Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_11.3315.698ON39939920280.0
YKR093W (PTR2)5.698ON60139919670.0
Smik_11.3565.698ON60239919480.0
Suva_11.3295.698ON60139919370.0
NDAI0E050205.698ON61938615220.0
Kpol_529.285.698ON61040015200.0
KNAG0C065705.698ON59035515050.0
CAGL0G02453g5.698ON59735515030.0
NCAS0A032205.698ON61138614960.0
TPHA0N01960singletonON59136114690.0
ZYRO0G06688g5.698ON61335714520.0
SAKL0E14828g5.698ON59236114420.0
TPHA0O02000singletonON62040114250.0
TBLA0A091205.698ON63339914100.0
TDEL0B022305.698ON57435614010.0
KLLA0E12915g5.698ON65435714030.0
KAFR0H002405.698ON59135413960.0
KAFR0H00230singletonON59639413660.0
TBLA0E01140singletonON61139613670.0
TBLA0B04710singletonON61535713490.0
KLTH0D16544gna 1ON6263584494e-49
Kwal_47.16930na 1ON6113704398e-48
AGL365Cna 2ON5993824264e-46
Ecym_2823na 2ON6133684021e-42
AFR228WsingletonON5763323957e-42
KNAG0K016203.227ON407192678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_11.331
         (399 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   785   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   762   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   754   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   750   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   590   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   590   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   584   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   583   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   580   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   570   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   563   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   560   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   553   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   547   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   544   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   545   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   542   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      530   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   531   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            524   0.0  
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   177   4e-49
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   173   8e-48
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   168   4e-46
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   159   1e-42
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   156   7e-42
KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON}              30   8.6  

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/399 (96%), Positives = 385/399 (96%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
           SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF
Sbjct: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXX 360
           IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDT    
Sbjct: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEM 360

Query: 361 XXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTAKY 399
                     FDLNPISAPKANDIEILEPMESLRSTAKY
Sbjct: 361 NAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTAKY 399

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/399 (92%), Positives = 377/399 (94%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSVLIADQLPKRKPSIKVLKSGERV++D NITLQNVFMFFYFMINVGSLSLMATT
Sbjct: 203 MIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT 262

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELEYHKGFWAAYLLPFCFFWIAVVTLI GKKQYIQRPIGDKVIAKSF+VCWIL KNKFDF
Sbjct: 263 ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF 322

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           NAAKPS+HPE++YPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH
Sbjct: 323 NAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 382

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           GIPNDFLQAFDSIALIIFIPIFEKF+YPFIRRYTP KPITKIFFGFMFGSFAMTWAAVLQ
Sbjct: 383 GIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ 442

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
           SF+YKAGPWY+EPLGHNTPN VHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF
Sbjct: 443 SFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 502

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXX 360
           IMSIFLLT AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW CFRKYNDT    
Sbjct: 503 IMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEM 562

Query: 361 XXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTAKY 399
                     FDLNPISAPKANDIEILEPMESLRST KY
Sbjct: 563 NAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTKY 601

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/399 (90%), Positives = 374/399 (93%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKAN+SVLIADQLPKRKP IKVLKSGERV++D NITLQNVFMFFYFMINVGSLSLMATT
Sbjct: 203 MIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT 262

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELEYHKGFWAAYLLPFCFFWIAVVTLI GKKQYIQRPIGDKV+AKSFRVCWIL KNKFDF
Sbjct: 263 ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDF 322

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           NAAKPS+HPE +YPWNDKFVDEIKRALAACKVF+FYPIYWTQYGTMISSFITQASMMELH
Sbjct: 323 NAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH 382

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           GIPNDFLQAFDSIALI+FIPIFEKF+YPFIRRYTP KPITKIFFGFMFGSFAMTWAAVLQ
Sbjct: 383 GIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ 442

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
           SF+YKAGPWY+EPLGHNTPN +HVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF
Sbjct: 443 SFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 502

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXX 360
           IMSIFLLT AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW CFRKYNDT    
Sbjct: 503 IMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEM 562

Query: 361 XXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTAKY 399
                     FDLN ISAPKANDIEILEP ESLRSTAKY
Sbjct: 563 NAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAKY 601

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/399 (90%), Positives = 372/399 (93%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSVLIADQLPKRKP IKVLKSGERV+ D NITLQNVFMFFYFMINVGSLSLMATT
Sbjct: 203 MIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATT 262

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELEYHKGFWAAYLLPFCFFW+AVVTL+ GKKQYIQRPIGDKVIAKSF+VCWIL KNKFDF
Sbjct: 263 ELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDF 322

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           NAAKPS+HPE+DYPWNDKFVDEIKRALAACKVF+FYPIYWTQYGTMISSFITQASMMELH
Sbjct: 323 NAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH 382

