Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_10.1581.319ON71671638080.0
Suva_6.1371.319ON71871828870.0
YJL061W (NUP82)1.319ON71371428220.0
Smik_10.1791.319ON71371428110.0
NCAS0A092101.319ON71072714270.0
ZYRO0G20680g1.319ON69269913790.0
NDAI0G057501.319ON73472813431e-175
TDEL0D018801.319ON69170412921e-168
KAFR0A017201.319ON71667612861e-167
KNAG0C058401.319ON74774011061e-140
SAKL0D06930g1.319ON69071210931e-139
Kpol_1035.241.319ON71772410661e-134
TBLA0F013101.319ON74272210571e-133
TPHA0O014601.319ON7217059141e-112
Kwal_14.25801.319ON6877248701e-106
CAGL0J05214g1.319ON7167148341e-100
KLTH0H10692g1.319ON6917258321e-100
Ecym_62901.319ON6717048251e-99
AEL168C1.319ON6737116993e-81
KLLA0F01661g1.319ON6877225943e-66
CAGL0J01221g2.463ON35169800.41
TPHA0O010001.427ON1011115762.0
TDEL0H010301.221ON73657752.2
Kwal_26.7448na 1ON71471743.0
NDAI0E044807.346ON443139733.1
ADR331C5.49ON156264725.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_10.158
         (716 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...  1471   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...  1116   0.0  
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...  1091   0.0  
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...  1087   0.0  
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   554   0.0  
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   535   0.0  
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   521   e-175
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   502   e-168
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   499   e-167
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   430   e-140
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   425   e-139
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   415   e-134
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   411   e-133
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   356   e-112
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   339   e-106
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   325   e-100
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   325   e-100
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   322   1e-99
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   273   3e-81
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   233   3e-66
CAGL0J01221g Chr10 (115478..116533) [1056 bp, 351 aa] {ON} simil...    35   0.41 
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    34   2.0  
TDEL0H01030 Chr8 (177680..179890) [2211 bp, 736 aa] {ON} Anc_1.2...    33   2.2  
Kwal_26.7448 s26 complement(369897..372041) [2145 bp, 714 aa] {O...    33   3.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...    33   3.1  
ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON...    32   5.2  

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score = 1471 bits (3808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/716 (100%), Positives = 716/716 (100%)

Query: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60
           MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS
Sbjct: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60

Query: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120
           RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE
Sbjct: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120

Query: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180
           NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN
Sbjct: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180

Query: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240
           DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST
Sbjct: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240

Query: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300
           TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA
Sbjct: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300

Query: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360
           NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD
Sbjct: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360

Query: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420
           IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT
Sbjct: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420

Query: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMS 480
           IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMS
Sbjct: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMS 480

Query: 481 FTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKII 540
           FTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKII
Sbjct: 481 FTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKII 540

Query: 541 KAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLME 600
           KAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLME
Sbjct: 541 KAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLME 600

Query: 601 RFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKK 660
           RFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKK
Sbjct: 601 RFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKK 660

Query: 661 ELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQSKN 716
           ELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQSKN
Sbjct: 661 ELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQSKN 716

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/718 (75%), Positives = 625/718 (87%), Gaps = 5/718 (0%)

Query: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60
           M +S+SL ALPIFQASLSA+QSP YIFSSHNGTR+V IQD+IIRWC+ LT+ SY SL+FS
Sbjct: 1   MPQSDSLAALPIFQASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFS 60

Query: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120
           RHL+LDDTF  ISSASGDLL F++ QEIFVME+PWGY N+ + S+QDAFQ+FHYSV ++E
Sbjct: 61  RHLVLDDTFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELE 120

Query: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180
            GS S IKKVLFHPKSY+DSCIVVLK DDTITMFDILNQQ  PI+LNKR++SFGLDARVN
Sbjct: 121 LGSNSPIKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQEAPIILNKRNSSFGLDARVN 180

Query: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240
           DITD AFS+DGLTLYCLNTTEGGD+FAFYP LP VL L EKDLGWILNKSLVMYESL++T
Sbjct: 181 DITDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNAT 240

Query: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300
           TD  VKRNI KQLQ VSKLH+N DS+L KV+ID+EYRLVKMQGPFTINPFP+ELY++TA+
Sbjct: 241 TDYKVKRNITKQLQFVSKLHKNWDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTAS 300

Query: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360
            ITTIPIDN QNEIVCV FDDGSL +LFQDLEMSMSWDVDNYV+NNSL+LIERIK+Q+ +
Sbjct: 301 KITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQKE 360

