Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_10.631.195ON53353328540.0
Suva_6.2311.195ON54354225950.0
Smik_10.811.195ON53353325920.0
YJL153C (INO1)1.195ON53353325770.0
KLLA0D16412g1.195ON52952921070.0
CAGL0I06050g1.195ON53853020950.0
SAKL0F00396g1.195ON52752520630.0
TDEL0C035801.195ON53052420500.0
ZYRO0G18150g1.195ON53052619770.0
KAFR0F018601.195ON54253119390.0
TPHA0A028801.195ON54053519230.0
TBLA0C020701.195ON53653819170.0
Kpol_2001.171.195ON47147118740.0
NCAS0I027501.195ON58352818810.0
KNAG0C025201.195ON59252118490.0
NDAI0B001201.195ON56753717850.0
Smik_4.2013.154ON46476780.66
Kpol_299.28.520ON183270751.5
YDL036C (PUS9)3.154ON46276723.1
TPHA0C038902.484ON48864696.8
SAKL0H22550g4.128ON1196101697.7
KLLA0C17028g8.145ON460112698.4
ZYRO0E03586gna 1ON35073689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_10.63
         (533 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {O...  1103   0.0  
Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C ...  1004   0.0  
Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {O...  1003   0.0  
YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON} ...   997   0.0  
KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]...   816   0.0  
CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly...   811   0.0  
SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly s...   799   0.0  
TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.1...   794   0.0  
ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} high...   766   0.0  
KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {O...   751   0.0  
TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {O...   745   0.0  
TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.1...   743   0.0  
Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON} (48908....   726   0.0  
NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.1...   729   0.0  
KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {O...   716   0.0  
NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195 Y...   692   0.0  
Smik_4.201 Chr4 complement(367783..369177) [1395 bp, 464 aa] {ON...    35   0.66 
Kpol_299.2 s299 (1970..7468) [5499 bp, 1832 aa] {ON} (1970..7468...    33   1.5  
YDL036C Chr4 complement(387513..388901) [1389 bp, 462 aa] {ON}  ...    32   3.1  
TPHA0C03890 Chr3 (837758..839224) [1467 bp, 488 aa] {ON} Anc_2.4...    31   6.8  
SAKL0H22550g Chr8 complement(1958491..1961990,1962073..1962163) ...    31   7.7  
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    31   8.4  
ZYRO0E03586g Chr5 (278440..279492) [1053 bp, 350 aa] {ON} conser...    31   9.7  

>Skud_10.63 Chr10 complement(109499..111100) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/533 (100%), Positives = 533/533 (100%)

Query: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60
           MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL
Sbjct: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60

Query: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120
           DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD
Sbjct: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120

Query: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180
           AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK
Sbjct: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180

Query: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240
           PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI
Sbjct: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240

Query: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL
Sbjct: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPV 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPV
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPV 480

Query: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           LTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL
Sbjct: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533

>Suva_6.231 Chr6 (414131..415762) [1632 bp, 543 aa] {ON} YJL153C
           (REAL)
          Length = 543

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/542 (88%), Positives = 510/542 (94%), Gaps = 10/542 (1%)

Query: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60
           MTEDNT PTASVRVA+ KCTYT++ELLTKYSYENAVVSKTPDGR+DVTPTVQDYVFK+ L
Sbjct: 1   MTEDNTAPTASVRVASNKCTYTDNELLTKYSYENAVVSKTPDGRYDVTPTVQDYVFKLDL 60

Query: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120
           +KP KLG+MLVGLGGNNGST  A++LANKH+IEF TKEGLKKPNYFGSMTQSSTLKLG+D
Sbjct: 61  NKPAKLGVMLVGLGGNNGSTFTAAILANKHNIEFQTKEGLKKPNYFGSMTQSSTLKLGID 120

Query: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180
           A GNDVYAPFNSLLPM NPNDFV++GWDIN+AN  EAMQRAQVLEYDLQQRL ++MS++K
Sbjct: 121 AQGNDVYAPFNSLLPMANPNDFVVTGWDINNANQFEAMQRAQVLEYDLQQRLKTKMSSLK 180

Query: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240
           PLPS+YYPDFIAANQD+RANNCIN+D KG VTT GKWAHLQQIRHDIQ FK++NSLDKVI
Sbjct: 181 PLPSIYYPDFIAANQDQRANNCINLDEKGHVTTKGKWAHLQQIRHDIQSFKEKNSLDKVI 240

Query: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVE+SAGVNDTMENLLQSIK+DHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVSAGVNDTMENLLQSIKDDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHE  FIAGDD KSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDG+NL
Sbjct: 301 FVPGLVQLAEHEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLG KVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGNKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQ----------ED 470
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYK+ + +Q          E+
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKADSSQENGNGNENENEN 480

Query: 471 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEE 530
           DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQR+ALENFMRLLIGLPSLNELRFEE
Sbjct: 481 DGKFESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFMRLLIGLPSLNELRFEE 540

Query: 531 RL 532
           RL
Sbjct: 541 RL 542

>Smik_10.81 Chr10 complement(132183..133784) [1602 bp, 533 aa] {ON}
           YJL153C (REAL)
          Length = 533

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/533 (88%), Positives = 505/533 (94%)

Query: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60
           MTEDNT P ASV+V T+KCTYTE+ELLTKYSYENAVV+KT  G+FDVTPTVQDYVFK+ L
Sbjct: 1   MTEDNTTPIASVKVVTDKCTYTENELLTKYSYENAVVTKTAGGQFDVTPTVQDYVFKLDL 60

Query: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120
           +KP KLGIML+GLGGNNGSTLVAS+LAN+HD+EF TKEGLKKPNYFGSMTQ STLKLG+D
Sbjct: 61  NKPKKLGIMLIGLGGNNGSTLVASILANRHDMEFQTKEGLKKPNYFGSMTQCSTLKLGID 120

Query: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180
           A GNDVYAPFNSLLPMVNPNDF++SGWDIN ANL EAMQR QVLEYDLQQRL ++MS VK
Sbjct: 121 AEGNDVYAPFNSLLPMVNPNDFIVSGWDINKANLYEAMQRGQVLEYDLQQRLKAKMSTVK 180

Query: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240
           PLPS+YYPDFIAANQDERANNCIN+D KG VTT GKW+HLQQIR DIQ FK+ENSLDKVI
Sbjct: 181 PLPSIYYPDFIAANQDERANNCINLDEKGKVTTRGKWSHLQQIRRDIQHFKEENSLDKVI 240

Query: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVE++AGVNDTM+NLLQSIK+DHEEIAPST+FAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVTAGVNDTMQNLLQSIKDDHEEIAPSTVFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHE  FIAGDD KSGQTKLKSVLAQFLVDAGIKP+SIASYNHLGNNDGYNL
Sbjct: 301 FVPGLVQLAEHEGTFIAGDDFKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPV 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYK+ +  QED  K+ESFYPV
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKKGSSVQEDHDKYESFYPV 480

Query: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           LTFLSYWLKAPLTRPGFHPVNGLNKQR+ALENF+RLLIGLPSLNELRFEERLL
Sbjct: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSLNELRFEERLL 533

>YJL153C Chr10 complement(134332..135933) [1602 bp, 533 aa] {ON}
           INO1Inositol-3-phosphate synthase, involved in synthesis
           of inositol phosphates and inositol-containing
           phospholipids; transcription is coregulated with other
           phospholipid biosynthetic genes by Ino2p and Ino4p,
           which bind the UASINO DNA element
          Length = 533

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/533 (88%), Positives = 507/533 (95%)

Query: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGL 60
           MTEDN  P  SV+V T+KCTY ++ELLTKYSYENAVV+KT  GRFDVTPTVQDYVFK+ L
Sbjct: 1   MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL 60

Query: 61  DKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVD 120
            KP+KLGIML+GLGGNNGSTLVASVLANKH++EF TKEG+K+PNYFGSMTQ STLKLG+D
Sbjct: 61  KKPEKLGIMLIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID 120

Query: 121 AAGNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVK 180
           A GNDVYAPFNSLLPMV+PNDFV+SGWDIN+A+L EAMQR+QVLEYDLQQRL ++MS VK
Sbjct: 121 AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK 180

Query: 181 PLPSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVI 240
           PLPS+YYPDFIAANQDERANNCIN+D KG+VTT GKW HLQ+IR DIQ+FK+EN+LDKVI
Sbjct: 181 PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI 240

Query: 241 VLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300
           VLWTANTERYVE+S GVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT
Sbjct: 241 VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT 300

Query: 301 FVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNL 360
           FVPGLVQLAEHE  FIAGDDLKSGQTKLKSVLAQFLVDAGIKP+SIASYNHLGNNDGYNL
Sbjct: 301 FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL 360

Query: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420
           SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
Sbjct: 361 SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS 420

Query: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPV 480
           ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RVSYK+V+P +ED GKFE+FYPV
Sbjct: 421 ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV 480

Query: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           LTFLSYWLKAPLTRPGFHPVNGLNKQR+ALENF+RLLIGLPS NELRFEERLL
Sbjct: 481 LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL 533

>KLLA0D16412g Chr4 complement(1382063..1383652) [1590 bp, 529 aa]
           {ON} highly similar to uniprot|P11986 Saccharomyces
           cerevisiae YJL153C INO1 Inositol 1-phosphate synthase
           involved in synthesis of inositol phosphates and
           inositol- containing phospholipids transcription is
           coregulated with other phospholipid biosynthetic genes
           by Ino2p and Ino4p which bind the UASINO DNA element
          Length = 529

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/529 (72%), Positives = 450/529 (85%), Gaps = 5/529 (0%)

Query: 6   TIPTASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGLDKPDK 65
           T+   +V+VAT+   ++E EL TKY+Y NA+V K+ DG F+V P  QDY FKV L  P K
Sbjct: 5   TVFKPTVKVATDVAEFSETELTTKYTYRNAIVEKSADGVFNVEPVTQDYEFKVDLKLP-K 63

Query: 66  LGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGND 125
           +G+MLVGLGGNNG+T +AS+LANKH ++F TKEGLK+ NY+GS+TQSSTLKLGVDA GND
Sbjct: 64  VGVMLVGLGGNNGTTFLASILANKHKVKFQTKEGLKEANYYGSVTQSSTLKLGVDAEGND 123

Query: 126 VYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSV 185
           VYAPFNSL+PMV+PNDF +SGWDIN A+L  AM RA+VL  DLQ +L   MSA KPLPS+
Sbjct: 124 VYAPFNSLVPMVSPNDFYVSGWDINGADLGTAMARAEVLGVDLQNKLRQEMSAHKPLPSI 183

Query: 186 YYPDFIAANQDERANNCINVDAK-GSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWT 244
           YYPDFIAANQDERA+NC N D K G V+   KW+H++ IR+DI+ FK+ N LDKV+VLWT
Sbjct: 184 YYPDFIAANQDERADNCFNRDGKAGPVSVKDKWSHVEHIRNDIRQFKENNGLDKVLVLWT 243

Query: 245 ANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304
           ANTERY +I  GVNDT ENL+ +I++DH EIAPST+FA ASILE VPYINGSPQNTFVPG
Sbjct: 244 ANTERYADIVTGVNDTAENLINAIRSDHAEIAPSTVFAVASILENVPYINGSPQNTFVPG 303

Query: 305 LVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPK 364
           ++ LAE E  FIAGDD KSGQTK+KSVLAQFLVDAGI+P+SIASYNHLGNNDGYNLS+P+
Sbjct: 304 VIDLAEKEGAFIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 363

Query: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           QF+SKEISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 364 QFKSKEISKASVVDDIIESNQILYNDKLGNKIDHCIVIKYMPAVGDSKVAMDEYYSELML 423

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFL 484
           GGHNRISIHNVCEDSLLATPLIIDLLVM EFCSR+ YK++N   +  G + SFYPVLT L
Sbjct: 424 GGHNRISIHNVCEDSLLATPLIIDLLVMAEFCSRIKYKKIN---DLSGGYHSFYPVLTML 480

Query: 485 SYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           SYWLKAPLTRPGF  +NGLNKQR+ALENF+RLLIGLP+L+ELRFEERL+
Sbjct: 481 SYWLKAPLTRPGFKAINGLNKQRAALENFLRLLIGLPALDELRFEERLV 529

>CAGL0I06050g Chr9 (575188..576804) [1617 bp, 538 aa] {ON} highly
           similar to uniprot|P11986 Saccharomyces cerevisiae
           YJL153c INO1 myo-inositol-1-phosphate synthase
          Length = 538

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/530 (73%), Positives = 454/530 (85%), Gaps = 8/530 (1%)

Query: 11  SVRV--ATEKCTYTEDELLTKYSYENAVVSKTPDG-RFDVTPTVQDYVFKVGLDKPDKLG 67
           S+RV    +K +Y E+ELLT Y+Y   VV    D  +F+VTP  ++Y FKV L+KP++LG
Sbjct: 8   SIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQFEVTPLDKNYQFKVDLNKPERLG 67

Query: 68  IMLVGLGGNNGSTLVASVLANKHDIEFHT--KEGLKKPNYFGSMTQSSTLKLGVDAAGND 125
           +MLVGLGGNNGST++A+VLANKH++ F T  KEGL +PNY+GS+TQSST+KLGVD+ G D
Sbjct: 68  VMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGLTEPNYYGSLTQSSTIKLGVDSKGKD 127

Query: 126 VYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSV 185
           VY PFNSL+PMVNPNDFV+SGWDIN A + +AM+RA VLE DL+ +L   M   KPL SV
Sbjct: 128 VYVPFNSLVPMVNPNDFVVSGWDINGATMDQAMERASVLEVDLRNKLAPMMKDHKPLKSV 187