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           GIPNDFLQAFDSIALIIFIPIFEKF YPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ
Sbjct: 383 GIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 442

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
           SF+YKAGPWY EPLGHNTPN VHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA+MKSF
Sbjct: 443 SFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSF 502

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXX 360
           IMSIFLLT AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW CFRKYNDT    
Sbjct: 503 IMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEM 562

Query: 361 XXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTAKY 399
                     FDLNPIS PKANDIEILEPM SL+ST KY
Sbjct: 563 NAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKSTTKY 601

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/386 (71%), Positives = 315/386 (81%)

Query: 2   IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61
           IKANLSVLIADQLPKRKP +K+LKSGERV+ DPNITLQNVFM FY MIN+GS+S+MATTE
Sbjct: 216 IKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTE 275

Query: 62  LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFN 121
           LE HKGFWAAYLLPFCFFWIAVV L+ G+K Y++  +GD V+ KSF+VCWI+AKNK D+N
Sbjct: 276 LESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYN 335

Query: 122 AAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 181
           AAKPS HPER+YPWND+FVDE+KR +AACKVF+FYPIYW QYG+MIS+F+TQ S MELHG
Sbjct: 336 AAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHG 395

Query: 182 IPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQS 241
           IPNDFLQ FDSIALIIFIPIFE F+YPFIRR+TP +PITKI  GF  G  AMTWAAVLQ 
Sbjct: 396 IPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQH 455

Query: 242 FIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 301
           FIY  GP YD PL  +TPN++HV WQIPAYVLI+FSEIFASITGLEYAYSKAP SMKSF+
Sbjct: 456 FIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFV 515

Query: 302 MSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXXX 361
           MSIFLLT AFGS +G ALS VTVDPKF WLF GLAV+C ++G LFW CFR  N T     
Sbjct: 516 MSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMN 575

Query: 362 XXXXXXXXXFDLNPISAPKANDIEIL 387
                           +  A+D+EIL
Sbjct: 576 AMDYDAEIDEQSKRHLSSGADDLEIL 601

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/400 (69%), Positives = 329/400 (82%), Gaps = 6/400 (1%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKAN+SVLIA+Q+P+ KP +   K G+RV+ DPNIT QNVFMFFY MINVGSLSLMATT
Sbjct: 208 MIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATT 267

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE HKGFWAAYLLPFCFFWIAVV L++G+ QYI  P+GDK+I+KSF+V WIL KNK +F
Sbjct: 268 ELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNF 327

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           +AAKPS++PE++YPWNDKFV+EI+RAL ACKVF+FYPIYW  YG MI++F+TQA  MELH
Sbjct: 328 DAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELH 387

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
            +PNDFLQAFDSIA+I+FIPIFE+FIYPF+RR+TPF+PITKIF+GFMFGS AM WAAVLQ
Sbjct: 388 NLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQ 447

Query: 241 SFIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA 295
           SFIYKAGP Y+ P+       NTPN+VHV WQ+PAYVLI+ SEI AS+TGLEYAYS APA
Sbjct: 448 SFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPA 507

Query: 296 SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           SMKSFIMSIFL+T AFGSAIG A+SP   DPK+TW FTGLAVACFI+GCLFW CFR YN+
Sbjct: 508 SMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNN 567

Query: 356 TXXXXXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRS 395
           T                + P +  K + IE++EP+ S RS
Sbjct: 568 TEDAMNDIDFMDDDDDKIMPTAGEKTS-IEVMEPITSFRS 606

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/355 (75%), Positives = 314/355 (88%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIK+NLSVLIADQLPKRKP +K  K+GERV+ D N+TLQNVFMFFY MIN+GSLS++AT+
Sbjct: 196 MIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATS 255

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE H+GFWAAYLLPFCFFWIAVV L+LGK QY++ PIGDKVI+K F+V WIL KN+F+F
Sbjct: 256 ELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNF 315

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           +A KPS++P ++YPW+DKFVDEI+RAL ACKVF+FYPIYWT YG M+S F+TQ SMMELH
Sbjct: 316 DAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELH 375

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PNDF Q  DSIA+I+FIP+ E  +YPFIR+YTPF+PITKI+FGFMF S  M WAAVLQ
Sbjct: 376 GLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQ 435

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
           S+IYKAGP Y  PL H+ PNR+HV  Q+PAYVL++FSEIFASITGLEYAYSKAPASMKSF
Sbjct: 436 SYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSF 495

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           IMSIFL+T AFGSAIGCALSPV+ DP +TWL+TGLAVACFISGCLFW CFRKYND
Sbjct: 496 IMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYND 550