Query: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420
           +KSL  LP++LGKLYV  E+SVHQLD T+W+++LS+CI+ESDLNAL DVKF SK E+I T
Sbjct: 361 MKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFEDIAT 420

Query: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQT----TKFDANNKSDRIDAGKH 476
           I   SN AYI+WND S+L L ++ KLT QNISN K+ Q+     + D N  SD+ D GK 
Sbjct: 421 IHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKSDTGKR 480

Query: 477 -YEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEF 535
            YE+SFTQPINEILSLNESFQK C+SPCE+IIPPA RQ+PLKNEA+ENQLEIFT ISKEF
Sbjct: 481 GYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEF 540

Query: 536 LQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQ 595
           L+KIIKAQSLG SIYNRI EQQFELTRQLQ+TSKII+KD  LQ+KL AQ +KW++Q SRQ
Sbjct: 541 LRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQ 600

Query: 596 VKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDL 655
            +LM RF KLTENLS++AES K +E+NI+ GEM+WFKEIRNQILQFN FV SQKS+QQDL
Sbjct: 601 AELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDL 660

Query: 656 SYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQ 713
           SY+K+EL RIE+ETI  D+K+QNEWDELRKMLE DSKIIKECNEEL+HVSQQLTT TQ
Sbjct: 661 SYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTTKTQ 718

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/714 (75%), Positives = 611/714 (85%), Gaps = 2/714 (0%)

Query: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60
           MS+S+ L ALPIFQASLSASQSP YIFSS NGTR+VFIQDNIIRW N LT+S Y SL+FS
Sbjct: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60

Query: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120
           RHL+LDDTF VISS SGDLL  FN  EIFVMEVPWGY+N+E+ S+QDAFQ+FHYS+ + E
Sbjct: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120

Query: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180
            G +S IKKVLFHPKSY DSCIVVLKEDDTITMFDILN Q KPIVLNK +NSFGLDARVN
Sbjct: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180

Query: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240
           DITDL FS+DGLTLYCLNTTEGGD+FAFYP LP VLLL EKDL  ILNKSLVMYESLDST
Sbjct: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDST 240

Query: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300
           TD+ VKRN+IKQLQ VSKLHEN +S+ GKV+I +EYRL K+QGPFTINPFP ELY+YTA 
Sbjct: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300

Query: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360
           NI TI IDN QNEIVCV FDDGSL LLF+DLEMSMSWDVDNYV+NNSLVLIER+K+Q  +
Sbjct: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQR-E 359

Query: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420
           IKSL TLPE+LGKLYV S+N + Q++  +W++ LS+CI ESDLN L  +KFESKLE+I T
Sbjct: 360 IKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIAT 419

Query: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRID-AGKHYEM 479
           IE   NLAYI+WND SNL L +   LTFQNIS+D + Q+T  + +  +++ D  G  ++M
Sbjct: 420 IERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKM 479

Query: 480 SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKI 539
           SFTQPINEIL LN++FQKACISPCE+IIP A RQ+PLKNEASENQLEIFT ISKEFLQ+I
Sbjct: 480 SFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRI 539

Query: 540 IKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLM 599
           +KAQ+LG SI+NRI EQQFELTRQLQ+T KIISKD DL+ K  AQNKKWDAQ+SRQ +LM
Sbjct: 540 VKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELM 599

Query: 600 ERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMK 659
           ERF KL++ LSQIAES K +EK I+ GEMKWFKEIRNQILQFN+FV SQKSLQQDLSY+K
Sbjct: 600 ERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLK 659

Query: 660 KELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQ 713
            ELTRIEAETIK D+K+QNEWDELRKMLE DSKIIKECNEEL+ VSQ+ TT TQ
Sbjct: 660 SELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/714 (73%), Positives = 613/714 (85%), Gaps = 2/714 (0%)

Query: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60
           MS+S SL +LPIFQASLSASQSP YIF+S NGTR+VFIQDNIIRW N LT+  Y SL  S
Sbjct: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60

Query: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120
           RHL+LDDTF VISS SGDLL FFN QEIFVMEVPWGY+N+E  S+QDAFQ+FHYSV + E
Sbjct: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120

Query: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180
            G +SLIKKVLFHPKSYHDSCIVVLKE+DTI MFDILNQQ KPI+LNK +NSFGLDAR+N
Sbjct: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180

Query: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240
           DITDL FS+DGLTLYCLNTTEGGD+FAFYP LP  LLL E DL WILNKSLVMYESLD T
Sbjct: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240

