Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_11.197singletonON85853823e-49
YKL031WsingletonOFF137901199e-09
Smik_11.223singletonON9477985e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_11.197
         (85 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_11.197 Chr11 (361091..361345) [255 bp, 85 aa] {ON} YKL031W ...   151   3e-49
YKL031W Chr11 (382072..382485) [414 bp, 137 aa] {OFF} Dubious op...    50   9e-09
Smik_11.223 Chr11 (369174..369200,369204..369377,369381..369386,...    42   5e-06

>Skud_11.197 Chr11 (361091..361345) [255 bp, 85 aa] {ON} YKL031W
          (REAL)
          Length = 85

 Score =  151 bits (382), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 77/85 (90%), Positives = 77/85 (90%)

Query: 1  ERERQKESENECAGAASIPVSTARYGHIFFVPVCSLHRTXXXXXXXXARCAPLVQQHPHT 60
          ERERQKESENECAGAASIPVSTARYGHIFFVPVCSLHRT        ARCAPLVQQHPHT
Sbjct: 1  ERERQKESENECAGAASIPVSTARYGHIFFVPVCSLHRTKKKKKKKKARCAPLVQQHPHT 60

Query: 61 TPATKPRAAVVSRGAPTHPEVVCRA 85
          TPATKPRAAVVSRGAPTHPEVVCRA
Sbjct: 61 TPATKPRAAVVSRGAPTHPEVVCRA 85

>YKL031W Chr11 (382072..382485) [414 bp, 137 aa] {OFF} Dubious open
           reading frame, unlikely to encode a protein; not
           conserved in closely related Saccharomyces species
          Length = 137

 Score = 50.4 bits (119), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 1   ERERQKESENECAGAASIPVSTARYGHIFFVPVC----SLHRTXXXXXXXXARCA-PLVQ 55
           E ERQKE ENECAG        A     F  P         +          RCA PL+ 
Sbjct: 18  ENERQKERENECAGPCLYLAPPADVCIFFLFPFVLSPRGGGKEKKKKKVRKVRCASPLLL 77

Query: 56  QHPHTTPATKPRAAVVSRGAPTHPEVVCRA 85
            HP  TP TKPRAAVVS  + TH   VCR+
Sbjct: 78  LHPDITPNTKPRAAVVSNRS-THSSTVCRS 106

>Smik_11.223 Chr11
          (369174..369200,369204..369377,369381..369386,
          369390..369464) [282 bp, 94 aa] {ON} YKL031W (REAL)
          Length = 94

 Score = 42.4 bits (98), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 1  ERERQKESENE-CAGAASIPVSTARYGHIFFVPVCSLHRTXXXXXXXXAR---CA-PLVQ 55
          E ERQKESE   C G         +    FFVP+CSL R          R   CA PL  
Sbjct: 11 ENERQKESEKRMCRGRVYTQYQFPQLVCAFFVPICSLTRGGGKKKEKKVRRAGCASPLPH 70

Query: 56 QHPHTTPATKPRAAVVS 72
          QH   TP  KPRAAVVS
Sbjct: 71 QHTTLTP--KPRAAVVS 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.129    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,710,678
Number of extensions: 192253
Number of successful extensions: 364
Number of sequences better than 10.0: 4
Number of HSP's gapped: 362
Number of HSP's successfully gapped: 4
Length of query: 85
Length of database: 53,481,399
Length adjustment: 57
Effective length of query: 28
Effective length of database: 46,945,437
Effective search space: 1314472236
Effective search space used: 1314472236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)