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/355 (75%), Positives = 310/355 (87%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIK+NLSVLIADQLP +KP + + K GERV+ DPN+TLQNVFMFFYF INVGSLS+MATT
Sbjct: 205 MIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATT 264

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELEYHKGFWAAYLLPFCFFW+AV  L+ G+ QYI+ P+GDKVI+KSF+V +IL+KNKF+ 
Sbjct: 265 ELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNA 324

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
            AAKPS +P++++PW+DKFVDEIKRAL ACKVF+FYP+YW  YGTM+++F+TQ   MELH
Sbjct: 325 EAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELH 384

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
            +PNDFLQAFDSIALIIFIPIFE+F+YPFIRRYTP +PITKIFFGFM GS AM WAAVLQ
Sbjct: 385 NLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQ 444

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
            FIY  GPWYD PL H+TPN +HV WQIPAYVLI+ SEIFASITGLEYAYSKAP SMKSF
Sbjct: 445 HFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSF 504

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           IMSIFLLT AFGSAIGCALSPV+VDPKF W +TGLA ACFI+G +FWF +   ND
Sbjct: 505 IMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLND 559

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/386 (70%), Positives = 314/386 (81%), Gaps = 2/386 (0%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSVLIADQLPKRKP +K LKSGERVV DPNITLQNVFM+FY M+NVGSLS++ATT
Sbjct: 208 MIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATT 267

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE HK FWAA+LLPFCFFWIAVV L+ G+ QY++    +K I KSF++ WI++KNKFD 
Sbjct: 268 ELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDL 327

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
            +AKPS HPE++YPW DKFVDE  RAL+ACKVF+FYPIYW  YGTMIS+F+TQ SMMELH
Sbjct: 328 TSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELH 387

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PND  QA DS ALIIFIPI E+FIYPFIRR+TPFKPITKIFFGFMF + AM W+ VLQ
Sbjct: 388 GLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQ 447

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
           SFIYKAGP+YD PL    PNR+HV WQ+PAYVLI+FSEI ASITGLEYAYSKAP SMKSF
Sbjct: 448 SFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSF 507

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXX 360
           IMS+FL + A GS +G ALSPV+VDPKFTWLF GL VACFI GC+FW  FRKYNDT    
Sbjct: 508 IMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYNDTEEEM 567

Query: 361 XXXXXXXXXXFDLNPISAPKANDIEI 386
                      DL  + +  AND+E+
Sbjct: 568 NAMDYEDEE--DLREMESAGANDLEL 591

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/361 (72%), Positives = 314/361 (86%), Gaps = 5/361 (1%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIK+N+SVLIA+Q+PKRK  +     GERV+ DP +T+QN+FMFFY MIN+GSLS++ATT
Sbjct: 197 MIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQNIFMFFYLMINIGSLSVIATT 256

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE HKGFWAAYLLPFCFFWIAVV LI+GKKQY+++P+GDKVI+K F + WI  KNK DF
Sbjct: 257 ELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGDKVISKCFTITWIAFKNKLDF 316

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           ++AKPS HPE +YPW DKFV+E++RA+ ACKVF+FYPIYW  YG M+++F+TQA  MELH
Sbjct: 317 DSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYWCVYGQMLNNFVTQAGTMELH 376

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PNDFLQA DSIA+I+FIPI EKF+YPFIR++TPF+ ITKIF+GFMFGS AM WAAVLQ
Sbjct: 377 GLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSITKIFWGFMFGSAAMIWAAVLQ 436

Query: 241 SFIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA 295
           SFIYKAGP +D+PL       +TPN+VH+ WQ+PAYVLI+FSEIFASITGLEYAYS AP 
Sbjct: 437 SFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIAFSEIFASITGLEYAYSNAPE 496

Query: 296 SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           SMKSFIMSIFLLTTAFGSA+G A+SP +VDPKFTW FTGLAV+CFI+GCLFW CFRKYN+
Sbjct: 497 SMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGLAVSCFIAGCLFWICFRKYNN 556

Query: 356 T 356
           T
Sbjct: 557 T 557

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/357 (74%), Positives = 301/357 (84%), Gaps = 1/357 (0%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSVLIADQ PKRKP IK  K GERV+ DPNIT+QNVFMFFY MIN+GSLS++ATT
Sbjct: 187 MIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATT 246

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE HKGFWAAYLLPFCFFWIAV+ L +G+K Y++ P+GDKVIAKSFRV   L K++FD+
Sbjct: 247 ELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDY 306

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
            A KPS+HPERDYPWND FV+EIKRAL ACKVF+FYPIYW  YG M S+F++    M+LH
Sbjct: 307 EAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLH 366

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PNDF QA DSIALI+FIPI E ++YPFIRRYTPFKPITKIFFGFM+ S +M WAAVLQ
Sbjct: 367 GLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQ 426