Query: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300
           TD+TVKRNIIKQLQ VSKLHEN DS+L KV+ID EYRLVK+QGPFTINPFP+ELY+YTA 
Sbjct: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300

Query: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360
           NI TI IDN QNEI C+ FDDGSL LL +DLEMSMSWDV NYV+N+SLVLIER+K+Q+ +
Sbjct: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQK-E 359

Query: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420
           I+SL TLPE++GKLYVFS+N V+Q++ST+W++ +S+CI ESDLN LGD+KFESK+ENI T
Sbjct: 360 IESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIAT 419

Query: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGK-HYEM 479
           +E   NLA+I WN+TSNL L +  +LTFQ +S D+++Q+T+ + +  ++     K  YE+
Sbjct: 420 VEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYEL 479

Query: 480 SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKI 539
            FTQP++EIL+LNE+FQ+ACISPCE+IIP   RQ+PLKNEASENQLEIFT +SKEFLQKI
Sbjct: 480 RFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKI 539

Query: 540 IKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLM 599
            KAQSLG SIYNRI EQQ ELTRQLQ+T KIISKD DL++K  AQNKKWDAQ+ RQ KLM
Sbjct: 540 AKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLM 599

Query: 600 ERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMK 659
           ERF KLTENLS+I++S K +EKNI+  EM+WFKEIRNQILQFN +V SQKSLQQDLSY+K
Sbjct: 600 ERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLK 659

Query: 660 KELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQ 713
           +ELTRIE ETI+ D+K+Q+EW+ELRKMLE DSKIIKECNEEL H SQQLTT TQ
Sbjct: 660 RELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/727 (40%), Positives = 469/727 (64%), Gaps = 36/727 (4%)

Query: 1   MSKSNSLVALPIFQA-SLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDF 59
           MS  +S+ + PIFQ    +   +P ++F+SH+GTR+V +Q  ++RWC S+T SS+ S+  
Sbjct: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWC-SVTASSFNSMTI 59

Query: 60  SRHLILDDTF--------RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQL 111
                  D F        + I S SG+ +  +    I V+E+PWGY      S+   FQL
Sbjct: 60  -------DFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYVT-PSPSMVSKFQL 111

Query: 112 FHYSVGQVENGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSN 171
           F Y+    ++   S IK+VLFHP++Y DSC+VVL ++ TI++ D+  Q  K I LNKR  
Sbjct: 112 FSYN--NKDDDGYSPIKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRVA 168

Query: 172 SFGLDARVNDITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSL 231
           +FG+D ++ DI  + FS+DG TLY L+ ++GGD++AFYP LP  L +  + +  +L++S+
Sbjct: 169 TFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESV 228

Query: 232 VMYESLDSTTDITVKRNIIKQLQLVSKLHENL-----DSQLGKVEIDEEYRLVKMQGPFT 286
           ++YESL   TD  VKRN+I+Q+Q V+KL+  L     +S    +EI++EYRL++ QGPFT
Sbjct: 229 LLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPFT 288

Query: 287 INPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNN 346
           I+P+P+ LY  TA  I+T+PI N  NE++C+ FDDGS+ LLF+DL ++MSWDVDNYVHNN
Sbjct: 289 IDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHNN 347

Query: 347 SLVLIERIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNAL 406
           S  L+E +++++TD+K + + P+  G+ ++F ++S+  + +  WS +L++ I+ S+LN L
Sbjct: 348 SFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNEL 407

Query: 407 GDVKFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANN 466
            ++ F SKL+   T    +  +   W     ++   +  +    +    E++ +    NN
Sbjct: 408 LEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPV----EMRKSGILGNN 463

Query: 467 KSDRID----AGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASE 522
           K   ++      + Y+ SF QP+ E+++LN+ FQ+ C     K+I P  RQ+ L NE +E
Sbjct: 464 KPVLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNE 523

Query: 523 NQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLG 582
            QLE+ + +SKE + KI + Q+L  ++++R+ EQQ+ELTRQL+    I+SK +DL+ K  
Sbjct: 524 VQLELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSE 583

Query: 583 AQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFN 642
            Q+++WD Q SR  +L++R + L   + +I  S KL+E  IN  E++WFKEIRNQ+L+FN
Sbjct: 584 EQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFN 643

Query: 643 NFVRSQKSLQQDLSYMKKELTRIEAETIK-TDEKTQNEWDELRKMLEEDSKIIKECNEEL 701
           +FV +Q+  Q++L+++KK+L RI  ET +  DEK+  EWDELR +L+ D++II+ECN+EL
Sbjct: 644 SFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKEL 703

