I   E +I ++ +QR DL  Q+Q+ L+ NSV+ND
Sbjct: 443  EATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502

Query: 497  SKGPLRKEEIKFIQNILQNDNS-GTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRN 555
            S GPL  EE+KFI+NI+Q D+     E+D+QK+++ RL +F+++IELQ+KN ELL+ TR 
Sbjct: 503  SAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRE 562

Query: 556  LADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXXXXXXXXXIS 615
            LA KLE  +   +    +IE +TI EAKEAIL+LQ+                       +
Sbjct: 563  LATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAALTKELETYKVLSN 622

Query: 616  KQASSFNNSVIQQLTKTKRELESQ--VQDLQARISQITRESTQNMSLLNKEIQDIYDSKS 673
             + SS      +Q  + +RE+E    V++L+ RI+ I +ES +N ++LN +I  + +  +
Sbjct: 623  TEDSSTPADFDKQ--REQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNN 680

Query: 674  DISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLN 733
             ISIEL +EKS++ LAEER KLL  ++D+T  EN++L+KR +SL++ + +QD +THET+N
Sbjct: 681  HISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETIN 740

Query: 734  EYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKE 793
              I  +S+L+  E   +  + E KL   SE+ LK EL +L+ EK S++++VT+LQTLQ E
Sbjct: 741  SLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSE 800

Query: 794  REDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKK 853
            RE LL   +     ++N++E   N+L+ +    +++   L E+ T   + ++ K ++LK+
Sbjct: 801  REHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKE 860

Query: 854  DNDSVMNLVNEKQTEI----EKLQYKVKSLEKEIEENKIRLHTYNVMDETINDD------ 903
            +    M+ V ++ +EI     + +++   L K+++E    +  Y       +DD      
Sbjct: 861  E----MSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAA----SDDEGKLEE 912

Query: 904  --SLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDE 961
              SL+KEL++ K  LTE+YSQ + Y+K  E   QS+ ++N ++     AF  +I  +   
Sbjct: 913  ISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELA 972

Query: 962  KINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021
            K N+ D  ++LK Q  +LNNEL++QK   E +K+ F +    L+   K +E  K +YE K
Sbjct: 973  KNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDK 1032

Query: 1022 LSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSEL 1081
            L  +  DL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   YR ++  LT+S ++ 
Sbjct: 1033 LKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDA 1092

Query: 1082 ENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAG---NGVGDAR 1138
            + +L EN+ SW  Q+    +Q++    RIE+ S QNK+L+ Q +L T A    N      
Sbjct: 1093 KRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGV 1152

Query: 1139 NGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVEND 1198
            N    +N ++++LR ERD+L  ++ V E + K+LR+++T ++ + +    +L   + E  
Sbjct: 1153 NSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETH 1212

Query: 1199 ERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESE 1258
                +++QH  +M +L QL+LLRESNITLRNE      KN+ LQ+E+  L + + P+E+E
Sbjct: 1213 NYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETE 1272

Query: 1259 LSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLED 1318
            L  L   ++EK++++ +  EE  RWK+RSQDIL K+Q++   ++E L  E   L+AQLE+
Sbjct: 1273 LQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEE 1332

Query: 1319 KMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNEL--------------KDAKVA 1364
            K ++  E   RF +L++QA EKL  SK++Q +LT Q+N+L              K+ K++
Sbjct: 1333 KSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLS 1392

Query: 1365 LERSL------------------------NDANTR-IQELEGEKVAEDNNRSEMIKRSQE 1399
            LE+ L                         D  T+ I  +E  K  E+N  SE IK+ QE
Sbjct: 1393 LEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSE-IKKLQE 1451

Query: 1400 DAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXXXXXXXXXXXXXXXTAAGHRDEDLS 1459
            ++                       KL EE+A                 T  G    D  
Sbjct: 1452 ESS----------------------KLQEELAHEKLTTSTTEIGNVDQDTVDGGVSND-- 1487

Query: 1460 NIVESMXXXXXXXXXXXXXXXTREVNKKIQ------EAQERLNQPSSVNIDE--MKKQWX 1511
             IVESM               T E  KK+Q      +A+    Q   V+IDE  ++KQ  
Sbjct: 1488 -IVESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIE 1546

Query: 1512 XXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSISGSE 1571
                             LK+RIRLPT                                 E
Sbjct: 1547 EEYEQATSQRIKEAEENLKRRIRLPTE--------------------------------E 1574

Query: 1572 QMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEK----DELRAEIEA 1627
            ++  ++ K        ++ +LE+E+  K++ + KE+     ++ +EK    D ++ EI+ 
Sbjct: 1575 KINKVIDK--------RRTQLENEFQNKVEARAKEL-----LTGDEKNEFFDRMKKEIQE 1621

Query: 1628 KLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIK 1674
            +L  +  +ELQ VKKK+F+EG+QQ  MKT+ LE+K+ K+ES L   K
Sbjct: 1622 ELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAK 1668

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/1747 (30%), Positives = 904/1747 (51%), Gaps = 165/1747 (9%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            +A+       QV+ +   ++  L  +   F +L++EN ++ VS    ++     ++ L+ 
Sbjct: 21   LAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGVEALRE 80

Query: 84   EMENVLRQ-NDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQ 142
              + +  +   + R +    SA      +   ++  +LE  +R++      ++++     
Sbjct: 81   RQQQLAAEAGAQQRGQGEAGSAGRAGGPSVPERVQQQLEETERRVAAGDSARRDL----- 135

Query: 143  RTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQ 202
               ++L+E++ +++ ++ E  R     + LR   +ELE   Q+  +  L  ++E++R  Q
Sbjct: 136  --ARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQ 193

Query: 203  ELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQ 262
            EL L++SN +W   +L+ K++Q  SYR++T+  I   + ELN +KN+ ++E  N   L+ 
Sbjct: 194  ELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRS 253

Query: 263  KNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRK 322
            KN ELS  LQ+ + + K L+DSL++EKQEF+ E+ALKQRLI+LL  Q+  +K++L+    
Sbjct: 254  KNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYD 313

Query: 323  SDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLR------------------- 363
               +   SD      SE E LL DL  TK+KL   ++   R                   
Sbjct: 314  VAKNGGMSD------SERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGR 367

Query: 364  -XXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVIN 422
                                  D   L+KQ ++E+R KE+LQ Q+ESF+VELEHK+PV+N
Sbjct: 368  NGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLN 427

Query: 423  SFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCR 482
            SFK+R +               T+ E++ K+ ++     K+   E  +  L +QR DL R
Sbjct: 428  SFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLAR 487

Query: 483  QVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIEL 542
            QVQ LLI  SV +DS GPL  EE++F++  LQ+     T SD+Q I++ RLVEF++V+EL
Sbjct: 488  QVQCLLIHISVRDDSSGPLTAEEVEFVKK-LQSCRDSATGSDTQAIISNRLVEFKSVVEL 546

Query: 543  QEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXX 602
            Q+KN ELL   R LA KLE  E K++  +  +E  T+NEAKEAILSLQ            
Sbjct: 547  QQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLET 606

Query: 603  XXXXXXXXXXXISKQASSFNNSVIQQLTKT---KRELESQVQDLQARISQITRESTQNMS 659
                       +S+     NNS+   +       +E+   +  L+AR+  +  ES Q+  
Sbjct: 607  VTTERDSFKLLVSE---GKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAK 663

Query: 660  LLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQS 719
            +LN+EI+ +Y S S ++IEL +E+SSR LA+E+  L+  +L+L K EN  L+ R+ SLQ+
Sbjct: 664  MLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQA 723

Query: 720  SISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTS 779
             + +QD++   T+ E++S KS+L    + L+ L+ E+      E  LK+E + L+ +   
Sbjct: 724  LLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNND 783

Query: 780  LRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTS 839
             ++++ QL+T QKER+ L++E RK  + +I E++   +  K +   K +   +L   +++
Sbjct: 784  SQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843

Query: 840  KIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM--- 896
            + +W+Q+K+++LK++  S    +  K +E++ L+ ++ S   ++E   +     +++   
Sbjct: 844  QCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLES 903

Query: 897  DETINDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQ 956
            D      SL K+L+ +   L+ AYS+I+ YK    +T +     N+  D  + +    I 
Sbjct: 904  DHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAI- 962

Query: 957  SLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKS 1016
            SL  E   L   +++  ++   L +EL+ ++     ++ E ++ I  L  + + IE  K+
Sbjct: 963  SLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKA 1022

Query: 1017 EYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTL 1076
            +Y+ K++++Q DL++Q    N A+  Y+  LQK A++S+ I  LR+   +Y+ ++     
Sbjct: 1023 DYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKS 1082

Query: 1077 SRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGV-- 1134
            +  E   +L+ NE++W  QK  +   LDL++ RIE+LS+QN+LLY+QIEL + + +    
Sbjct: 1083 AAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLE 1142

Query: 1135 ------GDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDART 1188
                   DAR       +++VTLRRERDIL+TK+ V++R+ KMLRQ++ L   EL + R 
Sbjct: 1143 PDTKISSDAR-------ELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRA 1195

Query: 1189 KLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKL 1248
            +L+ S+    E +   Q  + + EKLNQLNLLRE N++LRNE E  S+ N+ LQ+E++ L
Sbjct: 1196 QLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSL 1255

Query: 1249 KEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESE 1308
            +E + P+E ++ +L  ++ EKEQ++ L KEE  RWK+RSQDIL K++++   +Y KL SE
Sbjct: 1256 QEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASE 1315

Query: 1309 VESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERS 1368
            +E LKA+LE K  +  +++ERF +LR+QA E+L   K  +  +  +L      K  LE  
Sbjct: 1316 IEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAK 1375

Query: 1369 LNDANTRIQELEGE----KVAEDNNRS----EMIKRSQEDAXXXXXXXXXXXXXNAISYS 1420
            L++A  +I  LE +      +ED+N      E  K   +DA             +  S+ 
Sbjct: 1376 LSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFK 1435

Query: 1421 STVRKLNEEIATXXXXXXXXXXXXXXXXTAAGHRD--------------------EDLSN 1460
              + +LN+++ T                 ++GH D                    E+   
Sbjct: 1436 KQLDELNKQLET----------IQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRT 1485

Query: 1461 IVESMXXXXXXXXXXXXXXXTREVNKKIQEAQERLN----QPSSVNIDEMKKQWXXXXXX 1516
            ++ES                  E  K ++E ++ L     + +S N++ +KK+W      
Sbjct: 1486 LIESHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQ 1545

Query: 1517 XXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXSISGSEQMEAM 1576
                        LKKRIRLP+                                       
Sbjct: 1546 QTLQRIREAEEALKKRIRLPS--------------------------------------- 1566

Query: 1577 LQKQLEIRVQEKQKELEDEYNEKLQEK----LKEVSHSSSISVNEKDELR------AEIE 1626
             ++++   ++ KQK LE E+  K+       LKE  +  SI+ ++ D ++       +++
Sbjct: 1567 -EERINQVIERKQKALEQEFTTKVNATALALLKE--NPDSIASDKADLIKDHQKEIVQLK 1623

Query: 1627 AKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANN 1686
              L ++   +L  VKKK+FEEG+QQ  MK  LLE K++K+ESQ       A++P     N
Sbjct: 1624 KDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ-------AKAPL--GTN 1674

Query: 1687 VPN--PL 1691
            VP   PL
Sbjct: 1675 VPTKIPL 1681

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1402 (33%), Positives = 817/1402 (58%), Gaps = 76/1402 (5%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            +A F     + ++ I+ D++ R+ EKL    + KSENL+IT + D+LK+ S  K++  K 
Sbjct: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEE------KKEI 137
             +  + +  ++ + ER      FE    EK +L      V +++ +L +E      +KE+
Sbjct: 70   HISQLAKALEDGKDER----LHFE---EEKRRLIEGNSQVTKRIIELEQEIEVERQQKEL 122

Query: 138  Q-SNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSE 196
              +++Q   + L+E+++E+   K + N      + LR  VV  ET+ QT    +L S+SE
Sbjct: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182

Query: 197  LERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTN 256
            + R  QE+ LL+ N DWL  +L++K+ Q   +R+ T + + + + +++ ++++ ++ +T+
Sbjct: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTS 242

Query: 257  NDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEE 316
            N  LKQ  + L   L++K+ + K + D  N  KQE + E++LKQR+ID LE  + ++K+E
Sbjct: 243  NQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKE 302

Query: 317  LKSIRKS-DSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRXXXX-------- 367
            + + + + DSS  T         E + L+++L   K +L   ES C++            
Sbjct: 303  MDATKNNMDSSYFTE-------KERDELIEELNAVKYRLDASESNCIKLKETIDELTSNI 355

Query: 368  ---------XXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKV 418
                                      D  +LKKQ + EKR K++L+ Q+E+F+VELEHK+
Sbjct: 356  KLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKI 415

Query: 419  PVINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRL 478
            PV+NSFKER++M              T  +++ K  +L+     +   E  I  L++QR+
Sbjct: 416  PVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRV 475

Query: 479  DLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRN 538
            DL  Q+QYLL+  S+ ++  GPL  EE++F++N L N    T  SD+Q I+T RLVEFR+
Sbjct: 476  DLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN-LTNSQEITKTSDTQGIITDRLVEFRS 534

Query: 539  VIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXX 598
            V+ELQ+KN+ELL   RNLAD+LE  E ++K  +  +E++T+ EAKE IL+L  +      
Sbjct: 535  VVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLH-DHAQNLE 593

Query: 599  XXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNM 658
                           +S  ASS  N+  + +T    + + +V+DL+ R++ + +E+  N 
Sbjct: 594  NQLVILSKERDAYKALSVNASSGTNTP-KAITYPSPDNDDKVKDLETRLTAVIQEAENNA 652

Query: 659  SLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQ 718
               + E  ++     +IS+    EK+SR LAE+R  LL +TL+L+K + ++L+KRS  LQ
Sbjct: 653  KEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQ 712

Query: 719  SSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKT 778
              ++KQD +T ET++  I  KS LS  ++ LS LK E++     +K LK E ++ S E  
Sbjct: 713  DILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESV 772