Query: 241 SFIYKAGPWYDEPLG-HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 299
            FIYK GP YD P+   N PN +H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP SMKS
Sbjct: 427 HFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKS 486

Query: 300 FIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDT 356
           FIMSIFLLT AFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCLFW  F   NDT
Sbjct: 487 FIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDT 543

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/361 (73%), Positives = 320/361 (88%), Gaps = 5/361 (1%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKAN+SVLIADQ+PK +P++KVLKSGERV+ DPNIT+QN+FMFFY MIN+GSLS++ATT
Sbjct: 194 MIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLSVIATT 253

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           E+E H GFWAAYLLPFCFF++AV  LILG+ QY++ P+GDKVI+KSF+VCWI+ +NKF F
Sbjct: 254 EMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRF 313

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           +AA+PS++PE  YPW+DKF+DEIKRA+AACKVF+FYPIYW  YG M+S+F++QA MMELH
Sbjct: 314 DAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELH 373

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PNDFLQA DSIALI+FIPI E+F+YPFIRR+TPF+PITKIF+GF+FG+ AM WAAVLQ
Sbjct: 374 GLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQ 433

Query: 241 SFIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA 295
            FIYKAGP Y  P+       NTPNR+H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP 
Sbjct: 434 HFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPV 493

Query: 296 SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           SM+SFIMSIFLLTTAFGSA+G ALS V+V+PKF W F+GLAV+CFI+GCLFW  F KYND
Sbjct: 494 SMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYND 553

Query: 356 T 356
           T
Sbjct: 554 T 554

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/401 (64%), Positives = 318/401 (79%), Gaps = 6/401 (1%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSVL+A+Q+PKRK  +   K GERV+ DP+IT+QNVFMFFY MIN+G+LS++ATT
Sbjct: 216 MIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINIGALSVLATT 275

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE HKGFWAAYLLPFCFFWIAVV L++G+  YI +P+GDKVI+K F+V +I+ KNKF+F
Sbjct: 276 ELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTFIVCKNKFNF 335

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           ++AKPS++PE  YPW+DKFVDEI R++ ACKVFIFYPIYW  YG MI++FITQA  MELH
Sbjct: 336 DSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFITQAGTMELH 395

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
            IPNDFLQ FDSI +I+FIPIFE+F+YP IRR+TP KPITKIF GFM GS AM WAAVLQ
Sbjct: 396 NIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSCAMVWAAVLQ 455

Query: 241 SFIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPA 295
           SFIYKAGP YD P+       N PNRVHV WQIPAYV+I++SEIFAS+TGLE+AYS AP 
Sbjct: 456 SFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGLEFAYSNAPD 515

Query: 296 SMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           SMK+FIMSIFL T A G+A+G A+SP +VDPK+TW+FTGLAV+CF++GCLFW CF  YND
Sbjct: 516 SMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLFWICFHHYND 575

Query: 356 TXXXXXXXXXXXXXXFDLN-PISAPKANDIEILEPMESLRS 395
                           + +  +    ++    +EP+ S+RS
Sbjct: 576 IDADMKAIDFVEDDMINASGDVEKTASSGFSTVEPIISMRS 616

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 318/399 (79%), Gaps = 5/399 (1%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSV+IA+Q+PKRK  +   K+G RV+ DP+IT+QNVFM FYFMIN+GSLS++ATT
Sbjct: 223 MIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATT 282

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE HKGFWAAYLLPFCFFW+AV+ LI+G K YI+ P+GDKVI+K F+V  IL +N+F+ 
Sbjct: 283 ELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNP 342

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
           ++AKP+ +P+++YPW+DKFVDEI RAL ACKVF+FYPIYW  YG M+++F++Q   MELH
Sbjct: 343 DSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELH 402

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PNDF QA DSIALI+FIPI E+F+YPFIR+YTPFKPITKIF+GF FG+ +MTWA VLQ
Sbjct: 403 GLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQ 462

Query: 241 SFIYKAGPWYDEPLG-HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 299
            FIYKA P YD P    N PN +HV  Q+PAY L++ SEIFASITGLEYAYSKAPASMK+
Sbjct: 463 HFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKA 522

Query: 300 FIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXX 359
           FIMSIFL+T AFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GCLFW  F+KYND    
Sbjct: 523 FIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEE 582

Query: 360 XXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRSTAK 398
                         + +    A DIE+++P+ S RS+ K
Sbjct: 583 LNNLDFEEGD----DMLETKHAGDIEMIQPISSRRSSLK 617

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/356 (69%), Positives = 298/356 (83%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIK+N+SVLIADQ PK++  +   K G RV+ DPNITLQNVFM FY MIN+GSLS++ATT
Sbjct: 187 MIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLMINIGSLSVIATT 246

