Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_11.330singletonON1021025355e-72
AAL016C1.406ON147845613.8
KLLA0E09527g5.229ON69650596.8
Ecym_82265.272ON82164597.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_11.330
         (102 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_11.330 Chr11 complement(596821..597129) [309 bp, 102 aa] {O...   210   5e-72
AAL016C Chr1 complement(311460..315896) [4437 bp, 1478 aa] {ON} ...    28   3.8  
KLLA0E09527g Chr5 (843133..845223) [2091 bp, 696 aa] {ON} simila...    27   6.8  
Ecym_8226 Chr8 (461337..463802) [2466 bp, 821 aa] {ON} similar t...    27   7.4  

>Skud_11.330 Chr11 complement(596821..597129) [309 bp, 102 aa] {ON} 
           (NOVEL)
          Length = 102

 Score =  210 bits (535), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 1   MGTNGKNMEEKYITYIFFTKLKMKGNNELWWSVRASKANKKVVLIRVNSYHMKKKSVLIR 60
           MGTNGKNMEEKYITYIFFTKLKMKGNNELWWSVRASKANKKVVLIRVNSYHMKKKSVLIR
Sbjct: 1   MGTNGKNMEEKYITYIFFTKLKMKGNNELWWSVRASKANKKVVLIRVNSYHMKKKSVLIR 60

Query: 61  ELSIPKKSPQAPVLNHYFIEESPGGSLGEETHRNNKGNCPFP 102
           ELSIPKKSPQAPVLNHYFIEESPGGSLGEETHRNNKGNCPFP
Sbjct: 61  ELSIPKKSPQAPVLNHYFIEESPGGSLGEETHRNNKGNCPFP 102

>AAL016C Chr1 complement(311460..315896) [4437 bp, 1478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL014W
           (BUD3)
          Length = 1478

 Score = 28.1 bits (61), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 58  LIRELSIPKKSPQAPVLNHYFIEESPGGSLGEETHRNNKGNCPFP 102
           LI E+ +P K P+  VL+H +I++    + G+ + R +  N   P
Sbjct: 522 LINEVPLPPKIPKLEVLSHSYIDDVVVSTYGKNSLRFDTLNAERP 566

>KLLA0E09527g Chr5 (843133..845223) [2091 bp, 696 aa] {ON} similar
           to uniprot|P27351 Saccharomyces cerevisiae YJR005W APL1
           beta-adaptin large subunit of the clathrin- associated
           protein complex
          Length = 696

 Score = 27.3 bits (59), Expect = 6.8,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 49  SYHMKKKSVLIRELSIPKKSPQAPVLNHYFIEESPGGSLGEETHRNNKGN 98
           S ++K  S + R +S PKK P++P LNH   E+S    + +    N+ G+
Sbjct: 588 SVYLKPVSQVFRGVS-PKKLPESPALNH---EKSSLSIINDSISNNSTGS 633

>Ecym_8226 Chr8 (461337..463802) [2466 bp, 821 aa] {ON} similar to
           Ashbya gossypii ACR073C
          Length = 821

 Score = 27.3 bits (59), Expect = 7.4,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 29  LWWSVRAS-----KANKKVVLIRVNSYHMKKKSVL---IRELSIPKKSPQAPVLNHYFIE 80
           LWWS  ++     K N + V     SY++  +  +   IR+L  PK   Q P+++    E
Sbjct: 257 LWWSPSSTYLAYFKTNDEQVHEFPVSYYLSSEDAIYPEIRKLKYPKSGTQGPIVSLNIYE 316

Query: 81  ESPG 84
             P 
Sbjct: 317 VGPA 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,034,574
Number of extensions: 514016
Number of successful extensions: 833
Number of sequences better than 10.0: 7
Number of HSP's gapped: 833
Number of HSP's successfully gapped: 7
Length of query: 102
Length of database: 53,481,399
Length adjustment: 73
Effective length of query: 29
Effective length of database: 45,110,781
Effective search space: 1308212649
Effective search space used: 1308212649
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)