Query: 779  SLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNT 838
              ++++ QLQTLQ+ERE LL E + S + K+ ++E       +E S   + + ++E++ T
Sbjct: 773  EYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLE-------IELSGSLERLEEIEKNTT 825

Query: 839  S-------KIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLH 891
                    +  W+Q KI+ L  +       + EK+ +++K+Q  +     +++E + R  
Sbjct: 826  GIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQ 885

Query: 892  TYNVMDETIND-----DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDE 946
            +Y ++   ++D     ++LR+ELE   + L+++YSQI+ +K L E + QS+ E++   +E
Sbjct: 886  SYTMLS-NVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEE 944

Query: 947  SNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQN 1006
            + +     I +L +E+  L+  V++L +Q  +LNNE+  QK+E + ++    + I+ LQ 
Sbjct: 945  AQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQM 1004

Query: 1007 NNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHT 1066
              + ++  K++YE K++ IQ DL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +  +
Sbjct: 1005 VKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQS 1064

Query: 1067 YRGQVKTL-TLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIE 1125
            Y+  ++TL T S+  +EN LK +EK W  QK    ++L +   R+++LS+QNKLLY+QIE
Sbjct: 1065 YKSDLETLKTQSQLAMEN-LKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIE 1123

Query: 1126 LYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQD 1185
            L     N   D R+    ++D+L++LRRERD+L+TK+ VA  +  +L+Q++ +   E++D
Sbjct: 1124 LL----NKTED-RDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIED 1178

Query: 1186 ARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSEL 1245
              T+L+  +  + E + +++Q + IM++L+QL+LLRESN+TLR+E  +  K+   L+S+L
Sbjct: 1179 LNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQL 1238

Query: 1246 VKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKL 1305
             +  + +AP++S +S+L+  ++ KEQE+  +KEE  RWK RSQDIL K++++   ++ KL
Sbjct: 1239 QECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKL 1298

Query: 1306 ESEVESLKAQLE---DKMQ----QGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNEL 1358
            + E+  +K +L+   D +Q    +  + E +F R+R QA+++L  SK  +++L+ ++N++
Sbjct: 1299 KEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQI 1358

Query: 1359 KDAKVALERSLNDANTRIQELE 1380
             +AK  +E  L    T  +ELE
Sbjct: 1359 NEAKSQVEADLGKCKTACKELE 1380

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 90/217 (41%), Gaps = 48/217 (22%)

Query: 1496 NQPS-SVNIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXX 1554
            +QP+  ++ID +K +W                  LKKRIRLPT                 
Sbjct: 1541 SQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPT----------------- 1583

Query: 1555 XXXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSIS 1614
                                   Q++++  V+ ++  LE+ + EK+ EK ++++      
Sbjct: 1584 -----------------------QQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGND 1620

Query: 1615 VNEKDELRAEIEA---KLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLS 1671
                ++ RAE+ A    +R++   +L  +K+KSFEEGKQQ ++K   LE K+  +E Q S
Sbjct: 1621 AITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKS 1680

Query: 1672 EIKQSAESPPKHANNVPNPLLGLPRKIEENSNSPFNT 1708
             IK         +     P+ G          SPF+T
Sbjct: 1681 TIKPVENDTSNMSAAFQAPVFGSHSTF----TSPFST 1713

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  470 bits (1210), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 441/1381 (31%), Positives = 727/1381 (52%), Gaps = 106/1381 (7%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            I+S  D  LE++ + D D+I  + +KL +    K ++  ++   +EL+T +  K+  L  
Sbjct: 36   ISSILDVPLEKLHTTDYDLILAVKDKLDELRNSKDQSNVVSNDINELQTLADNKLTSL-- 93

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143
                                 K   ++ EK +L +++   + + N+L             
Sbjct: 94   -------------------GGKLATVETEKKELIDKVNGYETQFNEL------------- 121

Query: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITND--LNSR-SELERK 200
              KI +E L      KV N   N E  N ++     ET++  Y+     L+ R SE++R 
Sbjct: 122  --KIKNEGLN----LKVSN--LNIELENWKNNSNNFETEKLNYVXXXXXLSIRESEIQRL 173

Query: 201  TQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNN--- 257
             QE+  L  NK       SS SEQ+L  +++ +   +++  E N   +  +LE+      
Sbjct: 174  KQEVTFLNENK-------SSLSEQWL--KEKEEFNKAKLLLEKNLNNSTIKLEEATTTLK 224

Query: 258  ------DVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLN 311
                   VL  KNN+L+   +  + ++KNL D+L   K + + EIA+K +LIDLL+ QL+
Sbjct: 225  SMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLS 284

Query: 312  AVKEELKSIRKSDSSNVTSDDSRKLISENESL---LKDLRLTKEKLAQCESECLRXXXXX 368
            + +EEL+   + +S      D   L S+NE+L   ++DL L  E+L Q E+  L      
Sbjct: 285  STQEELRQNVELNSKFTKFPD---LESQNETLKSDIQDLTLKIEEL-QNENFNLNSMINQ 340

Query: 369  XXXXXXXXXXXXXXXXDFI-------LLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVI 421
                            +         LLKKQ  +EK  K+ LQ QIESFI+ELE+K+P+I
Sbjct: 341  MSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPII 400

Query: 422  NSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLC 481
            +SF+E+                 TSNEKN    +LN  + K+   +++I  L RQRLDL 
Sbjct: 401  SSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDLA 460

Query: 482  RQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQN--DNSGTTESDSQKILTGRLVEFRNV 539
             QV++LL+  +V NDS GPL +EEI+FI  I  N  D +G +E  SQ +++ RLV F N+
Sbjct: 461  NQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNG-SELTSQHVISERLVTFSNI 519

Query: 540  IELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXX 599
             ELQ KN ELL   R+L++ LE+  I++  +  + +NKTI +AKEAIL+LQ         
Sbjct: 520  EELQAKNMELLNSIRSLSENLEN--IENANSHKEFQNKTIADAKEAILTLQYHNDILESK 577

Query: 600  XXXXXXXXXXXXXXISKQA---SSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQ 656
                          ++      SS  N  +   T  +   E  ++ LQ  I ++  E  +
Sbjct: 578  VKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETN-EKSIEKLQTLIEELKAELKK 636

Query: 657  NMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDS 716
            N   L  +I      KS+++I L KEKSS  L  E+  L  +  D+ K EN +L KR ++
Sbjct: 637  NKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFEN 696

Query: 717  LQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSE 776
            LQ+ I KQ+SK  + +N+YI+ ++++S  +T LS  K E+   + S+ SL  EL K S E
Sbjct: 697  LQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEE 756

Query: 777  KTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEED 836
            K  LRIM++QLQ+LQ ER  LLD+ +K   +KI+E+E    +L      K   I +L   
Sbjct: 757  KNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSIS 816

Query: 837  NTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM 896
            N S+  WYQN I+ LKK N ++   +  K + I  L  K++ LE +       + T    
Sbjct: 817  NESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ----SYTIDTNTRC 872

Query: 897  DETINDDS-LRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQI 955
              + ND S + K+L+++K++L+EAY+Q++EYK+LY ST +SL+ + S  +       ++I
Sbjct: 873  SSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDDKI 932

Query: 956  QSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVK 1015
              L  E   L+       ++   L+ +L  +KN+  ++  +    I  L    K+     
Sbjct: 933  SKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSADTA 992

Query: 1016 SEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLT 1075
            SEYE K+SK+Q  L+ +  +A+ AQ  YE  L K     ++I E +EQ+     ++    
Sbjct: 993  SEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRI---V 1049

Query: 1076 LSRSELE---NILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIEL----YT 1128
            +  S+LE   ++L ENE  W  ++ + +  L+ S  +I++L++QNKL  +Q+EL    ++
Sbjct: 1050 IIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFS 1109

Query: 1129 AAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDART 1188
            +  +    +      N      LR +RD+L+TK+++AERD+K    K+  +  EL + + 
Sbjct: 1110 SMDSSQLSSETKHMFNR-----LRADRDVLETKLSIAERDSKNNASKLESLRDELANVQM 1164

Query: 1189 KLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKL 1248
            KL +S  +    S +++ H+ I+ +LNQ+ L +ESN TLRN++   ++KNK LQ++L + 
Sbjct: 1165 KLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEE 1224

Query: 1249 KEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESE 1308
               ++ +  EL ++K S+ +KE +I L KEE ++W+ R++++  +  ++  +   KL +E
Sbjct: 1225 NSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTE 1284

Query: 1309 VESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERS 1368
            +++LK   E K +Q  E EERFN L++QA E+L  SK  Q +L +Q+NELK +   +E +
Sbjct: 1285 LDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELA 1344

Query: 1369 L 1369
            L
Sbjct: 1345 L 1345

 Score = 80.9 bits (198), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 78/107 (72%), Gaps = 10/107 (9%)

Query: 1584 RVQEKQK-ELEDEYNEKLQEKLKEV-SHSSSISVNEKDELRAEIEAKLREEL----NDEL 1637
            RV EK+K ELE+EY  KLQEKL E+ ++ +SI   +  +LR EI+ +++ ++     ++L
Sbjct: 1530 RVIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDL 1589

Query: 1638 QNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEI----KQSAESP 1680
               KKKSFEEGKQQ++MKTTLLERK++K+ESQLSE     KQS ++P
Sbjct: 1590 NEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDKNP 1636

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  380 bits (977), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 501/1874 (26%), Positives = 877/1874 (46%), Gaps = 244/1874 (13%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            I+ +     + ++ ++  I+  L +++ +F   + E  ++ V  DE+K+    +I    +
Sbjct: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRI----S 60

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143
            ++  +L ++ E   E+N +  +   L N    L NE     RK++ L    K++ +++  
Sbjct: 61   KLNELLGESSE---EKNVSKKELSRLHN---LLKNERSKCARKIDALN---KQLNASKNT 111

Query: 144  TLKILDERL--KEVEMAKVEN-------NRTNNECRNLRSTVVELETKQQTYITNDLNSR 194
              K+ DER   +E E+ K E+       +   +E + LR  ++E+E   QT  +N L+ +
Sbjct: 112  ITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLK 171

Query: 195  SELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEK 254
             + +   QE  L+  NK W+E++LS + E+ L       + +  +  +LNR +ND++   
Sbjct: 172  LKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVS 231

Query: 255  TNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVK 314
            TNN  L  +N +LS+S+++K+L++KNL D++N EK +FS E+ L++ + DLL +QL + +
Sbjct: 232  TNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFE 291

Query: 315  EELK-SIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEK-------LAQCESECLRXXX 366
            +    S R+ D+ +   +     + +    L D +L  EK       L    ++C+    
Sbjct: 292  KNYSLSAREKDNDDPCKNSQHANVVDK---LIDTKLQLEKSKDECQRLQNIVADCIEEDE 348

Query: 367  XXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKE 426
                              D   LK+Q IKE+  K QLQNQ+ESFI ELE K P + SFKE
Sbjct: 349  AAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKE 408

Query: 427  RTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQY 486
            RT+                S  K    +EL    +KI  CE +IH L +QRLDL RQV+ 
Sbjct: 409  RTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKL 468

Query: 487  LLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKN 546
            LL+  S       PL  +E+  ++ +L++ +    E DSQ I+T RLVEF N  ELQEKN
Sbjct: 469  LLLNISAVQKKASPLSNDELISLKKLLESGDV-PNEKDSQIIITERLVEFNNTNELQEKN 527

Query: 547  TELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXX 606
             ELL   R LADKLE++E K  ++L K+EN+TI EAK+AI+ L+                
Sbjct: 528  MELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEH-----VNSTLESRID 582

Query: 607  XXXXXXXISKQASSFNNSVIQQLTKTKRELES--QVQDLQARISQITRESTQNMSLLNKE 664
                     K  +S N + I      K E  +  ++++L++ +S    E++  +  LNKE
Sbjct: 583  ILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKE 642

Query: 665  IQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQ 724
            +     S+S+  I L +  + ++LA E+  LL   +D  K    +L K+  S  SSI   
Sbjct: 643  LLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKT---KLEKQRSSAPSSIHGS 699

Query: 725  DSKTHETLNEYISCKSKLSVTETALSNL-KLEQKLKIDSEKSLKQELDKLSSEKTSLRIM 783
                   L++Y   K+K       +SNL K    L+   E SL ++L++   EK  L++ 
Sbjct: 700  IGSEETELSQY---KNKTKSLMCEISNLSKKNTDLRCMKE-SLTRDLERCCKEKMQLQMK 755

Query: 784  VTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEW 843
            +T+ +T   E++   D  +     KI  +E+   EL      K Q I  L+    S+++W
Sbjct: 756  LTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKW 815

Query: 844  YQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYN-VMDETIND 902
             QN I+  +K+  S+   ++EK+T I KL  ++K LE E+++ K++    N   D    +
Sbjct: 816  AQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLE 875

Query: 903  DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEK 962
             +L+KELE S+I+L +A+SQI+ Y+++  +   +L+E+N +L ++ E    + QSL +E 
Sbjct: 876  TALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEEN 935

Query: 963  INLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIA---ILQNNNKEIETVKSEYE 1019
               E+++S L+        ELD  +    K K    +++     L N  + I+ +  + +
Sbjct: 936  NAKEEEISFLRR-------ELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKID 988

Query: 1020 SKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRS 1079
             K++ I +      ++     + Y+ +L+ + D+S  +  L  ++  Y+ ++K    S  
Sbjct: 989  -KMTTIVE------LHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLH 1041

Query: 1080 ELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARN 1139
              + +L ++E+ W  +K     +L  +  + E L  +N  L  +I+  T   NG  +   
Sbjct: 1042 STQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKIDDGTGENNGDKEYLK 1101

Query: 1140 GPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDE 1199
              +L      +LR ER+ L+TK+T  +RD  + +QK   ++  + D +     SR +   
Sbjct: 1102 LVSL----FSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQC 1157

Query: 1200 RSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESEL 1259
             + I+ + + IM+++ Q+N+L+E+N  L+  L+  ++KN+ +  E   L+  I+ ++ +L
Sbjct: 1158 STDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDL 1217