Query: 186 YYPDFIAANQDERANNCINVDAK-GSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWT 244
           YYPDFIAANQDERA+NC+NVD + G VTT GKW HL  IR+DI+ FK++N LDKVI+LWT
Sbjct: 188 YYPDFIAANQDERADNCLNVDPQTGKVTTTGKWEHLNHIRNDIRTFKQQNDLDKVIILWT 247

Query: 245 ANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPG 304
           ANTERYVEI  GVNDTMENLL++IKNDH EIAPSTIFAAASILE  PYINGSPQNTFVPG
Sbjct: 248 ANTERYVEILPGVNDTMENLLEAIKNDHTEIAPSTIFAAASILEHCPYINGSPQNTFVPG 307

Query: 305 LVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPK 364
           L++LAE     IAGDD KSGQTK+KSVLAQFLVDAGI+P+SIASYNHLGNNDGYNLS+P+
Sbjct: 308 LIELAEKNDSLIAGDDFKSGQTKMKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQ 367

Query: 365 QFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           QFRSKEISK+SV+DDII SN ILYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELML
Sbjct: 368 QFRSKEISKASVVDDIIESNPILYNDKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELML 427

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVN--PAQEDDGKFESFYPVLT 482
           GGHNRISIHNVCEDSLLATPLIIDL+VMTEFCSRV+Y+ V+     E  G FE+FYPVL+
Sbjct: 428 GGHNRISIHNVCEDSLLATPLIIDLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLS 487

Query: 483 FLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532
           FLSYWLKAPLT+PG+ P+NGLNKQR+ALENF+RLLIGLP+++ELRFEERL
Sbjct: 488 FLSYWLKAPLTKPGYQPINGLNKQRTALENFLRLLIGLPAIDELRFEERL 537

>SAKL0F00396g Chr6 (31629..33212) [1584 bp, 527 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 527

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/525 (71%), Positives = 443/525 (84%), Gaps = 3/525 (0%)

Query: 9   TASVRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGLDKPDKLGI 68
           T  V+VATE C Y   +L+T Y+Y+N +VSK  DG +   P V++Y FKV L  P KLG+
Sbjct: 6   TPKVKVATENCQYRGSDLITNYTYKNTIVSKCSDGSYSAQPVVENYQFKVDLKVP-KLGV 64

Query: 69  MLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVYA 128
           MLVGLGGNNGST +AS+LANKH I+F++KEG    NY+GS+TQ+ST+KLG+DA GNDVY 
Sbjct: 65  MLVGLGGNNGSTFIASILANKHKIQFNSKEGTIGANYYGSVTQASTIKLGIDADGNDVYV 124

Query: 129 PFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYYP 188
           PFNS+LP VNPNDFV+ GWDIN +N+ EAM RA+VLEYDLQ++L + M  + PLPSVYYP
Sbjct: 125 PFNSVLPFVNPNDFVVGGWDINGSNMYEAMVRAKVLEYDLQEKLKAEMEKIHPLPSVYYP 184

Query: 189 DFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTANTE 248
           D+IAANQDERANNCIN   KG+V+T  KW H+++IR DI+DFK+ N LDKVIVLWTANTE
Sbjct: 185 DYIAANQDERANNCIN-RVKGTVSTKNKWDHVEKIRKDIRDFKETNGLDKVIVLWTANTE 243

Query: 249 RYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308
           RY ++  GVND  ENLL++IK+DH EI+PS IFA ASILE VPYINGSPQNTFVPG+V+L
Sbjct: 244 RYSDLIDGVNDNAENLLKAIKSDHTEISPSAIFAVASILENVPYINGSPQNTFVPGIVEL 303

Query: 309 AEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQFRS 368
           AE    FI GDD KSGQTKLKSVLAQFLVDAGI+P+SIASYNHLGNNDGYNLS+PKQF+S
Sbjct: 304 AEKNKSFIGGDDFKSGQTKLKSVLAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPKQFKS 363

Query: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428
           KEISKSSV+DDIIASN ILYN+KLGKK+DHCIVIKYM  V DSKVAMDEYYSELMLGGHN
Sbjct: 364 KEISKSSVVDDIIASNSILYNEKLGKKIDHCIVIKYMPAVADSKVAMDEYYSELMLGGHN 423

Query: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFLSYWL 488
           RISIHNVCEDSLLATPLIIDLLVM+EF SRV+YK++  +    G +E  Y +L+FLSYWL
Sbjct: 424 RISIHNVCEDSLLATPLIIDLLVMSEFLSRVTYKKLE-SDASAGSYEKLYSILSFLSYWL 482

Query: 489 KAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           KAPLTR GF  +NGLNKQR ALENF+RLLIGLP+++ELRFEERL+
Sbjct: 483 KAPLTRKGFETINGLNKQRMALENFLRLLIGLPAIDELRFEERLV 527

>TDEL0C03580 Chr3 (627672..629264) [1593 bp, 530 aa] {ON} Anc_1.195
           YJL153C
          Length = 530

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/524 (71%), Positives = 443/524 (84%), Gaps = 6/524 (1%)

Query: 11  SVRVATEKCTYTEDELLTKYSYENAVVSKTP-DGRFDVTPTVQDYVFKVGLDKPDKLGIM 69
           ++ VA +K  Y+E +L T+Y Y N+VV+K+  DG  +V PT QDY F+V L  P K+G+M
Sbjct: 10  TINVANDKTHYSETKLTTQYRYVNSVVAKSEVDGTLEVRPTAQDYEFQVDLKIP-KIGVM 68

Query: 70  LVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVYAP 129
           LVGLGGNNG+TLVASVLAN+  I FHTK+G K+ NY+GS+TQSST+KLG+D  GNDVY P
Sbjct: 69  LVGLGGNNGTTLVASVLANRDKIRFHTKDGAKEANYYGSVTQSSTIKLGIDEQGNDVYVP 128

Query: 130 FNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYYPD 189
           FNS+LP V+PNDFV+ GWDIN ANL +AM R+QVLEYDLQQ+L   M+   PLPS+YYPD
Sbjct: 129 FNSVLPFVSPNDFVVGGWDINGANLGDAMARSQVLEYDLQQQLRGEMAKTVPLPSIYYPD 188

Query: 190 FIAANQDERANNCINVDAK-GSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTANTE 248
           FIAANQDERA+NCIN D K G+V+T GKW+H++QIR DI++FK  N LDKVIVLWTANTE
Sbjct: 189 FIAANQDERADNCINRDGKSGNVSTKGKWSHVEQIRKDIKNFKSGNDLDKVIVLWTANTE 248

Query: 249 RYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQL 308
           RY ++ + VND  +NLL +IKNDHEEIAPSTIFA ASILEGVPYINGSPQNTFVPG++ L
Sbjct: 249 RYADVLSNVNDNADNLLAAIKNDHEEIAPSTIFAVASILEGVPYINGSPQNTFVPGVIDL 308