Query: 702 MHVSQQL 708
           +  ++ L
Sbjct: 704 LSTTEAL 710

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/699 (41%), Positives = 440/699 (62%), Gaps = 22/699 (3%)

Query: 18  SASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFRVISSASG 77
           ++  S  ++ +S +G++VV  QD+ IRWCN+  +S Y+ +       ++D   V+ S +G
Sbjct: 12  ASGSSKRFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TIEDVEHVVLSPTG 68

Query: 78  DLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKVLFHPKSY 137
            LL  +N +E+ ++E+PWGY+ +      + FQ F YSV   ++    LIKKVLFHP +Y
Sbjct: 69  TLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQD---PLIKKVLFHPLAY 121

Query: 138 HDSCIVVLKEDDTITMFD---ILNQQHKPIVLNKRSNSFGLDARVNDITDLAFSRDGLTL 194
            + CIV+LK D+TI + D     ++Q K +VLN+   +FG++  V DI  + FS+DGLTL
Sbjct: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181

Query: 195 YCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQLQ 254
           Y L+  EG D++AFYP LP  + +    L  +++KSLV YE+L   T    KRN IKQ Q
Sbjct: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241

Query: 255 LVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIPIDNMQNEI 314
            +SKL + L++   K++I  ++  V+ QGPFTI PFPD  Y+ TA  +  +PI    N++
Sbjct: 242 FISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLKILPI-GANNDL 300

Query: 315 VCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKTLPEELGKL 374
           + + FDDG++ +L+QDLE++M WD   Y +NNSLVL+E I+++  ++  LK     L + 
Sbjct: 301 LLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGEL-VLKQ--GTLSQF 357

Query: 375 YVFSENS-VHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHPSNLAYISWN 433
           +V    S ++ +D++ WS ILS CI+ SDL  + D++F+S++  I  +    + A    +
Sbjct: 358 FVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAMWKKD 417

Query: 434 DTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMSFTQPINEILSLNE 493
                V  ++  +  ++ + + +  T K   + K   +D  + YE++  QP++EILSLN 
Sbjct: 418 TEPKDVFVSKDTVFVKSTAVNDQPSTVK---DEKKANVDIPR-YEVALNQPMSEILSLNA 473

Query: 494 SFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRI 553
           SFQ     P  K++ P+ RQ  L NE++E QLEI T +SKEFLQKI+KAQ+LGF+++NR 
Sbjct: 474 SFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRC 533

Query: 554 QEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIA 613
            EQQ+ELTRQLQ +S+I+SK   L+ K  +Q+ + ++++ RQ KL++RF  L+E L +I 
Sbjct: 534 LEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRIN 593

Query: 614 ESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTD 673
           ES K RE NI   EM WFKEIRNQ+L FN +V  QK+ Q  L Y++KEL  I  E     
Sbjct: 594 ESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVG 653

Query: 674 EKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNT 712
           EK+++EW EL  +LE D+KIIKECN +L H S ++  +T
Sbjct: 654 EKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  521 bits (1343), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 282/728 (38%), Positives = 444/728 (60%), Gaps = 31/728 (4%)

Query: 7   LVALPIFQASLSASQ-SPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLIL 65
           + + PIF  S+  ++ S  + F+SH GTR+V +Q  I++WCN + +++Y S+      I 
Sbjct: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCN-VIDTTYHSMKVKS--IF 64

Query: 66  DDTFRVIS---SASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENG 122
           ++  ++I    S SGD L  +  + I ++E+PWGY  I +  +   FQ FHY +    + 
Sbjct: 65  NNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDISSSTSA 123

Query: 123 SRSL--IKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180
             S   IK+VLFHPKSYH++C+V+L ED  I + D      + I +N+ + + G++ RV 
Sbjct: 124 LSSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDT-TASTETITINQPTGTLGVETRVI 182

Query: 181 DITDLAFSRD-GLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDS 239
           DI  + F +  GL LY L+ ++GGD++A YP LP  L + +K++  +L KS+V+Y+SL  
Sbjct: 183 DIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKE 242

Query: 240 TTDITVKRNIIKQLQLVSKLHENLDSQLGK-----------------VEIDEEYRLVKMQ 282
                VKRN+IKQLQ  +KL      QL                   +++D EYRLV  Q
Sbjct: 243 NMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQ 302

Query: 283 GPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNY 342
           GPFTI+PFP+ELY  TA     + I N  NE++ + FDDGS+ LLF+DLE++MSWD+ NY
Sbjct: 303 GPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIANY 361