Query: 1260 SALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDK 1319
            +  K  +     ++ + + E+ +WK+R  ++ ++ ++   ++ EKL +E+  LKA+L + 
Sbjct: 1218 AQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNA 1277

Query: 1320 MQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQEL 1379
                 +  ++FNRL++QA EKL  SK  Q  LT +++ELKD K  LE SL+   +++ EL
Sbjct: 1278 QNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLEL 1337

Query: 1380 EGEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSSTVRKLNEEIATXXXXXXX 1439
            E  K+ +   ++E + + QE+                     T + L EEI         
Sbjct: 1338 EA-KLKKHLVQAEGVSKDQEE--------------------DTSKPLMEEIELLKRELQV 1376

Query: 1440 XXXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTREVNKKIQEAQERLNQPS 1499
                             D S+ +E M               T E  +K++EA  + N  +
Sbjct: 1377 FKETS------------DSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEATGK-NTGA 1423

Query: 1500 SV----NIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPTXXXXXXXXXXXXXXXXXX 1555
            ++    N++E+KKQW                  LKKRIRLP+                  
Sbjct: 1424 TIENGENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSE----------------- 1466

Query: 1556 XXXXXXXXXXSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISV 1615
                           E+++ ++ K        +++ELE E+    Q KLK  S S ++S 
Sbjct: 1467 ---------------ERIQKIISK--------RKEELEQEF----QRKLKANSGSFTLSS 1499

Query: 1616 NEK-DELRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIK 1674
            ++K +E+ AE          D+L N   K      ++ ++ T L+ +K   ++ QL   K
Sbjct: 1500 DKKENEVNAE----------DDLWNSPSKG---NSEKPSVVTNLIRQKNLILQEQLKNPK 1546

Query: 1675 Q---SAESPPKHA---NNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAF 1728
            +   S +S P  +   N++P          E  +   FN    G+ L  F        +F
Sbjct: 1547 KGIISNDSRPTSSNKENDIPGSTTA-----ENKAPLAFNF---GKPL--FPSNTSSFQSF 1596

Query: 1729 -NPFTSPSPKKLLQKDDVQKETSNNKTDPPTHLAPSFNI-PATRVXXXXXXXXXXDTNDE 1786
             NPFT  +             TS N     T ++P FNI PA  V               
Sbjct: 1597 QNPFTPAA-------------TSFN-----TGVSPVFNIKPALAVDATVD---------- 1628

Query: 1787 ELTVNEPGQKISSAINSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDD 1846
              T   PG         L+  G+    E ++ EI N       S KRPI           
Sbjct: 1629 --TFKTPG---------LNDAGT---NEAKIIEIGN------NSLKRPI----------- 1657

Query: 1847 EDSAEFTNESKKIK 1860
            E+   F  +SKK+K
Sbjct: 1658 ENEVSFDTDSKKVK 1671

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  377 bits (968), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 382/1379 (27%), Positives = 705/1379 (51%), Gaps = 64/1379 (4%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            I+ F     E ++ I+  ++ +L +K+  F   + E  ++ V  DE+K+    +I    +
Sbjct: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRI----S 60

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143
            ++  +L ++ E   ++N  S +   LQ+   QL  + E  +RK++ L    K++ S++  
Sbjct: 61   KLSKLLNESSE---QKNIASKELSHLQD---QLMQDRERCRRKIDALN---KQLDSSRDA 111

Query: 144  TLKILDER-LKEVEMAKVENNRTNNECRN--------LRSTVVELETKQQTYITNDLNSR 194
              ++ DE+  KE  M +   ++  N  +N        LR  ++E+E   Q   +N ++ +
Sbjct: 112  IKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171

Query: 195  SELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEK 254
             + +   QE  L+  NK W E++LSS + + L+      + I  +  +L + + D +   
Sbjct: 172  LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231

Query: 255  TNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVK 314
            + + +L  +N +LS+S++EK+L++KNL D+   EK EFS E+ L++ + DLL +QL + +
Sbjct: 232  SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291

Query: 315  EELKSIRKSDSSNVTSDDSRKLISENESLLKD-LRLTKEKLAQCESECLR---------X 364
                  R   S  +  DD       + + + D L  TK +  + + EC R          
Sbjct: 292  ------RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQ 345

Query: 365  XXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSF 424
                                D  +L+KQ IKE+  K QLQNQ+E FI+ELEHK P + SF
Sbjct: 346  EDKATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSF 405

Query: 425  KERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQV 484
            KERT                 S  K    REL    +KI  CE +IH+L +QRLDL RQV
Sbjct: 406  KERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQV 465

Query: 485  QYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQE 544
            + LL+  S    +  PL K+++  ++ IL++  S   E+D+Q I++ RLVEF N+ ELQE
Sbjct: 466  KVLLLNTSAIQKTTLPLSKDDLISLRKILES-GSDVNENDAQAIISERLVEFNNINELQE 524

Query: 545  KNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXX 604
            KN ELL   R LADKLE +E K    L ++E +TI EAK+AI+ L++  M          
Sbjct: 525  KNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILL 584

Query: 605  XXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKE 664
                      S   S  NN  +     T+   E ++++L+A +S    ES+  +  L KE
Sbjct: 585  RERDSYKLLAS---SKENNVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKE 641

Query: 665  IQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQ 724
            +        D  I     ++ ++LA+E+  +L   ++  K +   L K+  S+ S +  Q
Sbjct: 642  LTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD---LEKQKLSVPSFV--Q 696

Query: 725  DSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMV 784
            D+K  ++  E +  ++K  +    +S+LK E    +  ++SL ++L++   EK  L++ +
Sbjct: 697  DNKVRDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKL 755

Query: 785  TQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWY 844
             + +    E++   D        +I ++EE+   L++E   K Q I  L+    S+++W 
Sbjct: 756  KESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWA 815

Query: 845  QNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTY-NVMDETINDD 903
            QN I+  ++   SV+  ++ K+  +  L  K+++L+ E+ ENK++     N  D +    
Sbjct: 816  QNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDASTLQP 875

Query: 904  SLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKI 963
            +LRKELE +++ L +A+SQ++ Y+++  +  ++L+E+NS+L    E +  +I+    EK+
Sbjct: 876  ALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKL 935

Query: 964  NLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLS 1023
              E+++SLL+ +     +E+   + ++++  V   K    L+N  ++I+ +K++ +    
Sbjct: 936  ANEEELSLLRREL----DEIRSLQPKLKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNW 991

Query: 1024 KIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSELEN 1083
             +Q       +Y     + ++  ++ + ++S+ ++ L ++    + ++K L  S  + ++
Sbjct: 992  NVQ-------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQD 1044

Query: 1084 ILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTL 1143
            +L  +EK W  +K     +L  +  + E L  +N +L  +I   T   +G  D     + 
Sbjct: 1045 LLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVSF 1104

Query: 1144 NNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSI 1203
                   LR ER+ L+TK+T  +RD  +++QK   ++  + D +     S+ E    + I
Sbjct: 1105 ----FSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVI 1160

Query: 1204 VQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALK 1263
            + + + I +++ Q+NLL+E+N  L+  L+N ++KN+E+  EL   +E ++ ++S+L   K
Sbjct: 1161 IDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTK 1220

Query: 1264 YSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQG 1323
              +     +I + + E+ + K+R  D+  + +++     EKL SE+   KA+L D     
Sbjct: 1221 EQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTK 1280

Query: 1324 TEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELEGE 1382
            TE E +FNRL++QA EKL  SK  Q  LT +L ELK  +  LE+ LN  N +  +L+ E
Sbjct: 1281 TELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTE 1339

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  361 bits (926), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 383/1384 (27%), Positives = 704/1384 (50%), Gaps = 78/1384 (5%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGL-- 81
            I+ F     E ++ I    + RL +K+ +F   + E  ++ V  DE+K+    +I  L  
Sbjct: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64

Query: 82   ---KTEMENVL------RQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTE 132
               ++  E V+      R  D++++ER+  + K + L     QL+   E++K KL D  E
Sbjct: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNK---QLNASHETIK-KLED-EE 119

Query: 133  EKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLN 192
              KE  S+ Q  L+  D+  K V          + E + L+  ++E+E   Q   +N ++
Sbjct: 120  GAKEEASSWQDGLRN-DDSTKHV---------LDKENKLLQRKLLEMENILQVCKSNAVS 169

Query: 193  SRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQL 252
             + + +  +QE  L   NK W E+ LSS +++ L       + +  +  +LN+ + + + 
Sbjct: 170  LQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENES 229

Query: 253  EKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNA 312
              T N  L  +N +LS+ ++EK+L++KNL D+ NTEK EFS E+ L++++ DLL +QL +
Sbjct: 230  VSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTS 289

Query: 313  VKEELKSIRKSDSSNVTSDDSRKLISENESLL-KDLRLTKEKLAQCE------SECLRXX 365
              E   S+R  +  +     + + I   E L+   L+L K K  +C+      S+C+   
Sbjct: 290  F-ERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSK-EECQLLKNIVSDCI-EE 346

Query: 366  XXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFK 425
                               +   LK+Q +KE+  K Q+QNQ++ F++ELEHK P + SFK
Sbjct: 347  NGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFK 406

Query: 426  ERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQ 485
            ERT++               S  K    ++L    +KI   E +IH L RQRLDL RQV+
Sbjct: 407  ERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVK 466

Query: 486  YLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEK 545
             LL   S    +  PL  +E+  ++ +L+++N+   E DSQ I+T +LVEF+N+ ELQEK
Sbjct: 467  ILLSNISAIQTTTSPLSNDELMSLRKLLESENT-VNERDSQIIITEKLVEFKNIDELQEK 525

Query: 546  NTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQS--EKMXXXXXXXXX 603
            N ELL   R LADKLE+NE ++ + + KIEN+TI EAKEAI+ ++S   K+         
Sbjct: 526  NMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTR 585

Query: 604  XXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNK 663
                       +   +  +   I + T      E ++++LQ+++S    ES+  +  LN 
Sbjct: 586  ERDSYKLLASANDNKTHADTEGITEAT-----YEKKIRELQSKLSSTRVESSAIIQNLNG 640

Query: 664  EIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISK 723
            ++     S++D  I L + ++ ++L  E+  +L   ++  K + ++ R     L ++   
Sbjct: 641  QLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAAPPV 695

Query: 724  QDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIM 783
            QD K +  L +    ++K+   +  +SNLK E    I  ++SL ++L++   EK  L + 
Sbjct: 696  QDYK-YSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVK 754

Query: 784  VTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEW 843
            +++ +T   E+  +          +I  +E+   EL V    K+Q I  L+    S+++W
Sbjct: 755  LSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKW 814

Query: 844  YQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRL-HTYNVMDETIND 902
             QN I+  +K+  SV   ++ K+T I +L  ++++L  E+   K++     N  D    +
Sbjct: 815  AQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLE 874

Query: 903  DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEK 962
             +LRKEL+ ++I L +A+SQI+ Y+++  +    L+E+N +L ++ E    +IQ      
Sbjct: 875  PTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQ------ 928

Query: 963  INLEDKVSLLKEQSF-NLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021
              LE+K    KE+   +L  ELD    E+   + + ++  + L   ++++     +   +
Sbjct: 929  --LENKEKGAKEEELSHLRKELD----EIRCLQPKLREGASYLVLQSEKV----GDQAQR 978

Query: 1022 LSKIQDDLDQQTI----YANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLS 1077
            + ++++ +D+       Y     + Y+ EL+ + D+S+ +  L ++   Y+ ++K    S
Sbjct: 979  IQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKS 1038

Query: 1078 RSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDA 1137
                + +L  +EK W  +K     +L  +  + E L  +N +L  +I+     G   G  
Sbjct: 1039 LYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKID-----GATEGSN 1093

Query: 1138 RNGPTLN-NDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVE 1196
             N   L    +   LR ER  L+TK+T  +RD  +LRQK   ++  + D +      R +
Sbjct: 1094 SNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNK 1153

Query: 1197 NDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIE 1256
                + I+ +++ I++++ Q+N+LRE+N  L   L+N ++KN+ +  EL+ ++E I+ ++
Sbjct: 1154 VQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQ 1213

Query: 1257 SELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQL 1316
              L   K  +     ++   + E+ + K+R QD+ ++ +    N+ EKL + +  L+ +L
Sbjct: 1214 GHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKL 1273

Query: 1317 EDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRI 1376
             +      + E +FNRL++QA EKL  SK  Q  LT +LNELK+ K  LE +L++  +++
Sbjct: 1274 LNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKV 1333

Query: 1377 QELE 1380
             +LE
Sbjct: 1334 VDLE 1337

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  359 bits (922), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 425/1551 (27%), Positives = 763/1551 (49%), Gaps = 129/1551 (8%)

Query: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
            I+ F +   E ++ +   ++ +L +K+ +F   + E  ++ V  DE+K+    +I  LK 
Sbjct: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64

Query: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143
             +       DE  +++N  +AK E L   K QL+ E    +R+++ L   KK++  + + 
Sbjct: 65   LL-------DESSEQKN--TAKEE-LNGLKDQLNEERSRYRREIDAL---KKQLHVSHEA 111

Query: 144  TLKILDE-RLKE---VEMAKVENNRT-----NNECRNLRSTVVELETKQQTYITNDLNSR 194
              ++ DE R+KE   +  ++ + N +     N E + LR  ++E+E   Q   +N ++ +
Sbjct: 112  MREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQ 171

Query: 195  SELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEK 254
             + +   QE  L+  +K  +E++LSS S++ L+      + +  +  +L +++++++   
Sbjct: 172  LKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVF 231

Query: 255  TNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVK 314
            T N  L  +N +LS S++EKVL++KNL D+ + EK EFS E+ L++ + DLL +QL +++
Sbjct: 232  TYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLE 291

Query: 315  EE--LKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLR--------- 363
            ++  L++I K+D ++  + +   +I E       L  TK +L + ++EC R         
Sbjct: 292  KDCSLRAIEKNDDNSCRNPEHTDVIDE-------LIDTKLRLEKSKNECQRLQNIVMDCT 344