Query: 309 AEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQFRS 368
           AE     IAGDD KSGQTK+KSVLAQFLVDAGIKP+SIASYNHLGNNDG+NL++ +QF+S
Sbjct: 309 AEKHNALIAGDDFKSGQTKIKSVLAQFLVDAGIKPVSIASYNHLGNNDGFNLTSERQFKS 368

Query: 369 KEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHN 428
           KEISK SV+DD+IASN ILYN+K G K+DHCIVIKYM  VGDSKVAMDEYYSELMLGGHN
Sbjct: 369 KEISKRSVVDDVIASNKILYNEKAGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHN 428

Query: 429 RISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFLSYWL 488
           RISIHNVCEDSLLATPLIIDL+VM EFCSRVSYK++   Q+    +ESFY +L+FLSYWL
Sbjct: 429 RISIHNVCEDSLLATPLIIDLIVMAEFCSRVSYKKLGSDQQ---SYESFYSILSFLSYWL 485

Query: 489 KAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532
           KAPLTR GF  +NGLNKQR  +ENF+RLLIGLP+L+ELRFEE+L
Sbjct: 486 KAPLTRKGFKTINGLNKQRQGIENFLRLLIGLPALDELRFEEKL 529

>ZYRO0G18150g Chr7 (1494235..1495827) [1593 bp, 530 aa] {ON} highly
           similar to gnl|GLV|KLLA0D16412g Kluyveromyces lactis
           KLLA0D16412g and similar to YJL153C uniprot|P11986
           Saccharomyces cerevisiae YJL153C INO1 Inositol 1-
           phosphate synthase involved in synthesis of inositol
           phosphates and inositol-containing phospholipids
           transcription is coregulated with other phospholipid
           biosynthetic genes by Ino2p and Ino4p which bind the
           UASINO DNA element
          Length = 530

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/526 (70%), Positives = 434/526 (82%), Gaps = 6/526 (1%)

Query: 9   TASVRVATEKCTYTEDELLTKYSYENAVVSK-TPDGRFDVTPTVQDYVFKVGLDKPDKLG 67
           T SV+VAT+K  Y+E EL TKY+Y N++V++       DV P  Q+Y FKV L  P ++G
Sbjct: 8   TPSVKVATDKVHYSETELTTKYTYVNSIVTENAATNTVDVNPIKQEYDFKVDLKLP-RVG 66

Query: 68  IMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVY 127
           +MLVG+GGNNG+T +AS+LAN+  ++FH KEGLK+ NY+GS+TQ STLKLGV   GND Y
Sbjct: 67  VMLVGIGGNNGTTFLASILANRQKMKFHNKEGLKEANYYGSVTQCSTLKLGVRPDGNDFY 126

Query: 128 APFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYY 187
            PFNSLLP V+PNDF ++GWDI+  NL +AM+RAQVLEYDLQ++L   MS  KPLPS+YY
Sbjct: 127 VPFNSLLPFVSPNDFEVTGWDISATNLGDAMERAQVLEYDLQRQLKPEMSEYKPLPSIYY 186

Query: 188 PDFIAANQDERANNCINV-DAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTAN 246
           PDFIAANQD RA+NCIN  +  G  +T  KW HL++IR DI++FK++  LDKVIVLWTAN
Sbjct: 187 PDFIAANQDGRADNCINRPNNAGPASTKNKWEHLERIRADIREFKQQKDLDKVIVLWTAN 246

Query: 247 TERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLV 306
           TERY +I  GVNDT +NLL +IK D EEIAPSTIFA ASILEG  YINGSPQNTFVPG++
Sbjct: 247 TERYADIIPGVNDTADNLLNAIKQDGEEIAPSTIFAVASILEGSVYINGSPQNTFVPGVI 306

Query: 307 QLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQF 366
           +LAE E  FIAGDD KSGQTK+KSVLAQFLV+AGIKP SIASYNHLGNNDGYNLS+ +QF
Sbjct: 307 ELAEREDSFIAGDDFKSGQTKIKSVLAQFLVEAGIKPTSIASYNHLGNNDGYNLSSERQF 366

Query: 367 RSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSELMLGG 426
           +SKEISK SV+DD++ASN +LYNDKLG K+DHCIVIKYM  VGDSKVAMDEYYSELMLGG
Sbjct: 367 KSKEISKKSVVDDVVASNPLLYNDKLGNKIDHCIVIKYMNAVGDSKVAMDEYYSELMLGG 426

Query: 427 HNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFLSY 486
           HNRISIHNVCEDSLLATPLIIDLLVM EFC+RVSYKRV     + GK   FY +L+FLSY
Sbjct: 427 HNRISIHNVCEDSLLATPLIIDLLVMAEFCTRVSYKRVGDGSTEYGK---FYNILSFLSY 483

Query: 487 WLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532
           WLKAPLTR G+  +NGLNKQRS LENFMRLLIGLP+ +ELRFEERL
Sbjct: 484 WLKAPLTRKGYQAINGLNKQRSGLENFMRLLIGLPAQDELRFEERL 529

>KAFR0F01860 Chr6 complement(365737..367365) [1629 bp, 542 aa] {ON}
           Anc_1.195 YJL153C
          Length = 542

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/531 (68%), Positives = 432/531 (81%), Gaps = 9/531 (1%)

Query: 6   TIPTASVRVATEKCTYTED--ELLTKYSYENAVVSK-TPDGRFDVTPTVQDYVFKVGLDK 62
           T P  SV+     CT + D  EL+++Y Y+N++V K       ++TP  QDY FK+ L+ 
Sbjct: 16  TAPRPSVKFNPRLCTLSGDNNELISRYKYQNSIVVKDIHTNELEITPFEQDYQFKINLN- 74

Query: 63  PDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAA 122
           P+K+GIMLVGLGGNNGST +AS+LANK++I F+T+EG  +PNY+GSMTQSSTLKLG+D+ 
Sbjct: 75  PNKVGIMLVGLGGNNGSTFLASLLANKNNISFNTREGTVEPNYYGSMTQSSTLKLGIDSE 134

Query: 123 GNDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPL 182
           GNDV+APFNS+LPMVNPNDFV+SGWDIND NL  AMQRA+VLEYDLQ +L   M + KPL
Sbjct: 135 GNDVFAPFNSILPMVNPNDFVVSGWDINDENLFMAMQRAKVLEYDLQSKLKPYMESYKPL 194

Query: 183 PSVYYPDFIAANQDERANNCINVDAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVL 242
            S+YYPDFIA NQ ERANNCIN +  G   T  KW  L +IR DI+DFK  N+L+ +IVL
Sbjct: 195 KSIYYPDFIAMNQFERANNCINQNDDGQFNTQDKWNDLLKIRQDIKDFKSHNNLENIIVL 254

Query: 243 WTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFV 302
           WTANTER VEI  GVNDTM+NL+ SIK++H EI+PS IFA A+I+E VPYINGSPQNTFV
Sbjct: 255 WTANTERCVEIIPGVNDTMDNLIASIKDNHSEISPSNIFATAAIMEKVPYINGSPQNTFV 314