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE H GFWAAYLLPFCFFWIAV+ L +GK  Y++ P+GDKVI+K F+V  I  KNKF+F
Sbjct: 247 ELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFKVVGIAIKNKFNF 306

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
            AAKPS+ P+R +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M+++F++    MELH
Sbjct: 307 EAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLNTFVSVGGTMELH 366

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PNDF QA DSIALI+FIPI E F+YP+IR++TPF+PITKIF+GFMFG+ AM WAAVLQ
Sbjct: 367 GLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMFGAAAMVWAAVLQ 426

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
            FIYK+GPWY  P+  NTPN +H+ WQ+PAYVLI+FSEIFASITGLEYAYSKAP +MKSF
Sbjct: 427 HFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVTMKSF 486

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDT 356
           IM+IFLLT AFGSAIGCALSPVT DP + WL+ GL VACF +G LFWFCF+ YNDT
Sbjct: 487 IMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFWFCFKHYNDT 542

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/357 (69%), Positives = 298/357 (83%), Gaps = 5/357 (1%)

Query: 3   KANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTEL 62
           KANLSVLIADQ+PK +P IKVLK+GE+V+ DPN+T+QNVFMFFY MIN+GSLS+MATT L
Sbjct: 239 KANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHL 298

Query: 63  EYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFNA 122
           E   GFWAAYLL FCFFW+ +V L+ G+K+Y++RPIGD VIA+ F++CWI   N F+ N 
Sbjct: 299 EASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNR 358

Query: 123 AKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 182
           A PS++PE++YPWND F+DEI+RA  ACKVF FYPIYW  YG M+++F+TQA  MELHG+
Sbjct: 359 AVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGL 418

Query: 183 PNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 242
           PNDFLQA +SIALI+FIPI E+FIYPFIRR+TPF+P+TKIF GF FGS AM +AAVLQ F
Sbjct: 419 PNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHF 478

Query: 243 IYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASM 297
           IYKAGP YD P+       NTPNRVH+ WQ+PAYVLIS SEIFASITGLEYAYSKAPA+M
Sbjct: 479 IYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPATM 538

Query: 298 KSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYN 354
           K+FIMSIFL+T A GSA+G ALSP   +PK+ W F+GLAVACFI+GCLFW CF  YN
Sbjct: 539 KAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYN 595

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/354 (69%), Positives = 300/354 (84%), Gaps = 1/354 (0%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           +IK+NLSVLIADQ+P ++P +K LKSGERV+ D ++T+QNVFMFFY MIN+GSLS++ATT
Sbjct: 205 LIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATT 264

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE + GFWAAYLLPFCFFWIAV+ ++ GK+QYI +P GD+VIAKSF+VCWIL KNKFD 
Sbjct: 265 ELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDI 324

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
            +AKPS HPE ++PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+LH
Sbjct: 325 TSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLH 384

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
           G+PND  QA +SI+LIIFIPI EKF+YPFIRR+TP +P+T+IF GF+F + AM W+ VLQ
Sbjct: 385 GLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQ 444

Query: 241 SFIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 300
            FIY  GP Y+ PL     N +HV WQ+PAYV I+FSEIFASITGLEYAYSKAPA+MKSF
Sbjct: 445 HFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSF 503

Query: 301 IMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYN 354
           IM++FL   AFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FW CFRKYN
Sbjct: 504 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYN 557

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/394 (63%), Positives = 304/394 (77%), Gaps = 7/394 (1%)

Query: 2   IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61
           IKANLSVLIADQ+P ++P +K LKSGERV+ D +IT+QNVFMFFY MIN+GSLS++ATTE
Sbjct: 206 IKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTE 265

Query: 62  LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFN 121
           LE H GFWAAYLLPFCFFWIAV+ L+LG++ Y  +P  D+VI KSF+ CW L KNKF+++
Sbjct: 266 LEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWS 325

Query: 122 AAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 181
           A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYPIYWT YG M ++F+T  SM++LHG
Sbjct: 326 AVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHG 385

Query: 182 IPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQS 241
           +PND  QA DSIALI+FIPI EKF YPFIRR+TPF+PITKI +GF   S +M WA VLQ 
Sbjct: 386 LPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQY 445

Query: 242 FIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 301
           FIYK GP Y  PL  + PN VHV WQ+PAYVLI+FSEIFASITGLEYAYSKAPASMKSFI
Sbjct: 446 FIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFI 504

Query: 302 MSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXXXX 361
           M++FL   AFGSAIGCALSPV+ DP +TWL+ GLAV  FI+GC FWFCFR YND      
Sbjct: 505 MALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYND------ 558