Query: 364  XXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINS 423
                                 D  +LK+Q IKE+  K QLQNQ+E FI+ELEHK P + S
Sbjct: 345  KEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELIS 404

Query: 424  FKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQ 483
            FKERT                 S  K  + RE+    +KI  CE +IH L +QRLDL RQ
Sbjct: 405  FKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQ 464

Query: 484  VQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQ 543
            V+ LL+  S   ++  PL ++E+  ++ IL++ N    E+DSQ I+T RLVEF NV ELQ
Sbjct: 465  VKLLLLNTSAIQETASPLSQDELISLRKILESSNI-VNENDSQAIITERLVEFSNVNELQ 523

Query: 544  EKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXX 603
            EKN ELL   R LADKLE+ E K  + L K+EN+TI EAK+AI+ L++            
Sbjct: 524  EKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINIL 583

Query: 604  XXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNK 663
                       S + +  N + +  +   +   E ++++L+A +S    E++  +  L K
Sbjct: 584  LRERDSYKLLASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRK 640

Query: 664  EIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISK 723
            E+     S+      L   ++ + LA+E+ ++L   +D  KAE   L K+   + S I  
Sbjct: 641  ELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHV 697

Query: 724  QDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIM 783
            +  +    L++    + K+   E  +S LK E    I +++SL ++ ++   EK  L++ 
Sbjct: 698  EKERASTELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMR 754

Query: 784  VTQLQTLQKEREDLLDEARKSCQ--NKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKI 841
            + + +      E+ +D + K  Q   KI E+E     L+ +   K Q I  +     S++
Sbjct: 755  LKESEI--SHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQL 812

Query: 842  EWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETIN 901
            +W QN I+  +    S++  ++ K+T IEKL  ++++L+KE+ + K +   Y  +D+  +
Sbjct: 813  KWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSD 869

Query: 902  ----DDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQS 957
                + +LRKELE  ++ L +A SQIQ Y+++  S   +L E+ ++L ++ E +      
Sbjct: 870  ASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENY------ 923

Query: 958  LTDEKINLEDKVSLLKEQSFN-LNNELD----LQKNEMEKKKVEFKKIIAILQNNNKEIE 1012
              D KI LE K    +E+  + L  EL     LQ  ++++  + F +    L+N  + I+
Sbjct: 924  --DAKIELEKKEKWAREEDLSRLRGELGEIRALQP-KLKEGALHFVQQSEKLRNEVERIQ 980

Query: 1013 TVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVK 1072
             +  + E   + +Q       +      + Y+  ++++ D+S+ +  L +     + ++ 
Sbjct: 981  KMIEKIEKMSTIVQ-------LCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELT 1033

Query: 1073 TLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGN 1132
                S    +++L ++E+ W  +K     +L  +  + E L  +N +L  +++  TAA N
Sbjct: 1034 KTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAANN 1092

Query: 1133 GVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNN 1192
            G  D     +L       LR ER+ L+TK+T  +R+   ++QK   ++  + D +     
Sbjct: 1093 GDKDHLKLVSL----FSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTL 1148

Query: 1193 SRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEII 1252
            S  E    + I+ +   I +++ Q+N+L+E+N  L+  L+N ++KN+E+  +L   +E I
Sbjct: 1149 SEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEI 1208

Query: 1253 APIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESL 1312
            + ++ +L   K  +     +I + + E+ + K+R QD+ ++ +     D EKL +E+  L
Sbjct: 1209 SRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDL 1268

Query: 1313 KAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDA 1372
            K +L        + E +FNRL++QA EKL  SK  Q  LT +LNELK  K  LE+ L+  
Sbjct: 1269 KGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFE 1328

Query: 1373 NTRIQELEGEKVAEDNNRSEMIKRSQEDAXXXXXXXXXXXXXNAISYSSTVRKLNEEIAT 1432
            N ++ +L+  K+     +SE + R  E                      T R L EEI +
Sbjct: 1329 NAKVIDLDT-KLKAHELQSEDVSRDHE--------------------KDTYRTLMEEIES 1367

Query: 1433 XXXXXXXXXXXXXXXXTAAGHRDEDLSNIVESMXXXXXXXXXXXXXXXTREVNKKIQEAQ 1492
                            TA        S+  E +               T+E  KK+QE  
Sbjct: 1368 -------LKKELQIFKTANSS-----SDAFEKLKVNMEKEKDRIIDERTKEFEKKLQET- 1414

Query: 1493 ERLNQPSSV------NIDEMKKQWXXXXXXXXXXXXXXXXXXLKKRIRLPT 1537
              LN+ +S       +I+ +KK+W                  LKKRIRLP+
Sbjct: 1415 --LNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPS 1463

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  300 bits (767), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 324/1214 (26%), Positives = 616/1214 (50%), Gaps = 77/1214 (6%)

Query: 194  RSELERKTQEL----NLLQSNKDWLE---KELSSKSEQYLSYRQRTDATISEIRSELNRL 246
            +S+ ERK ++     N   S K + E   KELS  S ++ + +  +   +   +  L+ L
Sbjct: 173  KSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSL 232

Query: 247  KNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLL 306
            +  ++L    N   K++NNEL+ ++ +++   K+L + LN  K+ F+ E+ L Q   DLL
Sbjct: 233  EKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLL 292

Query: 307  ETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRXXX 366
            +  +    E LK+  K  +   ++ +  +L+ E    L D++ + EK     SE      
Sbjct: 293  KEHI----EYLKNTTKETTGGTSTLEKDRLLHE----LVDIKKSLEK-----SELENVHL 339

Query: 367  XXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKE 426
                              + +LLK+Q IKEKR K+ LQ Q+E F++ELE+++P +NS K+
Sbjct: 340  NDFIEQYLTENEESTSDNELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKD 399

Query: 427  RTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQY 486
            R                 T  E + +I+EL  +N ++ +   +I++L  QR+DL  QVQ+
Sbjct: 400  RNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQF 459

Query: 487  LLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKN 546
            LL+   +    +  L  +EI F++ I+++ NS   +SDSQKI++ RLV+F ++  LQ++N
Sbjct: 460  LLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQN-DSDSQKIISERLVKFHDISVLQKQN 518

Query: 547  TELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXX 606
             ELL  TRNLA++LES++ KS Q +      T NE+KE I  LQ E +            
Sbjct: 519  MELLTTTRNLAEQLESSDTKSVQKI------TRNESKEKIAKLQ-ESINGLTSKLEKLQK 571

Query: 607  XXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL------ 660
                   +S Q     N+  Q  T+   EL SQ+Q  + +++++ R S+ +  L      
Sbjct: 572  EKDAYKLLSLQ-----NTGEQTPTE---ELRSQLQKKEEQLTKLERMSSLDSHLAEEKAK 623

Query: 661  -LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQS 719
             LN+ I  +   K D++  + KE S R +AE++ K+L ++L+L   + D   K+ +  ++
Sbjct: 624  VLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYET 683

Query: 720  SISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTS 779
             ++  +++  +   E  + ++K+S+ +  + + K  Q L +   K  +  L KL++    
Sbjct: 684  LLNDHNAENIKHSRENETTQAKISILQKEIESYK--QNL-LQYSKDNENTLSKLAAATQE 740

Query: 780  LRIMVTQLQTLQKERE---DLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEED 836
               + ++L T++ E E   +L+ E     +   +  E    + K++   K + +   E  
Sbjct: 741  KETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAK 800

Query: 837  NTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM 896
              S+I WYQ ++++L   ND +   +N++ T+I   + K+  LEK + +N     +   +
Sbjct: 801  KNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQNTNGSSSLPRV 860

Query: 897  DETINDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQ 956
            D+         + E  K  L E   +I +Y+ L     ++   +   L++  +   + ++
Sbjct: 861  DQ---------DFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAME 911

Query: 957  SLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVK- 1015
                 K  L+ +++ L ++  ++N+ L  QK + E  +        I+Q+   E E +K 
Sbjct: 912  G----KEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQ-------KIIQDKATETENLKN 960

Query: 1016 --SEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKT 1073
              S  E+K++ +++++ ++T      +N Y+++L K ++ S  I ++  +   Y+  +  
Sbjct: 961  SLSSLENKITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDG 1020

Query: 1074 LTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNG 1133
            L  + +  E+ +    +    +K +   Q+D     I++L+ Q  +   +    T+ G+ 
Sbjct: 1021 LKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGST 1080

Query: 1134 VGDARNGPTLN-----NDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDART 1188
              +  +   +N     N++++ LRRERD LD K+ +++R+   LR+++  +   L + R 
Sbjct: 1081 TSNDTDETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQ 1140

Query: 1189 KLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKL 1248
                   E     +  +QH   +++LN+LN L+E+N  L+ +L    K+N  + ++L  L
Sbjct: 1141 SFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELL 1200

Query: 1249 KEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESE 1308
            K  + P++ ++  LK S+ EK+Q++ L  EE  RWK RS++IL K QQ+   ++ KL  E
Sbjct: 1201 KNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEE 1260

Query: 1309 VESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERS 1368
            + +LK QL+ K +   +  +RFNRL++QA EKL  +K    +LT ++ +L DAK  LE  
Sbjct: 1261 LSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEID 1320

Query: 1369 LNDANTRIQELEGE 1382
            L++   RIQE+E +
Sbjct: 1321 LDEERKRIQEVESQ 1334

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  276 bits (705), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 335/1262 (26%), Positives = 619/1262 (49%), Gaps = 123/1262 (9%)

Query: 151  RLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELNLLQSN 210
            R+  VE A+  NN T+    N+   ++ L+ + +   +  L S+SE ER  ++  L++ +
Sbjct: 81   RITGVE-AQAPNNATS--ISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREH 137

Query: 211  KDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNS 270
              WLE+ L   +E+ ++ +Q     + E   E++ L+++  + K NND+L  KN ELS +
Sbjct: 138  NQWLEEHLVKTTEELMTQKQSI-LKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSEN 196

Query: 271  LQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTS 330
            +QEK++++K  SD  +T++QEF  EI LK R+   LETQL  +++E KSI+  D++    
Sbjct: 197  VQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE-KSIQNEDNT---- 251

Query: 331  DDSRKLISENESLLKDLRLTKEKLAQCESECLRXXXXXXXXXXXXXXXXXXXXXDFILLK 390
              SR   +E++ +++ L  T+++L    +EC R                         LK
Sbjct: 252  --SR---AESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYSSSSSL---LK 303

Query: 391  KQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMXXXXXXXXXXXXXHTSNEKN 450
            K+ +K K  K+ L+ Q+E+FI ELE KVPVI+S +++                  S E+ 
Sbjct: 304  KELLKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERE 363

Query: 451  AKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQ 510
            +  +E      K    +  I  LT QR DL  Q+Q+LL+       +   L K+E  FI+
Sbjct: 364  SLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIR 423

Query: 511  NILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQN 570
             + +ND      +DSQ I++ RL++F ++ ELQ++N ++L   R+LA +LE  E   + +
Sbjct: 424  RLTENDTYARN-NDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQAD 482

Query: 571  LLKIENKTINEAKEAILSLQ------SEKMXXXXXXXXXXXXXXXXXXXISKQASSFNNS 624
               IE KT+ EAK+A+L LQ        K+                    S + S  N+ 
Sbjct: 483  HHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDI 542

Query: 625  VIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKS 684
                  K + EL+   + L   I ++TR +           +DI + K ++   + K +S
Sbjct: 543  DKHTTGKLQNELQQTREYLTKEIEKLTRTN-----------KDILNKKKELEYSMKKMES 591

Query: 685  SRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSK-------THETLNEYIS 737
            ++  AE + +L+ N L + +     + +++D LQ  +S++++K        HE  ++Y  
Sbjct: 592  AKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNL 651

Query: 738  CKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDL 797
             + + + T++  ++L+ +        ++ ++EL ++  EK +L++ + +L+  + E + +
Sbjct: 652  LQIRFTDTQSQSNSLRTQH-------QTTQKELFEVVEEKNALKVKIHELEISRNECKGI 704

Query: 798  LDEARKSCQNKINEVEEAY-----NELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLK 852
                + + + K+NE    Y     + LK+    +DQ I  +E     ++ WYQ       
Sbjct: 705  ----QATVELKLNERLTEYQLHEQDLLKIIEKQEDQ-IRDMEVKRAEELNWYQK------ 753

Query: 853  KDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI----NDDSLRKE 908
                   N   + +TEI       K  E   + N+  L +             D S+RK 
Sbjct: 754  -------NFPTQTETEIGLPVDMKKEGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKS 806

Query: 909  LEMSKINLTEAYSQIQEYKKLYESTAQS-LREMNSKLDESNEAFSNQIQSLTDEKINLED 967
              +  + +     + +E KK    T  S +  +   + +  +    QI+ L  +K  L+ 
Sbjct: 807  TSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKT 866

Query: 968  KVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQD 1027
             +  ++ +  +L+++L L+KN  + +K      +  +  NN   E  K   E  L  ++ 
Sbjct: 867  SLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEM 926

Query: 1028 DLDQQTIYANTAQNNYEQELQKHADVSKTISE-------LREQLHTYRGQVKTLTLSRSE 1080
             L              E+E QKH + + T+SE       + E++  YR            
Sbjct: 927  KL--------------EEERQKHEETNATLSEKELLCEKMIEEISGYR------------ 960

Query: 1081 LENILKENEKSWTSQKQSLLEQ-LDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARN 1139
             E + K  E     Q    LE  LDL+N RI+DL +QN LL+ Q+     A   + D +N
Sbjct: 961  -EELSKSAEMQVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQLN----ATLDLEDTQN 1015

Query: 1140 GPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDE 1199
               +  DI+V ++RERD L  K+ + ER+ ++LR++   +  EL DA +K    +  N  
Sbjct: 1016 KDDI-KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSEL-DAVSK--GQQWHNLP 1071

Query: 1200 RSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESEL 1259
             S+++  H+ I+++L +++LLRE+N++L  E+      N  L  EL +++++  P++ + 
Sbjct: 1072 LSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQK 1131