Query: 303 PGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSA 362
           PGL++LAEH  V IAGDD K+GQTKLKSV+ QFLVDAGIKP+SIASYNHLGNNDG NLS+
Sbjct: 315 PGLIELAEHNDVLIAGDDFKTGQTKLKSVMTQFLVDAGIKPVSIASYNHLGNNDGLNLSS 374

Query: 363 PKQFRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSE 421
             QFRSKEISKSSVIDD I SN+IL+N K    K +HCIVIKYMK VGDSKVAMDEYYS+
Sbjct: 375 HAQFRSKEISKSSVIDDCINSNEILFNKKDSTDKTNHCIVIKYMKAVGDSKVAMDEYYSQ 434

Query: 422 LMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVL 481
           LMLGGHNRISIHNVCEDSLLA+P+IIDLLVMTEF SR++YK++   QE    F  FYP+L
Sbjct: 435 LMLGGHNRISIHNVCEDSLLASPIIIDLLVMTEFLSRITYKKMGEDQE----FHKFYPIL 490

Query: 482 TFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532
           +FLSYWLKAPLTR GF P+N LN+QR ALENF+RLL+GLP  +ELRFEERL
Sbjct: 491 SFLSYWLKAPLTRSGFKPINSLNRQRLALENFLRLLVGLPPNDELRFEERL 541

>TPHA0A02880 Chr1 complement(624919..626541) [1623 bp, 540 aa] {ON}
           Anc_1.195 YJL153C
          Length = 540

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/535 (68%), Positives = 436/535 (81%), Gaps = 17/535 (3%)

Query: 12  VRVATEKCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQ-DYVFKVGLDKPDKLGIML 70
           + V  +KCT   + L +KY+Y + +V+K       +  TV+ DY F V L+ P KLGIML
Sbjct: 10  IIVNNDKCTIEGNTLKSKYTYTSNLVTKNDSTNSYIVDTVKKDYEFNVDLNLP-KLGIML 68

Query: 71  VGLGGNNGSTLVASVLANKHDIEFHTK--EGLKKPNYFGSMTQSSTLKLGVDAAGND-VY 127
           VGLGGNNG+TL+ASVLANK+++EF++K  +GLKK NY+GS+TQSST+KLG+D   ND +Y
Sbjct: 69  VGLGGNNGTTLLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGIDPKTNDEIY 128

Query: 128 APFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYY 187
            PF  +LP+ NPNDFVI+GWDI+D N  EAMQRA VLE+DLQ +L   M  +KPL S+YY
Sbjct: 129 VPFTDILPLSNPNDFVITGWDISDLNCFEAMQRACVLEHDLQMQLKDEMEKIKPLKSIYY 188

Query: 188 PDFIAANQDERANNCIN--VDAKGSV-------TTVGKWAHLQQIRHDIQDFKKENSLDK 238
           PDFIA NQ+ERAN+C N   +A+G+         T  KW+H++QIR DI++FKKEN+LDK
Sbjct: 189 PDFIALNQNERANHCFNRKSEAEGNKDPLSLDGLTKNKWSHVEQIRDDIRNFKKENNLDK 248

Query: 239 VIVLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQ 298
           VIVLWTANTERY  I AGVND  +NLL +IKNDH E++PSTIFA ASILEGVPYINGSPQ
Sbjct: 249 VIVLWTANTERYSTIEAGVNDNADNLLNAIKNDHSEVSPSTIFAVASILEGVPYINGSPQ 308

Query: 299 NTFVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGY 358
           NTFVPG++ LAE E  FIAGDD KSGQTK+KSVLAQFLVDAGIKPLSIASYNHLGNNDG+
Sbjct: 309 NTFVPGVIDLAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGF 368

Query: 359 NLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEY 418
           NLS+P QF+SKEISK  V DD+I SN IL+NDK+GK +DHCIVIKY+  VGDSKVAMDEY
Sbjct: 369 NLSSPMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYLNAVGDSKVAMDEY 428

Query: 419 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFY 478
           YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RV+YK++     D   +E FY
Sbjct: 429 YSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLGEGATD---YEQFY 485

Query: 479 PVLTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           PVLT LSYWLKAPLTRPGF P+NGL KQR+ALENF+RLLIGLP L++LRFEERL+
Sbjct: 486 PVLTLLSYWLKAPLTRPGFKPINGLMKQRAALENFLRLLIGLPPLDDLRFEERLI 540

>TBLA0C02070 Chr3 (490480..492090) [1611 bp, 536 aa] {ON} Anc_1.195
           YJL153C
          Length = 536

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/538 (68%), Positives = 430/538 (79%), Gaps = 9/538 (1%)

Query: 1   MTEDNTIPTASVRVATEKCTYTEDELLTKYSYENAVV-SKTPDGRFDVTPTVQDYVFKVG 59
           MT    +P  +V+V T+KC YTEDEL+TKY+Y+N +V S      FDV    +DY FK  
Sbjct: 1   MTAQTFVP--AVKVQTDKCRYTEDELITKYTYKNVLVDSNQAKTSFDVKIQNEDYEFKTD 58

Query: 60  LDKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTK--EGLKKPNYFGSMTQSSTLKL 117
           L  P K+G+MLVG+GGNNG+T VASVLANK  ++F TK  +GLK  NY+GS+TQ+ST+KL
Sbjct: 59  LKIP-KVGVMLVGMGGNNGTTFVASVLANKKKLKFRTKNFKGLKDANYYGSVTQASTVKL 117

Query: 118 GVDAAG-NDVYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRM 176
           GVD+   NDVY PFNSLLPMVNPNDFV+SGWDI D N  +AM  +QVLEYDL Q+L   M
Sbjct: 118 GVDSETLNDVYIPFNSLLPMVNPNDFVVSGWDIQDYNCYDAMVESQVLEYDLIQQLKPEM 177

Query: 177 SAVKPLPSVYYPDFIAANQDERANNCINVDAKGS--VTTVGKWAHLQQIRHDIQDFKKEN 234
           S +KPL S+YYPDF+A NQ ERANNCIN     S  +    K + L  IR+DI+ FK+EN
Sbjct: 178 SQIKPLKSIYYPDFLAMNQIERANNCINRKDNSSEVIDIKNKQSDLDHIRNDIKTFKQEN 237

Query: 235 SLDKVIVLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYIN 294
            LDKVIVLWTA+TERY +I  GVNDT +NLL SIK  HEEIAPSTIFA ASILEG  YIN
Sbjct: 238 HLDKVIVLWTASTERYADIIEGVNDTADNLLNSIKTSHEEIAPSTIFAVASILEGAIYIN 297

Query: 295 GSPQNTFVPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGN 354
           GSPQNT VPG+V L++ E   IAGDD K+GQTKLKSVLAQFL+DAGIKPLS+ASYNHLGN
Sbjct: 298 GSPQNTLVPGVVDLSKRENTIIAGDDFKTGQTKLKSVLAQFLIDAGIKPLSVASYNHLGN 357