Query: 362 XXXXXXXXXFDLNPISAPKANDIEILEPMESLRS 395
                    ++   I      DIE++ P+ +  S
Sbjct: 559 IEDEMNALNYEDEDIITENNQDIEMVHPLSAYTS 592

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 306/396 (77%), Gaps = 7/396 (1%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60
           MIKANLSV+IA+Q+PKRK  I   K G RV+ DP+ITLQNVFM FYFMINVGSLS+MATT
Sbjct: 211 MIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYFMINVGSLSVMATT 270

Query: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120
           ELE  KGFWAAYLLPFCFFW+AVV L++G K++I+ PIGDK I+KSF+V  IL KNKF++
Sbjct: 271 ELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSFKVVGILIKNKFNY 330

Query: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180
            +AKPSIHPE +YPW DKFV+EI+RA+ AC VF FYPIYW  YG M+++F+TQ   MELH
Sbjct: 331 ESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQMLNNFVTQGGQMELH 390

Query: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240
            +PNDFLQ  DSIALI+FIPI E+ IYPF+RR+TP +PITKI  GF FGSF+M WAAVLQ
Sbjct: 391 DLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFFFGSFSMVWAAVLQ 450

Query: 241 SFIYKAGPWYDEPLG-HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 299
            F+Y+  P Y  P    N PN +HVCWQ+PAY LI+ SEIFASITGLEYAYSKAPASMKS
Sbjct: 451 WFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGLEYAYSKAPASMKS 510

Query: 300 FIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTXXX 359
           FIMSIFL TTA GSA+G ALSPV++DPKFTW + GLAV+CFI+G  FW CF +YND    
Sbjct: 511 FIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAFWLCFSRYNDEEDE 570

Query: 360 XXXXXXXXXXXFDLNPISAPKANDIEILEPMESLRS 395
                       D+  IS+   ND   LE   S+RS
Sbjct: 571 LNNIDDQP----DVIQISSENEND--DLEAKNSIRS 600

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 296/357 (82%), Gaps = 2/357 (0%)

Query: 1   MIKANLSVLIADQLPKRKPSIKVLK-SGERVVLDPNITLQNVFMFFYFMINVGSLSLMAT 59
           MIKANLSV+IADQLPK+K  +   K SG+RV+ DP +T+QNVFM FYFMINVGSLS++AT
Sbjct: 207 MIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAFYFMINVGSLSVIAT 266

Query: 60  TELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFD 119
           TELE H GFWAAYLLPFCFFWIAV+ L  G ++++++PIGD+VI+K F +  IL KN F+
Sbjct: 267 TELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISKCFTIIGILIKNNFN 326

Query: 120 FNAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMEL 179
           F  AKP+ +PE++YPW+DKFVDEI+R+L ACKVF+FYPIYW  YG M+++F+TQ S M+L
Sbjct: 327 FQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQMLNNFVTQGSTMQL 386

Query: 180 HGIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVL 239
           HG+PNDF QA +SIALI+FIPI EKF+YPFIR++TP KPITK+  GF+FGS AM WAAVL
Sbjct: 387 HGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIGFVFGSLAMVWAAVL 446

Query: 240 QSFIYKAGPWYDEPLG-HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMK 298
           Q FIY+AGP YD P+   N PN VHV WQ+PAY LIS SEIFASITGLE AYSKAP SMK
Sbjct: 447 QHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASITGLEIAYSKAPESMK 506

Query: 299 SFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYND 355
           SFIMS+FL+T AFG+AIGCALS V+ DPK+ WL+TGLAV CF +G  FWF F+ YND
Sbjct: 507 SFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGIAFWFTFKHYND 563

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  177 bits (449), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 180/358 (50%), Gaps = 22/358 (6%)

Query: 12  DQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAA 71
            Q P     ++ L SGERV++D + +LQ + M FY+ IN+GS   +AT+      G+W A
Sbjct: 205 SQYPHETDVVRTLASGERVLVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLA 264

Query: 72  YLLPFCFFWIA-VVTLILGKKQYIQRPIGDKVIA---KSFRVC----WILAKNKFDF-NA 122
           +L+P   + I   V L+LG+    + P G  ++A   K  RVC    W       DF N 
Sbjct: 265 FLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNY 324

Query: 123 AKPS-IHPERDYPWNDK---------FVDEIKRALAACKVFIFYPIYWTQYGTMISSFIT 172
           A+PS +       W  K          V + +  L+A  +F++Y IY    G + S   +
Sbjct: 325 ARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNS 384

Query: 173 QASMMELHGIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYT-PFKPITKIFFGFMFGSF 231
           Q + +  +G+PND +  F+ + +I+F+P+ +  +YP +R+    FKP+ +IF GFM  + 
Sbjct: 385 QTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAAL 444