Query: 1260 SALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEK-LESEVESLKAQLED 1318
            +  +   +EK+QEI L K+E+ RWKKR Q ++  H+Q  +   E   ++E++SLK  +E+
Sbjct: 1132 NNTERYFKEKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDSLKGLIEE 1189

Query: 1319 KMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQE 1378
            + ++  +  E+F  L++QA EKL  +K+  +TL   L+E+K + + LE  + + + +I+E
Sbjct: 1190 RTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIRE 1249

Query: 1379 LE 1380
            +E
Sbjct: 1250 IE 1251

 Score = 85.9 bits (211), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 130/275 (47%), Gaps = 36/275 (13%)

Query: 1585 VQEKQKELEDEYNEKLQEK--LKEVSHSSSISVNE-KDELRAEIEAKLREELNDELQNVK 1641
            +++++ ELE +++++++EK  L  ++  + +S +E K ++R E+E  + ++L  +L+ ++
Sbjct: 1411 IEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIR 1470

Query: 1642 KKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEEN 1701
             K+FEEGK+QA MKTTLLERKL+K+ESQ+++  +S     K  + +    +  P+  ++N
Sbjct: 1471 TKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDN 1530

Query: 1702 SNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSP--------SPKKLLQKDDVQKETSNNK 1753
            + +    +L      K +         NPFTSP        SP  L              
Sbjct: 1531 TGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPTQELSKSNSPAAL-------------- 1576

Query: 1754 TDPPTHLAPSFNIPATRVXXXXXXXXXXDTNDEELTVNEP---GQKISSAINSLSQTGSE 1810
              P  H+AP+F+    +                + T   P       S+A    S  G  
Sbjct: 1577 --PIVHMAPTFSFTPGKSTGTVNKELNKTA---QATFGAPTFSNFGTSTAFGGFSGFGKT 1631

Query: 1811 QNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDD 1845
             N +      + + E   +S KRP   V++ K+DD
Sbjct: 1632 TNDQSGFKPFEALKEIDNESIKRP---VSDEKEDD 1663

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  269 bits (688), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 267/1008 (26%), Positives = 517/1008 (51%), Gaps = 64/1008 (6%)

Query: 388  LLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMXXXXXXXXXXXXXHTSN 447
            +L  +  +E  +K++L+ Q+  F+ ELE   P+I SFK++++              H + 
Sbjct: 294  ILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTK 353

Query: 448  EKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIK 507
            +K    +E+    +++ +      IL R+R DL RQ+QYLL+ N    DS  PL   E  
Sbjct: 354  DKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFS 412

Query: 508  FIQNILQND--NSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNE- 564
            +I+ IL  D     T+ +DSQ I++ R+++F++++ELQ++N  LL   R L+D+ E+ E 
Sbjct: 413  YIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER 472

Query: 565  -IKSKQNLLKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXXXXXXXXXISKQASSFNN 623
             ++S  ++     + INEAK+ +L LQ                        S     F N
Sbjct: 473  KLESGDSI-----EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGN 527

Query: 624  SVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEK 683
            S +           + +Q L+ +   +  ES++ +  L  +I ++  SKSD++ E     
Sbjct: 528  SDLSD--------GNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLI 579

Query: 684  SSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLS 743
            +S+ L E+R K+  + LDL+K EN  LR R  +   ++ +++ +T +T+ +Y+ C +KL 
Sbjct: 580  NSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLD 639

Query: 744  VTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLDEARK 803
            V +  L N  +E+ +  +++ S++ +L++   E+ + + ++ QL+ LQK +++ L + + 
Sbjct: 640  VIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQV 699

Query: 804  SCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVN 863
            S QNKI+++E    EL+ +   K+        +  +++EWYQ K ++L   ND++   + 
Sbjct: 700  SLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMI 759

Query: 864  EKQTEIEKLQYKVKSLEKEIEE----NKIRLHTYNVMDETINDDSLRKELEMSKINLTEA 919
            E  + IE L  K ++L+  ++E    NK+      V D      +L  EL  S+  LT+ 
Sbjct: 760  ECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDT 819

Query: 920  YSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNL 979
              ++       E ++ ++R+  S++   NE  S     L +E  +L D++++L+      
Sbjct: 820  SREL-------EISSNTIRQYQSEIKVLNERQSE----LENENKHLRDEIAILR------ 862

Query: 980  NNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTA 1039
             +EL     E E++K    K ++ L+    E+  ++ +Y +++ K++ DLD+Q +     
Sbjct: 863  -DELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEI 921

Query: 1040 QNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSL 1099
            +  +++E++   +V    +E      TYR +++ + + +++   +  E EK   S+ + L
Sbjct: 922  KLAHDEEVR---EVQNRNTE------TYRNELELVEIRQTK---VFVEKEKELESRIKIL 969

Query: 1100 LEQLDLSNSRIEDLSSQNKLLYNQIELYT-AAGNGVGDARNGPTLNNDILVTLRRERDIL 1158
             EQ++L   R++  S +  LL  Q++L      + + DA   P    D++  L  E+  L
Sbjct: 970  NEQIELDKERMKQFSDEESLLREQVKLLADEKASDLVDAGVSPEY-TDLVRKLSDEKKNL 1028

Query: 1159 DTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLN 1218
            ++K+  ++ +   LR+++T  + E+  A   +N  + + +  + +  +     E + QL 
Sbjct: 1029 ESKLFASQSEKNRLREQLTKTESEI--AVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLE 1086

Query: 1219 LLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKE 1278
             L+ESN++L NE++    +N E+ +EL +LK     +ES+L   +  +  K+ ++   + 
Sbjct: 1087 SLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQT 1146

Query: 1279 EVHRWKKRSQDILEKHQQLSSND-YEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQA 1337
            E  R K  S D+ +   + SS++    L+S V +L  Q+++     TE E+RF RL+RQA
Sbjct: 1147 ECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQA 1206

Query: 1338 QEKLKTSKLTQETLTEQLNELKDAKVAL----ERS---LNDANTRIQE 1378
            +E+L  SK+T  +L + +  L   K AL    ERS   LN+   +IQE
Sbjct: 1207 RERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQE 1254

 Score = 66.6 bits (161), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 90/186 (48%), Gaps = 43/186 (23%)

Query: 1585 VQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKS 1644
            ++ K  ELE+++  +++ K KE+           + L+ EIE K +    D L  VKK++
Sbjct: 1427 MRAKMDELEEQFQNRVRNKEKEL-----------NALKDEIEEKCKTGHEDTLIAVKKRA 1475

Query: 1645 FEEGKQQATMKTTLLERKLAKMESQLSEIKQS-----AESPPKHANNVPNPLLGLPRKIE 1699
            FEEGKQQATMK ++LERK+AK+E++    K       +E  P+     PN       K++
Sbjct: 1476 FEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFV--TPN-----NNKVQ 1528

Query: 1700 ENSNSPF-NTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLLQKDDVQKETSNNKTDPPT 1758
            + +N PF  T  SG     F+         NPFT+P          V +  ++      +
Sbjct: 1529 Q-ANQPFLATAGSG-----FSVQSSES---NPFTTP----------VSRGAAHTNASSQS 1569

Query: 1759 HLAPSF 1764
              AP+F
Sbjct: 1570 KFAPTF 1575

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  254 bits (648), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 289/1103 (26%), Positives = 554/1103 (50%), Gaps = 61/1103 (5%)

Query: 130  LTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITN 189
            L +EK   Q  +   LK+L+ER+ +++  K + N+   E +NL     +L  + +T    
Sbjct: 63   LQKEKLASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDE 122

Query: 190  DLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKND 249
             L  R++L++ T  L+L    K   E E  SK + + SY+ R +     +   L  + N+
Sbjct: 123  KLLLRTQLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNE 182

Query: 250  FQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQ 309
             ++    N  L ++N ELS  L+ K+ ++K+L +SL T   +F +E  L+ +LI+ L+ Q
Sbjct: 183  LRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQ 242

Query: 310  LNAVKEELKSI--RKSDSSNVTSDDSRKLISENESLLKDLRLT-KEKLAQCESE------ 360
            +  ++E+L+S+   K D       D  +L+ + ++L + L ++ +E+L+   S       
Sbjct: 243  IKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNI 302

Query: 361  CLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420
                                    D  +L+K ++KE++ K QL+ Q+   + ELE  +P 
Sbjct: 303  PEEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPS 362

Query: 421  INSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480
            ++S+KER+               H   E   K  EL  K  + +   + I+ L  QR  L
Sbjct: 363  LSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVL 422

Query: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540
             RQV+YLL+    +      L +++++ +   L   N+    SDS+KIL  RL +F+NV 
Sbjct: 423  ARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAA-NTAEAMSDSEKILLERLAQFKNVK 481

Query: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKI---ENKTINEAKEAILSLQ--SEKMX 595
            ELQ +N +LL+++R LA K E  E   K NL +I   E++TIN+AKEAIL LQ  S+K+ 
Sbjct: 482  ELQNRNMQLLQVSRELASKAEKLE---KVNLKQISSEEDETINDAKEAILVLQEYSQKLE 538

Query: 596  XXXXXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITREST 655
                              + K+  +   S I  ++K + +  S   DL  ++S   + S 
Sbjct: 539  SQIKELSDELA-------VQKKEKTEKES-ISAMSKIEDDASSHTIDLGKQLSANLKHSK 590

Query: 656  QNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSD 715
              +  LN EI++++ + +D++I L KEKS+R LAE+R+ LL   + L K+E ++L++  +
Sbjct: 591  DIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVN 650

Query: 716  SLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSS 775
             LQ +I  ++ +   +  +YISCKSKLS  E  +++L+ E +L I+++ +L+ + + L +
Sbjct: 651  KLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLN 710

Query: 776  EKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKIN----EVEEAYNELKVETSHKDQHIM 831
            E+ +LR+ VTQ+ +L  E + LL E +    +K+     +  +  N+L++      Q + 
Sbjct: 711  ERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQL----VQQRMS 766

Query: 832  QLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLH 891
            +L+  N S+I+WY+  I+ LK +       V E   E+++ + K++   K +E  +  L 
Sbjct: 767  ELKSQNDSEIKWYKATIDDLKAN-------VFELNEELKQKEEKIEEFSKTLENVQNELT 819

Query: 892  TYNVMDETINDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAF 951
              N  D +    +L KEL   K  L ++  +++EY+ +  ++ +S    + + ++  +A 
Sbjct: 820  LANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKAL 879

Query: 952  SNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEI 1011
            ++++ S   E+  L++ +S L+ +     +EL    N + + +V +  ++        E 
Sbjct: 880  ASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRVSYDSLLL-------EQ 932

Query: 1012 ETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQL--HTYRG 1069
            +T K     K ++++  +  +T   ++   +YE+ +Q+++++SK +  LRE++   T  G
Sbjct: 933  KTFK----DKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNG 988

Query: 1070 QVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTA 1129
            + +       + E+I+K+ +  W  +K+    ++ ++N          +       L + 
Sbjct: 989  EKEG---DLEDTESIIKKGQDVWDEEKKVF--EVQITNLNERLSELLEENESLLARLESQ 1043

Query: 1130 -AGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDART 1188
              GN    A      N + L  LR ER  L  K+T A+++ + +R K+   +  L +   
Sbjct: 1044 DKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAF 1103

Query: 1189 KLNNSRVENDERSSIVQ-QHDVI 1210
            +L   + +  E SS+ Q +HD++
Sbjct: 1104 ELKKIKSQIFELSSLPQNEHDIL 1126

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 89/193 (46%), Gaps = 40/193 (20%)

Query: 1585 VQEKQKELEDEYNEKLQEKLKEVS-HSSSISVNEKDELRAEIEAKLRE----ELNDELQN 1639
            +++++ ELE  + +K++E+ K +  HS    + +   +  EIE   RE    E +++L  
Sbjct: 1255 IEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKK---IYKEIEESGRETLQQEFDEQLNI 1311

Query: 1640 VKKKSFEEGKQQATMKTTLLERKLAKMESQ----------LSEIKQSAESPPKHANNV-P 1688
            V+KK+FEEGKQ   MK+  LERK++ +E Q             +K++  S  +H +++  
Sbjct: 1312 VRKKAFEEGKQHVLMKSAFLERKISMLEGQLKEKNKLNNNSKNLKENVSSTDEHNSSIQG 1371

Query: 1689 NPLLGLPRKIEENSNSPFNTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLLQKDDVQKE 1748
            NP   L +   E  N P        +    +       + NPFTS            Q E
Sbjct: 1372 NPFFNLGK---EQMNVP--------RFTSESSTMSTTSSLNPFTSFE----------QAE 1410

Query: 1749 TSNNKTDPPTHLA 1761
            T  ++   P H+A
Sbjct: 1411 TKTHEEHLPPHIA 1423

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  200 bits (508), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 302/1231 (24%), Positives = 576/1231 (46%), Gaps = 116/1231 (9%)

Query: 165  TNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQ 224
             N E R+ R  VVEL  +     T    S  + +R +++L   +   +     L   +++
Sbjct: 85   ANAELRSAREQVVELRQRLGESETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTKK 144

Query: 225  YLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDS 284
             L + QR D  +  IR +L++  ++ +  + +N  L      ++  L +K    K LSD 
Sbjct: 145  LLDF-QRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQ 203

Query: 285  LNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLL 344
            L++++ +F  E+A + +L  +L+ Q+N++  EL +  ++ +    +D   K  S++E  +
Sbjct: 204  LSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEEEI 263

Query: 345  KDLRLTKEKLAQCESECLRXXXXXXXXXXXXXXXXXXXXXDFILLKKQYIKEKRAKEQLQ 404
             + +   E+L     +                            L+K  +KE++    L+
Sbjct: 264  SNYKEQVEELLGILGQG---------------------APSIAHLRKLLLKERKENVSLK 302

Query: 405  NQIESFIVELEHKVPVINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIA 464
             Q+ESF++ELEH++P +   +++                  S  K    REL+   +K+ 
Sbjct: 303  KQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVD 362

Query: 465  KCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESD 524
                  H L  QR DL  Q+Q+LL  NS    S   L   E+ FI+ I++N+N    + D
Sbjct: 363  HLNQIFHKLRVQRSDLAHQIQFLLTVNS----SDTVLPPSELSFIKTIIENENWDAYK-D 417