Query: 355 NDGYNLSAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVA 414
           NDGYNLSAPKQFRSKEISKSSVIDD+I SN+ILYN K G +VDHCIVIKYM  VGD+KVA
Sbjct: 358 NDGYNLSAPKQFRSKEISKSSVIDDMIESNEILYNAKTGAEVDHCIVIKYMPAVGDNKVA 417

Query: 415 MDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKF 474
           MDEYYSELMLGGHNRIS+HNVCEDSLLATP++IDL+VM EF SR+SYKRVN   +++ ++
Sbjct: 418 MDEYYSELMLGGHNRISVHNVCEDSLLATPIMIDLMVMVEFISRISYKRVNSRDDEELEY 477

Query: 475 ESFYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532
            +F   L+FLSYWLKAP+ + GF P+NGLNKQR ALENF+RLLIGLP  +ELRFEERL
Sbjct: 478 STFNSTLSFLSYWLKAPMVKKGFQPINGLNKQRLALENFLRLLIGLPPNDELRFEERL 535

>Kpol_2001.17 s2001 (48908..50323) [1416 bp, 471 aa] {ON}
           (48908..50323) [1416 nt, 472 aa]
          Length = 471

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/471 (74%), Positives = 402/471 (85%), Gaps = 6/471 (1%)

Query: 69  MLVGLGGNNGSTLVASVLANKHDIEFHTK--EGLKKPNYFGSMTQSSTLKLGVDAAGN-D 125
           MLVGLGGNNG+T +ASVLANK+++EF++K  +GLKK NY+GS+TQSST+KLG++   N D
Sbjct: 1   MLVGLGGNNGTTFLASVLANKNNLEFYSKNFKGLKKANYYGSVTQSSTIKLGINPETNED 60

Query: 126 VYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSV 185
           VY PFN +LP VNPNDFV+SGWDIN++N SEAMQRA VLEYDLQ +L   M  V PL S+
Sbjct: 61  VYIPFNEILPFVNPNDFVVSGWDINNSNCSEAMQRACVLEYDLQSKLKDYMKDVTPLKSI 120

Query: 186 YYPDFIAANQDERANNCINV---DAKGSVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVL 242
           YYPDFIA NQ+ERANN IN    D      + GKW+H++ IR+DI++FK EN+LDKVIVL
Sbjct: 121 YYPDFIAINQNERANNVINRGTNDLSLENLSKGKWSHVEHIRNDIRNFKNENNLDKVIVL 180

Query: 243 WTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFV 302
           WTANTERY  I  G+NDT +NL+ SIKNDH E++PSTIFA ASILEGVPYINGSPQNTFV
Sbjct: 181 WTANTERYSVIENGINDTADNLINSIKNDHAEVSPSTIFAVASILEGVPYINGSPQNTFV 240

Query: 303 PGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSA 362
           PG+++LAE E  FIAGDD KSGQTK+KSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLS+
Sbjct: 241 PGVIELAEREHSFIAGDDFKSGQTKMKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSS 300

Query: 363 PKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYSEL 422
           P QF+SKEISK  V DD+I SN IL+NDK+GK +DHCIVIKYM  VGDSKVAMDEYYSEL
Sbjct: 301 PMQFKSKEISKRGVCDDMIESNQILFNDKVGKTIDHCIVIKYMNAVGDSKVAMDEYYSEL 360

Query: 423 MLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLT 482
           MLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFC+RV+YK+++ A     +FE FYPVLT
Sbjct: 361 MLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVTYKKLDGADATKKEFEPFYPVLT 420

Query: 483 FLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
            LSYWLKAPLTRPGF  +NGL KQR+ALENFMRLLIGLP L+ELRFEERLL
Sbjct: 421 LLSYWLKAPLTRPGFKAINGLMKQRAALENFMRLLIGLPPLDELRFEERLL 471

>NCAS0I02750 Chr9 (510393..512144) [1752 bp, 583 aa] {ON} Anc_1.195
           YJL153C
          Length = 583

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/528 (67%), Positives = 427/528 (80%), Gaps = 13/528 (2%)

Query: 11  SVRVATEKCTYT--EDELLTKYSYENAVV-SKTPDGRFDVTPTVQDYVFKVGLDKPDKLG 67
           +V +AT KC Y+  ++ LLT Y Y+ + V +   DG   V+   QDY FK+ L  P K+G
Sbjct: 62  NVVLATGKCQYSAKDNVLLTDYKYKTSTVKNNKADGSIKVSLEEQDYKFKIDLKVP-KVG 120

Query: 68  IMLVGLGGNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDA-AGNDV 126
           +MLVG GGNNGSTL+AS+LANKH+I FH K+G  KPNY GSMTQS+T+ LG D   G D 
Sbjct: 121 VMLVGFGGNNGSTLLASILANKHNISFHNKDGEIKPNYLGSMTQSATVHLGRDEETGRDF 180

Query: 127 YAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVY 186
           + PFN++LPMVNPND +++GWDI++ NL+E+MQRAQVL+YDLQ++L   M    P+ S+Y
Sbjct: 181 FQPFNAVLPMVNPNDLIVTGWDISNLNLAESMQRAQVLDYDLQRQLTPLMKEYTPMKSIY 240

Query: 187 YPDFIAANQDERANNCINVDAKG-SVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTA 245
           YP+FIAANQ +RANNCIN  +KG   TT GKW H+ Q+R DI+ FK EN LDKVIVLWTA
Sbjct: 241 YPEFIAANQFDRANNCIN--SKGDEFTTKGKWDHMMQVRSDIKTFKTENQLDKVIVLWTA 298

Query: 246 NTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL 305
           NTE++ +I  GVNDT ENLLQ+IKNDHEEIAPST+FA ASILEGVPYINGSPQNTFVPGL
Sbjct: 299 NTEKFAQIVPGVNDTHENLLQAIKNDHEEIAPSTLFAVASILEGVPYINGSPQNTFVPGL 358

Query: 306 VQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQ 365
           ++LAEHE V IAGDD K+GQTKLKSVL QFLVDAGI+P+SIASYNHLGNNDG NLS+  Q
Sbjct: 359 IKLAEHENVLIAGDDFKTGQTKLKSVLTQFLVDAGIRPVSIASYNHLGNNDGKNLSSQMQ 418

Query: 366 FRSKEISKSSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELML 424
           F+SKEISKS VI+DI+ SN I+Y D   K ++DHCIVIKYM  VGDSKVAMDEYY+ELML
Sbjct: 419 FKSKEISKSGVINDILESNSIMYGDDPEKARIDHCIVIKYMPAVGDSKVAMDEYYNELML 478

Query: 425 GGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFL 484
           GGHNRIS+HNVCEDSLLA P+I+DL++M EFCSRV+YK  N    D+G ++ F+PVLT L
Sbjct: 479 GGHNRISLHNVCEDSLLAAPIILDLVIMCEFCSRVTYKEAN----DNGDYKKFHPVLTLL 534