Query: 232 AMTWAAVLQSFIYKAGPWYDEPLGHNTPNRVHVCWQIPA-YVLISFSEIFASITGLEYAY 290
           A    A++Q+ IY   P        +        W +   Y L   SE  A  TG E A+
Sbjct: 445 ASAVGAIIQTVIYNTSPCGRYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAF 504

Query: 291 SKAPASMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLA-VACFISGCLFW 347
            ++PA MKSF+M++FL T+A  +A+G  ++P  VDP     F  LA +  F++    W
Sbjct: 505 ERSPAHMKSFVMALFLFTSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVFLW 562

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  173 bits (439), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 181/370 (48%), Gaps = 36/370 (9%)

Query: 12  DQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAA 71
            Q P     +K L SGERV++D + +LQ + M FY+ INVGS   +AT+      G+W A
Sbjct: 197 SQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSARDVGYWLA 256

Query: 72  YLLPFCFFWIA-VVTLILGKKQYIQRPIGDKVIA---KSFRVC--------------WIL 113
           +L+P   F I   V L+L +    + P G  +IA   K  +VC              W  
Sbjct: 257 FLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTFWDY 316

Query: 114 AK-------NKFDFNAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTM 166
           AK        +  +  +KP  +PE         V + +  ++AC +F++Y IY    G +
Sbjct: 317 AKPSNLRSLGRQGWRKSKPGFYPE-------SLVQDARVTISACTIFLYYVIYNINDGGI 369

Query: 167 ISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYT-PFKPITKIFFG 225
            S   +Q + +   G+PND +  F+ + +I+F+PI ++ +YP +R+    F+P+ +IF G
Sbjct: 370 GSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRPVFRIFAG 429

Query: 226 FMFGSFAMTWAAVLQSFIYKAGPWYDEPLGHNTPNRVHVCWQIP-AYVLISFSEIFASIT 284
           FM  + A    A++Q  IY+  P  +              W +   Y L  FSE  A  T
Sbjct: 430 FMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVVAIEYALTGFSECLAMTT 489

Query: 285 GLEYAYSKAPASMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGC 344
           G E A+ ++P  MK+F+M++FL  +A  +A+G  ++P  VDP     F  L  A   +  
Sbjct: 490 GYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGVL--AGLGAAV 547

Query: 345 LFWFCFRKYN 354
            F F +R +N
Sbjct: 548 AFAFLWRYWN 557

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  168 bits (426), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 117/382 (30%), Positives = 179/382 (46%), Gaps = 38/382 (9%)

Query: 2   IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61
           +K  L  ++  Q P     +K L +GERV+L+ + +LQ + M FY+ INVGS   +AT  
Sbjct: 191 VKPVLLPMLLRQYPHETNVVKTLPTGERVILNRDASLQRMSMTFYWCINVGSFVSLATGY 250

Query: 62  LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIA---KSFRVC-------- 110
                G+W ++L+P   F I    L+  K   +  P+G+ + A   K  +VC        
Sbjct: 251 SAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKVTPPLGESLFAECLKVIKVCFEPGWFKR 310

Query: 111 ------WILAKNKFDFNAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYG 164
                 W  AK        +      ++  + +  V++ +  LAAC +F++Y IY     
Sbjct: 311 YRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKESLVEDTRITLAACVIFLYYVIYNMNDN 370

Query: 165 TMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYT-PFKPITKIF 223
            + S    QA  M   G+PND +  F+ +A+II +PI +  + P +RR    FKP+ +IF
Sbjct: 371 QLSSIINNQAGSMTGEGVPNDVISNFNPLAIIITMPIIDYGLNPLLRRLRINFKPVYRIF 430

Query: 224 FGFMFGSFAMTWAAVLQSFIYKAGPWYDEPLGHNTPNRVHVCWQIP---------AYVLI 274
           FGFM    A    A++Q+ IY        P G +         Q+           YVL 
Sbjct: 431 FGFMLAVLASVAGAIIQAAIYNT-----SPCGKHASTCSETIRQVSPLSRWLVGVEYVLS 485

Query: 275 SFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTG 334
             SE FA  TG E A+ ++P  MK+F+MS+FL+TTA  S +    + +  DP     F  
Sbjct: 486 GVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALSSILTQIFNGIMTDPYLVIPFIL 545

Query: 335 LAVACFISGCLF--WFCFRKYN 354
            AV     G LF   F +R +N
Sbjct: 546 FAVL----GTLFAILFLYRYWN 563

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  159 bits (402), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 182/368 (49%), Gaps = 28/368 (7%)

Query: 12  DQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAA 71
            Q P     +K L++GERV++D + +LQ + M FY+ IN+G+   +AT+      GFW A
Sbjct: 209 QQYPHETNVVKTLETGERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLA 268