Query: 525  SQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKE 584
            SQ+I++ RL+ F N+ ELQE+N +L+   R+L DK+ES E  +   L      T+  AK 
Sbjct: 418  SQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAK- 470

Query: 585  AILSLQSEKMXXXXXXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQVQDLQ 644
                LQ  K+                     K   S ++ +      T  E + ++++L+
Sbjct: 471  ----LQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSKI----NVTMVEQQKKIEELE 522

Query: 645  ARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTK 704
            ++++ +     Q +++LNK I     ++S I++ L ++  + + ++   K   + L   K
Sbjct: 523  SKLTDVGESHVQKINVLNKTIDR---NQSTINM-LNEQIKNTVKSDMNAK---SELIACK 575

Query: 705  AENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETAL----SNLKLEQKLKI 760
             EN  L ++  + Q+ + + +SK+ +   +Y    ++LSV         ++  L  + K 
Sbjct: 576  RENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKT 635

Query: 761  DSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLD-------EARKSCQNKINEVE 813
              E+  +   DK+  E   L     QL+T  KE E  +         + ++  +KI  + 
Sbjct: 636  QMEQKQRSLFDKIQQESKKL----LQLETRNKELEVKISGKELHRKRSEETLSSKITFLS 691

Query: 814  EAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQ 873
            E    L  + + K++ + Q  E +  +I+WYQ  I+ L + N +       K  +I +L 
Sbjct: 692  EENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKN-------KSNKIIELN 744

Query: 874  YKVKSLEKEIEENKIRLHTYNVMDETINDDSLRKELEMSKINLTEAYSQIQEYK------ 927
             K++ L ++   NK     Y V  E      L+ EL   K  L  + SQ   YK      
Sbjct: 745  DKLRLLSEKSLSNK----PYPVGTEL---KELQNELNGMKAALEVSESQATLYKDTLERN 797

Query: 928  -KLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQ 986
               Y ++  S +   S+L   NEA S Q ++L ++    E++   ++ +   + + L  +
Sbjct: 798  QNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSE 857

Query: 987  KNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQT---IYANTAQNNY 1043
            K  +E+K       +  L ++ ++I  +K EY++++ KI+ +L  Q+   +   +A  + 
Sbjct: 858  KTALEEK-------LNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSK 910

Query: 1044 EQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQL 1103
            E+EL  +A     I +L  ++      +  LT      + ++KE        + SL ++L
Sbjct: 911  EKELTSYA---VQIEQLNTEIAKLNSDIAALTEPAEARKTLIKE--------RDSLGQEL 959

Query: 1104 DLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVT 1163
             L+N RIE L++QN +LY+    ++   +   DA     L N +++ LR ERD+  ++ T
Sbjct: 960  KLANQRIESLAAQNSILYD---TFSGMRHVDADAEPNEDLRN-LVINLRIERDMHQSQET 1015

Query: 1164 VAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRES 1223
             A+RD K+L++ +  +  +L     +++       +  S+   H+ IM +L  L   +E 
Sbjct: 1016 TAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEE 1075

Query: 1224 NITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRW 1283
            N+ L   +++ ++  + LQ E+ +L+E     +   SA+  S QE +Q+I   ++E  +W
Sbjct: 1076 NLYLDESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAI--SEQEWQQKIETYQQESEKW 1133

Query: 1284 KKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKT 1343
            K   Q + E     ++ + + L+ ++E+ KA ++ K Q+  +  +RF RL++QA EKL  
Sbjct: 1134 KLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNA 1189

Query: 1344 SKLTQETLTEQLNELKDAKVALERSLNDANT 1374
            SK T ++L  +L+ELK    AL+  LN+  T
Sbjct: 1190 SKATSDSLAIELSELKTVNDALQEKLNNQET 1220

 Score = 70.1 bits (170), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 20/118 (16%)

Query: 1585 VQEKQKELEDEYNEKLQE-----KLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQN 1639
            + +++ +LE+++  K+ E     KL E+S+ ++      DEL  E+  +++  L ++ + 
Sbjct: 1370 IAKRKAQLEEQFQTKVAEQANLLKLSELSNKTA------DELEKEVREEIKTRLEEDFEL 1423

Query: 1640 VKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHAN-----NVPNPLL 1692
            +KKK+FEEG+QQA+MKTTLLERK+AK+E++L    Q    P K AN     N+ +PL+
Sbjct: 1424 LKKKAFEEGRQQASMKTTLLERKIAKLEARL----QGGTGPLKSANGLNKINIDSPLM 1477

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  174 bits (440), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 151/461 (32%), Positives = 243/461 (52%), Gaps = 29/461 (6%)

Query: 403 LQNQIESFIVELEHKVPVINSFKERTDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEK 462
           L++ I++++ ELE ++P+I +FK   +                 N+K   ++ ++   + 
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 463 IAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTE 522
           I +  + I  L  QR DL  Q+QYLLI +S+ ND+ GPL K EI F+QN++  D    + 
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS- 332

Query: 523 SDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEA 582
           SD Q +++ RL++F++++ LQEKN EL +  RNLA  LES E + K +    +N TINEA
Sbjct: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392

Query: 583 KEAILSLQSEKMXXXXXXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQ--- 639
           KE ILSLQ                       IS+  SS  NS         +E E Q   
Sbjct: 393 KETILSLQ-------EYNNVLKLEIGTLQSKISELQSSIPNS---------KESEKQHFN 436

Query: 640 -----VQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFK 694
                V+DL++++S+++  S   +  LNK+IQ++Y+ ++DI I L KEKSS ILA E+  
Sbjct: 437 YHSNLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLT 496

Query: 695 LLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKL 754
           LL N+ DL   EN++L  ++  L+  +++++   +  LN+YI CK+ L      L+ L  
Sbjct: 497 LLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLN- 555

Query: 755 EQKLKIDSE-KSLKQELDKLSSEKTSLRIMVTQL-QTLQKEREDLLDEARKSCQNKINEV 812
             KL ++ E  SLKQE+     +   L      L Q+L+ E     D+  K  +  I+++
Sbjct: 556 NNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKV-KELELNISKL 614

Query: 813 EEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKK 853
            E    L+ +  +K+  I  L   N  +I WYQ K++  +K
Sbjct: 615 NEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEK 655

 Score =  109 bits (273), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 158/283 (55%), Gaps = 36/283 (12%)

Query: 1109 RIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERD 1168
            R+++L++QN+LL  ++E            R+     +DI V+LR ERD L  +V   E+D
Sbjct: 734  RVQNLATQNRLLLEKLE------------RSANLEVDDIFVSLRYERDTLSDQVVNYEKD 781

Query: 1169 AKMLRQKITLMDVELQDARTKLNNSRVENDE-RSSIVQQH-------DVIMEKLNQLNLL 1220
             +++     L D+E   +     NS++ N E + ++VQ H       + ++EKL +L+ L
Sbjct: 782  MQVI-----LADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDEL 836

Query: 1221 RESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEV 1280
            +E N+ L  E+   ++ N  L+ +L +  E + P+E+++S L   +++K+  I ++ E+ 
Sbjct: 837  KERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKA 896

Query: 1281 HRWKKRSQDILEKHQQLSS--NDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQ 1338
              WK R  ++      LS+  ND E L +    L+ Q+E+K ++  E  +RFNRL++QA 
Sbjct: 897  ENWKTRFNEL-----TLSAKNNDNEDLIN----LQKQVEEKSKENEELSDRFNRLKKQAN 947

Query: 1339 EKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELEG 1381
            E+L  SK+ Q  LTEQ NELK     LER+L++   R +ELE 
Sbjct: 948  ERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELEN 990

 Score = 59.7 bits (143), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 16/86 (18%)

Query: 1585 VQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKS 1644
            ++ K  +LE++Y    ++KL+ VS  S+           +IE K+++E  D L N KKK+
Sbjct: 1130 IESKVADLEEDY----KKKLETVSAEST-----------DIE-KIKQEFEDNLVNAKKKA 1173

Query: 1645 FEEGKQQATMKTTLLERKLAKMESQL 1670
            FEEGKQQA+MKT  LE K+AK+ESQL
Sbjct: 1174 FEEGKQQASMKTKFLENKIAKLESQL 1199

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  163 bits (412), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 177/585 (30%), Positives = 295/585 (50%), Gaps = 52/585 (8%)

Query: 24  IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83
           I+SFFD      +S+D   + ++  K     +L  EN  ++ + D++K     KI+ +  
Sbjct: 17  ISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAIDDIKHVYEGKINTISQ 73

Query: 84  EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQ-------LSNELESVKRKLNDLTEEKKE 136
           +  N+  +N +++++ +      E L +EK +       L++E+  +K  L  +  +   
Sbjct: 74  KYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTT 133

Query: 137 IQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETK-----QQTYITNDL 191
           +++ +++T  +L++   E++ +  EN+        L+  +   E K     Q+ ++ N  
Sbjct: 134 LEARERKTENVLEQSKLELQDSLTENSA-------LKEQIGVFEGKLDSMTQELWLANTE 186

Query: 192 NSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQ 251
           N + +   K     LL+ N  +LE +     +    Y    DA  S ++ +L  + ++  
Sbjct: 187 NKKLQTGMK-----LLRENNLYLEIKCKETDKNKKLYSSAEDA--SRLQDQLQIVSSEIL 239

Query: 252 LEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLN 311
             K+    LK  N  LS  LQ K+  +K+L D+LN+ KQEF+ EI LKQR+ +LL  ++ 
Sbjct: 240 SLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIA 299

Query: 312 AVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESEC--LRXXXXXX 369
           + K   K I +  S N+ + + +K+I E    L DL   KEKL   E EC  L+      
Sbjct: 300 SYK---KQIERLTSKNLETPE-KKIIQE----LVDL---KEKLVNSEKECNELKSTVDKY 348

Query: 370 XXXXXXXXXXXXXXXDFIL--LKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKER 427
                            ++  L++Q +KEKR K+ LQ Q+ESF+VELE K+P+I+SFKER
Sbjct: 349 INIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKER 408

Query: 428 TDMXXXXXXXXXXXXXHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYL 487
                            T+ E++ K REL    +KI+  E     L RQR DL  QVQYL
Sbjct: 409 NSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYL 468

Query: 488 LITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNT 547
           L+      D+K P  ++E   ++ I+ N+N+   ++DS KI++ RL+ F+NV ELQ+KN 
Sbjct: 469 LL----CIDNKSPFTEKEATLVKKIVSNENT-ENDTDSHKIISKRLLHFQNVKELQQKNM 523

Query: 548 ELLRITRNLADKLESNEIKSKQNLLKI--ENKTINEAKEAILSLQ 590
           ELLR TR L   LE  E + +Q  L+I   NK +  AK   + L+
Sbjct: 524 ELLRTTRQLVQTLERQE-QEQQKTLRITDNNKIVESAKSTSVDLE 567

 Score =  108 bits (270), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 121/206 (58%), Gaps = 6/206 (2%)

Query: 1170 KMLRQKITLMDVELQDARTKLNNSR------VENDERSSIVQQHDVIMEKLNQLNLLRES 1223
            KML   +   +  L+ AR +  N R      V+ D++S   +  + +ME   +L  L ES
Sbjct: 1016 KMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEES 1075

Query: 1224 NITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRW 1283
            N  L  E+ENC+K N+ L S+L  ++  + P+E E++ LK  + EKEQ + + +EE+ RW
Sbjct: 1076 NAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERW 1135

Query: 1284 KKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKT 1343
            K RSQ IL++ + +    + K   ++++L+ QLE    +  +  +RF+RL++QA EKL  
Sbjct: 1136 KLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDA 1195

Query: 1344 SKLTQETLTEQLNELKDAKVALERSL 1369
            +K  Q  LT Q+NEL + KV LE+SL
Sbjct: 1196 AKTMQINLTTQINELNETKVNLEKSL 1221

 Score = 76.3 bits (186), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 88/160 (55%), Gaps = 26/160 (16%)

Query: 1585 VQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKS 1644
            +++++K LE E+  KL+E       +  ++     + RA+IE +LRE+ N EL  +KKK+
Sbjct: 1389 IEKRRKVLEQEFETKLRELGLNADGNGVVT-----DTRAQIEKELREKFNLELAEIKKKA 1443

Query: 1645 FEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEE---N 1701
            FEEGKQQ+ MK+TLLERKL+K+ESQ         SP K  NN  N    +P KI     N
Sbjct: 1444 FEEGKQQSMMKSTLLERKLSKLESQ-------TLSPTK--NNDSNE-TQVPSKINLSNIN 1493

Query: 1702 SNSPFNTLLSGEKLLKFNXXXXXXGAF----NPFTSPSPK 1737
            S+SP      GEK+L+ N             NPFT  S K
Sbjct: 1494 SSSP----PLGEKVLQLNYGANVVAETDNDDNPFTLQSGK 1529

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  124 bits (310), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 176/742 (23%), Positives = 340/742 (45%), Gaps = 59/742 (7%)

Query: 140 NQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELER 199
           N    L+ L E+L  + +     NR  NE   L   + ELE K +    N+L+++ ELE+
Sbjct: 51  NDSTDLQTLHEQLNNITLKY---NRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEK 107

Query: 200 KTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDV 259
            +   N L+S    LE +LS+ ++   +           +  E+  LKND  + +T  D 
Sbjct: 108 MSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILILETKYDK 167

Query: 260 LKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKS 319
           L +  N+  ++L+EK+ +L  L  S       F +E  LK  +I+  +  +  +  E++S
Sbjct: 168 LLKGYNDTKDNLKEKISELLALDTS-------FKSETKLKDEIIEEKDYLIANLTNEIES 220

Query: 320 IRKSDSSNVTSD-------DSRKLIS--ENESLLKDLRLTKEKLAQCESECLRXXXXXXX 370
           ++  + +  +SD       +S  ++   E + LL +  +  EK+ + + +  R       
Sbjct: 221 LKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNE 280