Query: 485 SYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERL 532
           SYWLKAPL R  F PVNGL KQR+ALENFMRLLIGLP+ +ELRFEERL
Sbjct: 535 SYWLKAPLAREDFLPVNGLMKQRAALENFMRLLIGLPANDELRFEERL 582

>KNAG0C02520 Chr3 complement(492578..494356) [1779 bp, 592 aa] {ON}
           Anc_1.195 YJL153C
          Length = 592

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/521 (67%), Positives = 414/521 (79%), Gaps = 6/521 (1%)

Query: 19  CTYTED--ELLTKYSYENAVVSKTPD--GRFDVTPTVQDYVFKVGLDKPDKLGIMLVGLG 74
           CT + +  EL++ + Y+N V+   P       ++P   +Y FKV L  P+K+G++LVG G
Sbjct: 72  CTLSRETNELVSSFKYQNTVIDTDPSTGAVRGLSPREINYNFKVDLSVPEKVGVLLVGFG 131

Query: 75  GNNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVYAPFNSLL 134
           GNNGSTL+AS+LAN+  + F+ KEG ++ N+FGSMTQSST+KLGVD  GNDV+ PFNS+L
Sbjct: 132 GNNGSTLLASILANRQKMVFNNKEGPQRANFFGSMTQSSTMKLGVDVKGNDVFVPFNSVL 191

Query: 135 PMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSVYYPDFIAAN 194
           PM +P +FV+ GWDIN+ANL EAMQR  VLEYDLQ +L S+M  + P+ SVYYPDFIA N
Sbjct: 192 PMADPTEFVVDGWDINNANLFEAMQRGHVLEYDLQMKLKSQMENIVPMKSVYYPDFIALN 251

Query: 195 QDERANNCINVDAKG-SVTTVGKWAHLQQIRHDIQDFKKENSLDKVIVLWTANTERYVEI 253
           Q +RANNCIN    G   +T  K   L+QIR DI+ FK  N LDKVIVLWTANTER V+I
Sbjct: 252 QFDRANNCINATQGGEGFSTAQKRKDLEQIRKDIRHFKATNKLDKVIVLWTANTERCVDI 311

Query: 254 SAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHEA 313
              VND+ ++LL++I+++HEEIAPSTIFAAASILEGVPYINGSPQNTFVPGL+ LAE   
Sbjct: 312 IPSVNDSADSLLKAIEDNHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLIDLAERHD 371

Query: 314 VFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLSAPKQFRSKEISK 373
           V IAGDD KSGQTKLKSVL QFLVDAGIKP+SIASYNHLGNNDG NLS+ +QFRSKEISK
Sbjct: 372 VLIAGDDFKSGQTKLKSVLMQFLVDAGIKPVSIASYNHLGNNDGKNLSSQRQFRSKEISK 431

Query: 374 SSVIDDIIASNDILYNDKLGK-KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISI 432
           SSVIDD I SN ILYND   K KV+HCIVIKY+  VGDSKVAMDEYYSELMLGGHNRISI
Sbjct: 432 SSVIDDCIQSNKILYNDHKDKSKVNHCIVIKYLPAVGDSKVAMDEYYSELMLGGHNRISI 491

Query: 433 HNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFESFYPVLTFLSYWLKAPL 492
           HNVCEDSLLA PLIIDLLVMTEF SR+ Y+++        KF  FYP+LTFLSYWLKAPL
Sbjct: 492 HNVCEDSLLAAPLIIDLLVMTEFFSRIKYQKIEDGAPPSDKFSDFYPILTFLSYWLKAPL 551

Query: 493 TRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           TR GF P+N LN+QR ALENF+RLLIGLP  +ELRFEERL+
Sbjct: 552 TRKGFQPINSLNRQRLALENFLRLLIGLPPNDELRFEERLV 592

>NDAI0B00120 Chr2 (3784..5487) [1704 bp, 567 aa] {ON} Anc_1.195
           YJL153C
          Length = 567

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/537 (63%), Positives = 421/537 (78%), Gaps = 21/537 (3%)

Query: 16  TEKCTYTEDE--LLTKYSYENAVV---SKTPDGRFDVTPTVQDYVFKVGLDKPDKLGIML 70
           ++KC Y++ E  LLT Y+Y   +V       +   +V+   +DY FKV L  P K+G+ML
Sbjct: 33  SDKCKYSQSENALLTNYTYNKTIVDIQQSHNNNNINVSTLTKDYNFKVDLKIP-KIGVML 91

Query: 71  VGLGGNNGSTLVASVLANKHDIEFHTKEG----LKKPNYFGSMTQSSTLKLGVDAAGN-D 125
           VG+GGNNG+T +AS+LANK+++ F+ K+G     ++  + GSMTQSSTL LG +   N D
Sbjct: 92  VGMGGNNGTTFLASLLANKNNLTFNNKDGPYNIKERGGFLGSMTQSSTLYLGKNQQTNED 151

Query: 126 VYAPFNSLLPMVNPNDFVISGWDINDANLSEAMQRAQVLEYDLQQRLNSRMSAVKPLPSV 185
           VY PFNS+LPM NPND +ISGWDI+  N+ +AMQRA+VLEYDLQ++L   M +  PL S+
Sbjct: 152 VYVPFNSILPMCNPNDLIISGWDISGENMFKAMQRAKVLEYDLQEKLKPLMESYTPLKSI 211

Query: 186 YYPDFIAANQDERANNCINVDAKGS----VTTVGKWAHLQQIRHDIQDFKKENSLDKVIV 241
           YYPDFIA NQ +RA+NCIN   KG+     +   KW  L  IR +I+DFK +N LDKVI+
Sbjct: 212 YYPDFIAMNQLDRADNCINYTTKGTNHDAYSIKNKWNDLLTIRQNIKDFKNDNKLDKVII 271

Query: 242 LWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTF 301
           LWTA TE++ E+  G+NDT ENLL SIK +H+EIAPSTIFA ASILE  PYINGSPQNTF
Sbjct: 272 LWTATTEKFAEVIPGINDTFENLLNSIKANHKEIAPSTIFATASILENCPYINGSPQNTF 331

Query: 302 VPGLVQLAEHEAVFIAGDDLKSGQTKLKSVLAQFLVDAGIKPLSIASYNHLGNNDGYNLS 361
           VPGL+ LAE E V IAGDD K+GQTKLKSVLAQFL+DAGIKP+SIASYNHLGNNDG NLS
Sbjct: 332 VPGLIDLAERENVLIAGDDFKTGQTKLKSVLAQFLIDAGIKPISIASYNHLGNNDGLNLS 391

Query: 362 APKQFRSKEISKSSVIDDIIASNDILY--NDKLGKK---VDHCIVIKYMKPVGDSKVAMD 416
           +  QF+SKEI+KS+VIDD+I SN ILY  +DK+ KK   VDHCIVIKYM+ +GDSKVAMD
Sbjct: 392 SSLQFKSKEITKSNVIDDMIKSNQILYPQSDKMKKKNKDVDHCIVIKYMESIGDSKVAMD 451