Query: 72  YLLPFCFFWIAVVTLILGKKQYIQR-PIGDKVIAKSFRVCWIL------AKNKFD--FNA 122
           +L+P   +    V   L +     R P G  ++A   +V ++       A+ K    ++ 
Sbjct: 269 FLIPLIIYMAMPVVFSLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDY 328

Query: 123 AKPSIHPE-------RDYP-WNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQA 174
           A PS   +       +  P + +  V + K  L+AC +F +Y IY      + +   +Q 
Sbjct: 329 ALPSNQRQMGKVGWRKKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQT 388

Query: 175 SMMELHGIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYT-PFKPITKIFFGFMFGSFAM 233
             M  +G+PND +  F+ +++I+ IPI +  +YP +RR    FKP+ +IF GFM    + 
Sbjct: 389 GSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASS 448

Query: 234 TWAAVLQSFIYK-------AGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGL 286
              A++Q  IY+       A    ++ LG +  +   V  +   Y L   SE  A  T  
Sbjct: 449 VAGALIQWRIYETSSCGYHATTCSEKGLGVSPLSSWIVAVE---YTLSGASECLAMTTAY 505

Query: 287 EYAYSKAPASMKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 346
           E AY ++P  MKSF++++FL T+A  +AI   ++P+  DP     F   A   FISGC F
Sbjct: 506 EIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHF 565

Query: 347 WFCFRKYN 354
            + FR  +
Sbjct: 566 LWKFRNLD 573

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  156 bits (395), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 163/332 (49%), Gaps = 29/332 (8%)

Query: 21  IKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFW 80
           +K L SGERV++D + +LQ + M FY+ INVG+   +AT       G+W A+ +P   + 
Sbjct: 204 VKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYL 263

Query: 81  IAVVTL-ILGKKQYIQRPIGDKVIAKSFRVC-----------------WILAKNKFDFNA 122
           +  + L  L +      P  + V+A+S +V                  W  AK       
Sbjct: 264 LMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQ 323

Query: 123 AKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 182
            +     ++   +++K+V + K  ++AC +F++Y IY   +  +     +QA  ME  G+
Sbjct: 324 GRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIY-QMHSNLDEPMRSQAGSMEGEGV 382

Query: 183 PNDFLQAFDSIALIIFIPIFEKFIYPFIRRYT-PFKPITKIFFGFMFGSFAMTWAAVLQS 241
           PND    F+ I++I+ +PI +  +YP +RRY   FKP+ +IF GFM G    T  A++Q 
Sbjct: 383 PNDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQW 442

Query: 242 FIYKAGPWYDEPLGHNTPNRVH------VCWQIP-AYVLISFSEIFASITGLEYAYSKAP 294
            +Y   P     +G  T   +H        W +   Y L   SE  A  TG E A+ ++P
Sbjct: 443 RVYNTSPC--GYMGATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSP 500

Query: 295 ASMKSFIMSIFLLTTAFGSAIGCALSPVTVDP 326
             MK F++++F+ T A  SAI   ++P   DP
Sbjct: 501 KKMKGFVLALFMFTVAISSAIILPITPFFKDP 532

>KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON} 
          Length = 407

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 74/192 (38%), Gaps = 34/192 (17%)

Query: 114 AKNKFDFNAAKPSIHPERDYPWNDKFVDEIKRAL----AACKVFIFYPIYWTQYGTMISS 169
            K   D  A K SI+P      +    D +K +L     +  V +F  ++   +G   +S
Sbjct: 227 TKATCDMLAGKLSINPSTGEVTDLFLFDRLKASLICGLGSLSVGVFAVMWHRWFGKPSAS 286

Query: 170 FITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKP-----ITKIFF 224
            I Q+S + L GI          I L+ F+P   K  Y  I  Y   K      +  +FF
Sbjct: 287 LIQQSSHLSLIGI-------MSIILLLPFVPDL-KLSYQVISFYYADKTFWLTLMGSLFF 338

Query: 225 GFMFGSFAM-----------TWAAVLQSFIYKA-GPWYDEPLGHNTPNRVHVCWQIPAYV 272
           G +   F++                L S I+     W  EP+         V W++  Y+
Sbjct: 339 GTVPCLFSLLHLNKKNPPEFVTTVNLGSIIFMGLAEWLTEPI-----QTTIVRWEVIGYI 393

Query: 273 LISFSEIFASIT 284
           ++  S IF S+T
Sbjct: 394 VLVLSCIFLSMT 405

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,706,515
Number of extensions: 1632409
Number of successful extensions: 4245
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4299
Number of HSP's successfully gapped: 31
Length of query: 399
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 287
Effective length of database: 40,638,807
Effective search space: 11663337609
Effective search space used: 11663337609
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 67 (30.4 bits)