Query: 371 XXXXXX--XXXXXXXXDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERT 428
                           DFI+LKK+  K +  ++ LQ ++E  I ELE+  P +N+  ++ 
Sbjct: 281 FQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKI 340

Query: 429 DMXXXXXXXXXXXXXH-------TSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLC 481
           +              H         NEK   I  L + ++KI         L  +  DL 
Sbjct: 341 NELELLLSKEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKI-------ETLREENNDLT 393

Query: 482 RQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTES-----DSQKILTGRLVEF 536
            Q+Q++LI+NS+ ND  G L + EIKFI+ + +    GT  S     +SQ I++ RL+ F
Sbjct: 394 NQIQFMLISNSIQNDKYGELTENEIKFIKALRE---KGTETSFNELYNSQDIISDRLIRF 450

Query: 537 RNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMXX 596
            +VI LQ+KN EL++  R +  KL++ E + +       +  +NEAKE IL + SE    
Sbjct: 451 ESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSE---- 506

Query: 597 XXXXXXXXXXXXXXXXXISKQASSFNNSVIQQLTKTKRELESQ---VQDLQARISQITRE 653
                             ++  S   N     L + K   E     + +L+  I + T++
Sbjct: 507 -SDKLKEKISELQQQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNNIPEFTKQ 565

Query: 654 STQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKR 713
           ++  +S+   ++  +Y+   +++ +  K   SR + +++  LL +  D     N++L++ 
Sbjct: 566 ASNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEH 625

Query: 714 SDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKL 773
            + ++ +I ++D   + T+  ++ CK+ L      +++L      K D  K LK +  ++
Sbjct: 626 MEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSL----MTKYDELKYLKDQQSRI 681

Query: 774 SS----EKTSLRIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQH 829
           ++    E+  L++ +  ++T+Q + +    E + S  +KIN++E   + L  +   K+Q 
Sbjct: 682 TNELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQE 741

Query: 830 IMQLEEDNTSKIEWYQNKIETL 851
           +         +++WYQ K +  
Sbjct: 742 LQDFISTKNRELDWYQKKFDIF 763

 Score = 40.8 bits (94), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 85/166 (51%), Gaps = 12/166 (7%)

Query: 1236 KKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQ 1295
            K N++LQ +L   ++ I  ++ E+  L  S+ E ++       E+   + R +++  K +
Sbjct: 906  KSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLK 965

Query: 1296 QLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQL 1355
            + S      L+S+    K + E K ++  E  +RFNRL++QA  +L +SK  Q  L EQ+
Sbjct: 966  EAS------LQSD---FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQI 1016

Query: 1356 NELKDAKVALERSLNDANTRIQELEGE---KVAEDNNRSEMIKRSQ 1398
            + LK     ++  L   +  +QELE +     A+  +RS  I +SQ
Sbjct: 1017 SSLKKDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIPKSQ 1062

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 89.7 bits (221), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 120/479 (25%), Positives = 232/479 (48%), Gaps = 54/479 (11%)

Query: 389 LKKQYIKEKRAKEQLQNQIESFIVELEHKVPVI--NSFKERTDMXXXXXXXXXXXXXHTS 446
           +K + IKEK  K  L+ +   F+ ++E K+P +  NS +  T+              H  
Sbjct: 286 IKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETN---NGNKIEEQKIIHEH 342

Query: 447 NEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSN-DSKGPLRKEE 505
           +    + + L IK   +   E+ +  L +QR DL  Q+ YLLIT S  N D+   L + E
Sbjct: 343 DSLKLENQSLKIK---LNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENE 399

Query: 506 IKFIQNIL-QNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNE 564
           + FI+N++ Q  N+ +TE+  Q I++ RL++F NV +L  KN +L+ + R L +K+ES E
Sbjct: 400 LNFIRNLVAQPTNTWSTET--QNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIE 457

Query: 565 IKSKQNL--LKIENKTINEAKEAILSLQSEKMXXXXXXXXXXXXXXXXXXXISKQASSFN 622
            ++ Q    L+++ K+I+EAK+ ++ L+ E +                           N
Sbjct: 458 KQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVK--------------------------N 491

Query: 623 NSVIQQLTKTKRELESQVQDLQARIS------QITRESTQNMSLLNKEIQDIYDSKSDIS 676
             +I Q+   K+ LE ++  L + ++      +I RE T     L K  Q + +  + +S
Sbjct: 492 KDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLS 551

Query: 677 IELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYI 736
           IE+    +   + +E+F LL  +    K    ++   S   +SS+  +D      ++E +
Sbjct: 552 IEISNASNENKILKEKFDLLIKSYTELKELKSEI---STYTKSSVISKDGNETAKISELV 608

Query: 737 SCKSKLSVTETALSNLKLE-QKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKERE 795
             K+K    E +  + + + Q+L+I++  ++K EL K+ SE  + +     + +  + + 
Sbjct: 609 DLKAKCKNLEKSFKDRESKFQELEIEN-NNVKDELKKVLSEYNTFKSTRGTIDSFNQNKN 667

Query: 796 DLL---DEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETL 851
            +    +  ++  + ++N V+     L+ +   ++  I  L E   S+I+WYQ+KI+ +
Sbjct: 668 SIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEM 726

 Score = 38.1 bits (87), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 38/56 (67%)

Query: 1307 SEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAK 1362
            +E++ LK Q+E K ++ TE+ +RF RL++QA++KL   K T+  L E   +L+ +K
Sbjct: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSK 806

 Score = 37.0 bits (84), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 87/184 (47%), Gaps = 19/184 (10%)

Query: 1577 LQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDE 1636
            L+K+ E R+ ++ ++L D+YN KL++ L E      + +++K     E+E KL+ E ++ 
Sbjct: 976  LEKEYEERLSKESEKLSDQYNNKLKDDLSE----ELLKIDKK--YAMELETKLKNETDE- 1028

Query: 1637 LQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPR 1696
                 KK F++       K  +L +K+  +E+Q+ E+K   +   KH +N       +P 
Sbjct: 1029 ----SKKEFQDALGTEQTKNKILSKKIEFLETQIKELK---DEQTKHHSNPMKSDEKIPS 1081

Query: 1697 KIEENSNSPF--NTLLSGEKLLKFNXXXXXXGAFNPFTSPSPKKLLQKDDVQKETSNNKT 1754
                ++N  F  N  +S      +       G+  PF+  +P+K   K      T+++ T
Sbjct: 1082 TTNLSTNFAFGQNPFVSNASQNAYMSNVFLSGS--PFSRNAPEKAF-KHSTPDNTNSSIT 1138

Query: 1755 DPPT 1758
              PT
Sbjct: 1139 VQPT 1142

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 57/91 (62%), Gaps = 8/91 (8%)

Query: 1305 LESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKV- 1363
            L+++ E+LK   E+K ++  EA ++F+RL+RQA E+L  SK TQ+ L++ +  L+D +  
Sbjct: 646  LKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTN 705

Query: 1364 ------ALERSLNDANTRIQELEGEKVAEDN 1388
                   LE  +N+ N  + E E +K++E+N
Sbjct: 706  FKEHISKLEVDINNLNNALVEAE-KKLSEEN 735

>NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {ON}
            Anc_8.636 YOR216C
          Length = 487

 Score = 36.6 bits (83), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%)

Query: 1216 QLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIR 1274
            QLN     NI L++++E+ +K+NKEL S ++ L +  + +ESE  AL+ +  E E++I+
Sbjct: 170  QLNEYESQNIKLKSKVESVTKENKELSSTVITLNKEFSTLESEYEALENTSSEYEKKIK 228

>KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {ON}
            similar to uniprot|Q12234 YOR216C Saccharomyces
            cerevisiae RUD3 Golgi matrix protein that is involved in
            the structural organization of the cis-Golgi
          Length = 471

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 93/167 (55%), Gaps = 27/167 (16%)

Query: 1224 NITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEK-------EQEIRLA 1276
            N++LRN+LEN +++++ELQ+ +V L + ++ +  E  +L   + E        E++++  
Sbjct: 170  NLSLRNKLENSNREHEELQNTVVTLNQEVSGLNDECESLSQELSEAVEKSSKFEEDLKTL 229

Query: 1277 KE----EVHRWKKRSQDILEKHQQLSSN---DYEKLESEVESLKAQLE--DKMQQGTEAE 1327
                  E H W+ + +++    + L SN   D E L+ E E LK +LE  +++++ +EA 
Sbjct: 230  SSHNANERHTWETKFKEL----ELLLSNMKQDMESLKEEREDLKQRLEKSERLKETSEAN 285

Query: 1328 ----ERFNRLRRQAQEKLKTSKLTQ-ETLTEQLNE--LKDAKVALER 1367
                ER   L++QA E+  + K  + +TL  Q+ E  +K+ K+ LER
Sbjct: 286  LAELERQLELQQQAGEETISEKAKRIQTLEAQIQEYRIKNEKIELER 332

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 60/112 (53%), Gaps = 6/112 (5%)

Query: 63  ITVSFDELKTNSLKKIDGLKTEMEN-VLRQNDEIRKERNDTSAKFEF-LQNEKIQLSNEL 120
           +++S  ++ T +   ++       N VL Q + I K+ N  S +FEF + ++ + LS + 
Sbjct: 66  VSLSVGDMPTTTPGSLEAASLVAWNEVLSQTEMISKDHNQLSQEFEFQVADQIVALSKKC 125

Query: 121 ESVKRKLN----DLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNE 168
           E +   +N    +LTE++ +  SN  +  K  DE+  ++E A+ +  +T+++
Sbjct: 126 ELLLTSINGFNTELTEKRDKAYSNLDKAKKTYDEKCVQMESARAKQTKTSSD 177

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar to
            uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
            weakly similar to uniprot|P32380 Saccharomyces cerevisiae
            YDR356W SPC110 Inner plaque spindle pole body (SPB)
            component
          Length = 835

 Score = 35.4 bits (80), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 124/229 (54%), Gaps = 23/229 (10%)

Query: 806  QNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKD-NDSVMNLVNE 864
            QN++ +     N  + E +H +   ++++ED  +K E +Q +I+ L+ D N+  ++LVN 
Sbjct: 225  QNQLEKTTLQLNTYRDEVAHLEDKTIRIQEDQRAKEEQHQLEIQMLRSDVNNLNVSLVN- 283

Query: 865  KQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETINDDSLRKELEMSKINLTEAYSQIQ 924
            K++E+E+ + K++ L  ++ E   +  + +++D       L ++LEM + +++    +++
Sbjct: 284  KESELEEDRAKIQRLMNQLHEFDHK-GSQSLLD-------LERQLEMKRDSISSLEKEVR 335

Query: 925  E--YKKLYESTAQSLREM-NSKLD----------ESNEAFSNQIQSLTDEKINLEDKVSL 971
               + +++  T    RE+ N+K+           ++N + + +I  L   K +L+DKV  
Sbjct: 336  ALTHDRVHLETRIKDREIENAKIQSELERLRDNVKNNNSSNFEIGELKHAKASLDDKVRN 395

Query: 972  LKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020
            L E+  NLN  +   + E ++ K ++++  ++  N+ K  ++++ E ++
Sbjct: 396  LTEERHNLNQRISALRKECDEWKSKYQRNESLDSNHRKAFDSLRQELQT 444

>NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {ON}
           Anc_4.46 YLR309C
          Length = 960

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 79/156 (50%), Gaps = 26/156 (16%)

Query: 841 IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900
           I  +  ++E LK +N+ +++    KQ+E+EK      +L  EIE+ K +      MD + 
Sbjct: 478 IARWTAQVENLKNENEKIISENKTKQSELEK---NTAALTDEIEKLKTK-----YMDAS- 528

Query: 901 NDDSLRKELEMSKINLTEAYSQIQ-EYKKLYESTAQSLREMNS------KLDESNEAFSN 953
                 K L+ ++  + EA S+IQ E  +L    +  +R+ NS      + +++     N
Sbjct: 529 ------KRLKDNEARMNEALSKIQNENNRL----SNQMRDYNSVKTNVLQKEKTISYLEN 578

Query: 954 QIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNE 989
           QI+  T+EKI  E  + +LK ++  L N LDL K E
Sbjct: 579 QIKGYTEEKIKTEKSIDMLKRENGILTNRLDLLKKE 614

>CAGL0L04356g Chr12 (507792..510683) [2892 bp, 963 aa] {ON} highly
           similar to uniprot|Q99189 Saccharomyces cerevisiae
           YOR160w MTR10
          Length = 963

 Score = 35.0 bits (79), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 100/241 (41%), Gaps = 35/241 (14%)

Query: 619 SSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIE 678
           SSF +SV+Q LT     L   +  L   ++   R S Q ++  N  IQ+I    +   + 
Sbjct: 82  SSFKDSVLQMLTSHNNNL--VITQLNVALA---RLSIQYLNWKNP-IQEIITVLNPYPVA 135

Query: 679 LGKEKSSRILAEERFKLLSNTLDL--TKAENDQLRKRSDSLQSSISKQDSKTHETLNEYI 736
           L      R+L EE       TLD+  T    D+   R   L ++I++      + L   I
Sbjct: 136 L--LGFLRVLPEE-------TLDIDSTPLTEDEFNSRIHELINTIAQ------DVLQFLI 180

Query: 737 SCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKERED 796
           +C   +    +  SN+KL+  LK  S  S +  +D+L S    + ++   L    ++  D
Sbjct: 181 TCAENI---RSGNSNIKLDHVLKCISSWSFEFSVDQLVSVTPLMNLIFDALLNGNEDHPD 237

Query: 797 LLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDND 856
           + D A       + E  +A N         DQ ++ L E      +     +E++  DND
Sbjct: 238 IFDAAVDCLCVVLKESRDASN---------DQMVLALYEKLIELQQKLLPDLESVSADND 288

Query: 857 S 857
           S
Sbjct: 289 S 289

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 35.0 bits (79), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 98/214 (45%), Gaps = 58/214 (27%)

Query: 937  LREMNSKLDESNEAFSNQIQSLTDEKINLE-------DKVSLLK--EQSFNLNNE----- 982
            L E++  L  +   +    +++   KINL        D  +LLK  E + NLN+      
Sbjct: 238  LLEISKHLTNATAIYGAARENMIKHKINLNRLKTSYNDATTLLKNYESTSNLNDRKLKLQ 297