Query: 417 EYYSELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCSRVSYKRVNPAQEDDGKFES 476
           EYY+ELMLGGHNRISIHNVCEDSLLA+P+I+DL++M EFCSR++Y   +  Q+ DG ++ 
Sbjct: 452 EYYNELMLGGHNRISIHNVCEDSLLASPIILDLIIMCEFCSRITYIE-SGNQQGDGNYQQ 510

Query: 477 FYPVLTFLSYWLKAPLTRPGFHPVNGLNKQRSALENFMRLLIGLPSLNELRFEERLL 533
           FYPVL+ LSYWLKAPLTRPG+ P+NGLNKQR AL+NFMRLLIGLP ++ELRFEERL+
Sbjct: 511 FYPVLSLLSYWLKAPLTRPGYEPINGLNKQRMALDNFMRLLIGLPPIDELRFEERLM 567

>Smik_4.201 Chr4 complement(367783..369177) [1395 bp, 464 aa] {ON}
           YDL036C (REAL)
          Length = 464

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 376 VIDDIIASNDILYNDKLGK--KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISIH 433
           + +D I SND ++   LGK  +VD   V+  +  +G SK A   +Y     G   R    
Sbjct: 353 IANDPIYSNDEVWGSNLGKNGQVDLATVVTKLDEIGKSKPAKSWFYDSYGYGEVLRQEKC 412

Query: 434 NVCEDSLLATPLIIDL 449
           +VCE  L   P   DL
Sbjct: 413 SVCESDLYTDPGPNDL 428

>Kpol_299.2 s299 (1970..7468) [5499 bp, 1832 aa] {ON} (1970..7468)
            [5499 nt, 1833 aa]
          Length = 1832

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 3/70 (4%)

Query: 76   NNGSTLVASVLANKHDIEFHTKEGLKKPNYFGSMTQSSTLKLGVDAAGNDVYAPFNSLLP 135
            N+G  L    +     I    K+G+K P Y GS    ST  LG     N        L+P
Sbjct: 1171 NSGDKLTIGKIVTGCRIYLSVKDGIKVPEYLGS---KSTFTLGEFGGYNGRVLKTGDLIP 1227

Query: 136  MVNPNDFVIS 145
            +V+P D  +S
Sbjct: 1228 IVSPEDIDLS 1237

>YDL036C Chr4 complement(387513..388901) [1389 bp, 462 aa] {ON}
           PUS9Mitochondrial tRNA:pseudouridine synthase, catalyzes
           the formation of pseudouridine at position 32 in
           mitochondrial tRNAs; contains an N-terminal
           mitochondrial targeting sequence
          Length = 462

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 376 VIDDIIASNDILYNDKLGK--KVDHCIVIKYMKPVGDSKVAMDEYYSELMLGGHNRISIH 433
           + +D I SND ++ + LGK  + D  IVI  +  +G  K A   ++S    G   R    
Sbjct: 351 IANDPIYSNDEVWGNNLGKGGQADFDIVITKLDEIGKRKPAKSWFHSNGGYGEVLRQEKC 410

Query: 434 NVCEDSLLATPLIIDL 449
           ++CE  L   P   DL
Sbjct: 411 SICESDLYTDPGPNDL 426

>TPHA0C03890 Chr3 (837758..839224) [1467 bp, 488 aa] {ON} Anc_2.485
           YKL096W
          Length = 488

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%)

Query: 18  KCTYTEDELLTKYSYENAVVSKTPDGRFDVTPTVQDYVFKVGLDKPDKLGIMLVGLGGNN 77
           + T   +E  T +S  +  ++   D  F V P    YVFKVG         +L     +N
Sbjct: 87  RTTTDSNEATTNFSVRSGYLAYNNDASFYVLPVDDSYVFKVGYTTDSSFDSVLAKCSDSN 146

Query: 78  GSTL 81
           G+T+
Sbjct: 147 GNTI 150

>SAKL0H22550g Chr8 complement(1958491..1961990,1962073..1962163)
           [3591 bp, 1196 aa] {ON} similar to uniprot|P34111
           Saccharomyces cerevisiae YAL001C TFC3 Largest of six
           subunits of the RNA polymerase III transcription
           initiation factor complex (TFIIIC); part of the TauB
           domain of TFIIIC that binds DNA at the BoxB promoter
           sites of tRNA and similar genes; cooperates with Tfc6p
           in DNA binding
          Length = 1196

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 38/101 (37%), Gaps = 3/101 (2%)

Query: 41  PDGRFDVTPTVQDYVFKVGLDKPDKLGIMLVGLGGNNGSTLVASVLANKHDIEFHTKEGL 100
            D +   T + + Y+  VG  K D  G  LV +    G      +    +   F T  G 
Sbjct: 372 KDYKRSFTKSSESYIDSVGKQKKDSNGFGLVRVYDFEGKKKFYRLFTESN---FRTLSGT 428

Query: 101 KKPNYFGSMTQSSTLKLGVDAAGNDVYAPFNSLLPMVNPND 141
           K+P   GS       K  +    +  Y P N+ L  ++ ND
Sbjct: 429 KEPLDLGSFKDWKEQKKTICELNDKNYVPLNNTLRFISRND 469

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 46/112 (41%), Gaps = 15/112 (13%)

Query: 258 NDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNTFVPGLVQLAEHEAVFIA 317
           N T   L Q I N ++ +AP  +FA +S +  +  I        +  L+  ++H    IA
Sbjct: 50  NPTRTVLQQQIANLYD-VAPEQVFAVSSGMTALDII--------LRTLIDNSDHIPTIIA 100

Query: 318 GDDLKSGQTKLKSVLAQ------FLVDAGIKPLSIASYNHLGNNDGYNLSAP 363
           GDDL  G  +L + L           D       I  YN LG  D   L +P
Sbjct: 101 GDDLYGGTQRLLTFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESP 152

>ZYRO0E03586g Chr5 (278440..279492) [1053 bp, 350 aa] {ON} conserved
           hypothetical protein
          Length = 350

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 9/73 (12%)

Query: 220 LQQIRHDIQDFKKENSLDKV-IVLWTANTERYVEISAGVNDTMENLLQSIKNDHEEIAPS 278
           L ++  ++Q+F K N L  V I  W  +     E+        E L+ SI  DH+ + P 
Sbjct: 106 LARVERELQEFIKVNKLTPVNISTWECDISDPQEV--------EELINSIPRDHDGLIPD 157

Query: 279 TIFAAASILEGVP 291
            +   A   + VP
Sbjct: 158 KLVHTAGYCQNVP 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,427,103
Number of extensions: 2696403
Number of successful extensions: 7644
Number of sequences better than 10.0: 38
Number of HSP's gapped: 7820
Number of HSP's successfully gapped: 38
Length of query: 533
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 419
Effective length of database: 40,409,475
Effective search space: 16931570025
Effective search space used: 16931570025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)