Query: 983  -----LDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQ----------D 1027
                 +D++ N++E KK+E       + N+ +EI T+ ++ +SK  KIQ          D
Sbjct: 298  GKSLWIDIKHNQLECKKLE-----KSVNNSKEEIATIDAKIKSKDHKIQRYLTDEQAIKD 352

Query: 1028 DLDQQT--------IY------ANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKT 1073
            DL+ +         +Y       N  ++NY +ELQ   D++K I    E+ H    ++K 
Sbjct: 353  DLESKYKDVQEKKEVYDSAIAEVNKVRDNYNKELQNEEDINKNI----EKSHV---KLKN 405

Query: 1074 LTLSRSELENILKE---NEKSWTSQKQSLLEQLD 1104
            L+ +   LEN LKE    +K    Q+ S  E+LD
Sbjct: 406  LSKNIENLENKLKEELGTDKDLLKQELSKCEELD 439

>KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {ON}
            weakly similar to uniprot|P33420 Saccharomyces cerevisiae
            YPL174C NIP100 Large subunit of the dynactin complex
            which is involved in partitioning the mitotic spindle
            between mother and daughter cells putative ortholog of
            mammalian p150(glued)
          Length = 819

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 1207 HDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSM 1266
            H VI++  ++L  L      L  +LENC+   + L+ E  +L  +I  ++ EL+ L+  +
Sbjct: 90   HGVILKLQDKLYGLHHRYADLELQLENCAIDKEALKEENEELMSVIIGLQQELATLRQDL 149

Query: 1267 QEKEQEIRLAKE-EVHRW----KKRSQDILEKHQQLSSNDYEKLE 1306
               +QE+ L +  E H W     K S + L K  QL      KL+
Sbjct: 150  SALQQEVDLRRSIEEHEWETDAGKLSHEALWKRNQLVEVALSKLQ 194

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
           similar to uniprot|Q08581 Saccharomyces cerevisiae
           YOR195W SLK19 Kinetochore-associated protein required
           for normal segregation of chromosomes in meiosis and
           mitosis component of the FEAR regulatory network which
           promotes Cdc14p release from the nucleolus during
           anaphase potential Cdc28p substrate
          Length = 718

 Score = 34.7 bits (78), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 106/212 (50%), Gaps = 30/212 (14%)

Query: 772 KLSSEKTSLRIMVTQLQTLQKEREDLLDE-------ARKSCQNKINEVEEAYNELKVETS 824
           K  SE   L++ V++ QTL  E+   ++E       +  + Q    E+E+  N+L +E  
Sbjct: 363 KTQSENEDLKLSVSKAQTLLAEKTKFIEELQANLRASHDTKQKSTIELEQRINDLTLE-- 420

Query: 825 HKDQHIMQLEEDNT--SKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKE 882
            K++ + +LE+ +T  SKIE  +N+I+++K + D     +   + E  +L+   +SLE E
Sbjct: 421 -KNELVRELEDMSTLRSKIEESENEIQSVKTELDRTQVALQHLKEEHSELREHCRSLEAE 479

Query: 883 IEENKIRLHTYNVMDETINDDSLRKELEMSKIN-----LTEAYSQIQEYKKLYESTAQSL 937
           ++ +  +L       ET ND    K  E+ ++      L +  S +++  KL ++   S+
Sbjct: 480 LKTSHQKL-------ETANDQLAIKSAEVVELGHDVKELRQGKSHLEDSLKLRDA---SI 529

Query: 938 REMNSKLDES---NEAFSNQIQSLTDEKINLE 966
            E NSK +E    N   S +I+S   +  NLE
Sbjct: 530 SEWNSKYEEKCAENNKLSIEIESFQFKNGNLE 561

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
           YLR309C (REAL)
          Length = 916

 Score = 34.3 bits (77), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 105/222 (47%), Gaps = 37/222 (16%)

Query: 43  ITRLNEKLIQFNE-----------LKSENLQITVSFDELKT------NSLKKIDGLKTEM 85
           +  L E++ QFNE           LK EN +I+   D LK       N +KK +G     
Sbjct: 524 VGYLEEQVKQFNEQKDAAEKSTEQLKKENSKISNRLDLLKKENETLHNDIKK-NG--NSY 580

Query: 86  ENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQRTL 145
           E  L++N ++ +  N    K+  LQN K   +  ++S+KR+  +L  + KE   + ++ L
Sbjct: 581 ETYLKENGKLSERLNILQEKYNTLQNVKSNSNEHMDSIKRQCEELNVKLKE---SNKKIL 637

Query: 146 KILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELN 205
            + DE     E A +  ++T  E   LR  V + +       + DL+ + ELE K   L 
Sbjct: 638 SLEDEL---NEYANIVQDKT-REANTLRRLVSDSQ-------SGDLSKQKELEDK---LA 683

Query: 206 LLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLK 247
            L   K  LE EL+ ++ +  S  Q    T +E++SE++ LK
Sbjct: 684 YLTDEKSRLESELNLQTSRKASEIQEWKHTAAELKSEIHALK 725

>KLTH0G12562g Chr7 (1066299..1068476) [2178 bp, 725 aa] {ON} similar
            to uniprot|Q12309 Saccharomyces cerevisiae YLR117C CLF1
            SYnthetic lethal with cdcForty Crooked neck Like Factor
            an ortholog of the Drosophila crooked neck gene crn
            pre-mRNA splicing factor
          Length = 725

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 977  FNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIET-VKSEYESKLSKIQDDLDQQTIY 1035
            F+L ++      ++E+++V+F+K+     N N  I +  K EYE  LS    D D   IY
Sbjct: 305  FDLASQRWPHNGDLERRRVQFEKMYGTSTNVNDSITSKRKREYEIALSNDPKDYDTWWIY 364

Query: 1036 ANTAQNNY 1043
             +  Q +Y
Sbjct: 365  LDLLQKHY 372

>KNAG0M01430 Chr13 (249807..251963) [2157 bp, 718 aa] {ON} Anc_5.161
           YJL012C
          Length = 718

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 79  DGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQ 138
           D LK ++E+ L Q+D+    R D + + EFL+  +++L       K K  ++    K++Q
Sbjct: 23  DDLKHDLEDKLEQHDD----RWDGTLETEFLEKLEVELDKVYTFCKVKHGEVVRRVKDVQ 78

Query: 139 SNQQRTLKILDERLKEVEM 157
              QRT+ +LD      E+
Sbjct: 79  EEVQRTVALLDSSTPPTEV 97

>ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON}
            similar to uniprot|P39723 Saccharomyces cerevisiae
            YAL047C SPC72 Component of the cytoplasmic Tub4p (gamma-
            tubulin) complex binds spindle pole bodies and links them
            to microtubules has roles in astral microtubule formation
            and stabilization
          Length = 713

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 18/82 (21%)

Query: 937  LREMNSKLDES-------NEAF-------SNQIQSLTDEKINLEDKVSLLKEQSFNLNNE 982
            LR  NSKLDE+        EA+       +N+I+++TDE + L+D+ S L +  FN+ N 
Sbjct: 502  LRRENSKLDEALEKIAQKTEAYQEQRHQLNNKIRTMTDELVGLKDENSALHKLVFNVEN- 560

Query: 983  LDLQKNEMEKKKVEFKKIIAIL 1004
              + K  + K+K EF K  A L
Sbjct: 561  --INKT-IHKQKSEFTKFQAHL 579

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] {ON}
            complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score = 33.5 bits (75), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 61/108 (56%), Gaps = 6/108 (5%)

Query: 931  ESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEM 990
            ES   +L EM SK++E  +A +N I+   + ++  E+ +S++K+    L + L++     
Sbjct: 795  ESLFDTLSEMKSKINELQKA-ANIIE---NNEVVTEEFISIMKKNGI-LKDTLNINMTST 849

Query: 991  EKKKVEFKKIIAILQNNNK-EIETVKSEYESKLSKIQDDLDQQTIYAN 1037
            E+  V F K+   ++N  K EI+T  + Y+S L +I D LDQQ +  N
Sbjct: 850  EESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPN 897

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 33.5 bits (75), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 16/136 (11%)

Query: 845 QNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHT-YNVMDETINDD 903
           Q+  +T   ++D ++N + EK  +   +Q  +  L+KE+ +  ++L T YN+ DE I + 
Sbjct: 328 QDTSDTYYLNSDGILNKLTEKPYD---MQIDI-VLQKEMFQFALKLATAYNLSDEYIKE- 382

Query: 904 SLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKI 963
            + K       N  +     +EY K ++    S  E+ +KL  SN+A SN +Q+LTD   
Sbjct: 383 -IHKRYGDYLFNKNKVADATEEYIKAFDVVETS--EIIAKLGMSNKADSNNLQNLTDYLC 439

Query: 964 NL-------EDKVSLL 972
           +L        D V+LL
Sbjct: 440 SLVKTSKANADHVTLL 455

>Skud_7.579 Chr7 complement(957174..958967) [1794 bp, 597 aa] {ON}
            YGR246C (REAL)
          Length = 597

 Score = 33.1 bits (74), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 1329 RFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVA 1364
            R N LRR   E +  S + +ETL ++LNE K+ K A
Sbjct: 233  RMNNLRRTHTEVVAVSHVAEETLQQRLNEFKNTKAA 268

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
            Ashbya gossypii AER241W
          Length = 854

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 7/113 (6%)

Query: 922  QIQEYKKLYESTAQSLREMNSKLDESNEAFSN---QIQSLTDEKINLEDKVSLLKEQSFN 978
            Q+QE+    +  + SL E+  K+DE N+   N   ++Q L  ++ NLE ++        +
Sbjct: 290  QLQEF----DHNSGSLLELEKKIDEKNQGIRNLESKLQELNHQRQNLERQLQTSDGVVNS 345

Query: 979  LNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQ 1031
            L NE +  KN+ E K   ++K  +  +N  +E   +  +  SKLSK++D L+Q
Sbjct: 346  LKNEYEKYKNDTENKLNSYQKSASADENKLREKMEILEKDNSKLSKMKDSLEQ 398

>CAGL0F08151g Chr6 complement(806209..808005) [1797 bp, 598 aa] {ON}
            highly similar to uniprot|P29056 Saccharomyces cerevisiae
            YGR246c BRF1 TFIIIB
          Length = 598

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 1329 RFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVA 1364
            R N LRR   E +  S + +ETL ++LNE K  K A
Sbjct: 235  RMNNLRRTHSEIVAVSHVAEETLQQRLNEFKGTKAA 270

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 33.1 bits (74), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 69/115 (60%), Gaps = 13/115 (11%)

Query: 1145 NDILVTLRRERDILDTKVTVAERDAKMLRQKI---TLMDVELQDART-------KLNNSR 1194
            +D L  L++E   L+ +  V +++ + LRQ+I     +++++Q+++        K+ NS+
Sbjct: 948  DDKLQALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSK 1007

Query: 1195 VENDERSSIVQQHDVIMEKL-NQLNLLRESNITLRNELENCSKKNKELQSELVKL 1248
             +ND+  S +++++ I++KL N+LN  +++++  +  LEN  KK   L  EL KL
Sbjct: 1008 QKNDK--SAIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKL 1060

>TBLA0A07910 Chr1 (1951391..1953940) [2550 bp, 849 aa] {ON} Anc_3.38
            YOL130W
          Length = 849

 Score = 33.1 bits (74), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 85/181 (46%), Gaps = 20/181 (11%)

Query: 944  LDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAI 1003
            +D+  ++F+  IQS+  E   +ED V + ++  F++     LQ+    ++K+    ++ +
Sbjct: 570  IDDITDSFAPVIQSIEYEADTVEDSVFMTRDTDFSMM----LQRIGESRRKI--MTLMRL 623

Query: 1004 LQNNNKEIETVKSEYESKLSKIQDDLDQQTIYAN----TAQNNYEQELQKHADVSKTISE 1059
            L      I+      + +++ I   L  Q   AN    +   +Y Q +Q   D++  + +
Sbjct: 624  LSGKADVIKMFAKRCKDEMNGIGPALTSQINIANLQASSVNYHYSQTIQPRGDIALYLGD 683

Query: 1060 LREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKL 1119
            +++ L        T+  + S  E I   +  ++ +Q Q  +E  + SN+R+ ++ S+  +
Sbjct: 684  IQDHL-------LTMFQNLSSYEKIFSRSHANYLAQLQ--VESFN-SNNRVTEILSKVTI 733

Query: 1120 L 1120
            L
Sbjct: 734  L 734

>YGR246C Chr7 complement(982482..984272) [1791 bp, 596 aa] {ON}
            BRF1TFIIIB B-related factor, one of three subunits of RNA
            polymerase III transcription initiation factor TFIIIB,
            binds TFIIIC and TBP and recruits RNA pol III to
            promoters, amino-terminal half is homologous to TFIIB
          Length = 596

 Score = 33.1 bits (74), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 1329 RFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVA 1364
            R N LRR   E +  S + +ETL ++LNE K+ K A
Sbjct: 233  RMNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAA 268

>Suva_7.541 Chr7 complement(937649..939451) [1803 bp, 600 aa] {ON}
            YGR246C (REAL)
          Length = 600

 Score = 32.7 bits (73), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 1329 RFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVA 1364
            R N LRR   E +  S + +ETL ++LNE K+ K A
Sbjct: 233  RMNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAA 268

>NCAS0A08030 Chr1 (1586013..1586612) [600 bp, 199 aa] {ON} Anc_5.619
          Length = 199

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 97  KERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTE 132
           KE  D +A+FE L+ E + L +++ES+KRKL + T+
Sbjct: 164 KELEDIAAQFEILKQENLVLRDQVESLKRKLAEQTQ 199

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.309 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 184,864,656
Number of extensions: 8892491
Number of successful extensions: 111510
Number of sequences better than 10.0: 5260
Number of HSP's gapped: 92862
Number of HSP's successfully gapped: 13393
Length of query: 1885
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1761
Effective length of database: 39,262,815
Effective search space: 69141817215
Effective search space used: 69141817215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)