Query: 343 VHNNSLVLIERIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESD 402
           +H+NS  L+E IK++ TDI  L    +  GK ++ S++ +  + + +WS  L++ I++S+
Sbjct: 362 IHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSN 421

Query: 403 LNALGDVKFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKF 462
           LN L ++ FES++     +   +N     ++   +++  +   +  +N++    +   K 
Sbjct: 422 LNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKG 481

Query: 463 DANNKSDRIDAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASE 522
            + + S+   A   Y+++F QPI+E+++LNE FQK C  P  K+I P  RQ+ L NE++E
Sbjct: 482 SSTSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNE 541

Query: 523 NQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLG 582
            QLEI T +SKE + KII  Q+LGF+++NR++EQQ ELTRQL+ T  +  K   ++ K  
Sbjct: 542 IQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNK 601

Query: 583 AQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFN 642
              K+W+ Q++R VKL +R + L E L  I +S  L    I   E++WFKEIRNQ+ +FN
Sbjct: 602 EILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFN 661

Query: 643 NFVRSQKSLQQDLSYMKKELTRIEAE-TIKTDEKTQNEWDELRKMLEEDSKIIKECNEEL 701
           +FV +Q+   ++LS++KKEL RI  + T   DEK++ EW+ELR +LE+DSKIIKECN EL
Sbjct: 662 SFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNIEL 721

Query: 702 MHVSQQLT 709
              ++ + 
Sbjct: 722 TKTTESMA 729

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  502 bits (1292), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 275/704 (39%), Positives = 427/704 (60%), Gaps = 29/704 (4%)

Query: 11  PIFQASLSA-SQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69
           PIF+ SL+A S S  +  ++ +G R V +QD+ IRWCN ++E  Y S+   R     D  
Sbjct: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCN-VSEPGYHSMTLER--AFKDVK 63

Query: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKK 129
            V+ S SG+ L  +N  E+ ++EVPW Y  +  +S+ +AFQLF +    V + +R  IK+
Sbjct: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEV--SSMANAFQLFRF----VSDEAR--IKQ 115

Query: 130 VLFHPKSYHDSCIVVLKEDDTITMFDILNQQ----HKPIVLNKRSNSFGLDARVNDITDL 185
           VLFHP +Y    +V+LK+DD+IT   I+N Q     KP VLN  + ++ LD+ + D+  +
Sbjct: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172

Query: 186 AFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITV 245
            FS+DGLTLY L+ +EG D++AFYP L P +   ++ L  ++ KSL+ Y+ L+  TD  V
Sbjct: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232

Query: 246 KRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTI 305
           KRN IKQL+ VS LH+  +SQ   +EI E  R V+ QGPFTI PFP ++Y  T   I ++
Sbjct: 233 KRNTIKQLKFVSGLHKQQNSQR-ILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291

Query: 306 PIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLK 365
           PI N QNE++ +  DDG++ +L QDL+++M+WD   Y +NNS  L+E I +   +I+ + 
Sbjct: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350

Query: 366 TLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHPS 425
               + G+  V +   V  +D++ WS +++ C+ ESDL  L + K ES++      + P 
Sbjct: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410

Query: 426 NLAYISWNDTSNLVLTARGK-LTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMSFTQP 484
           ++A+  WN T   V+    + +  + +S       +K D +    R +  K Y   ++QP
Sbjct: 411 SVAW--WNTTPQSVVKVSNREVKSKQVSEG----VSKQDDDITGSRQEPEK-YNAHYSQP 463

Query: 485 INEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQS 544
           I EI+ LN+ FQ        K+IPP  RQ PLKNEASE QL++ T  SK+F+ KI   Q+
Sbjct: 464 IAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQT 523

Query: 545 LGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKK 604
           LG +++NRI EQQ +LT QL+A+ +++ K   +     +Q+ + DA  +R   LM RF K
Sbjct: 524 LGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFNK 583

Query: 605 LTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTR 664
             +NL QI  S++ ++  I++ E++WFKEIR Q+L FN  V +QK LQ  L ++K+E+ R
Sbjct: 584 FKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMNR 643

Query: 665 IEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQL 708
           I   T   + + ++EW ELR MLEED+ I+++CN +L   ++Q+
Sbjct: 644 IAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQV 687

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  499 bits (1286), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 270/676 (39%), Positives = 427/676 (63%), Gaps = 23/676 (3%)

Query: 41  NIIRWCNSLTESSYQSLDFSRHLILDDTF--RVISSASGDLLGFFNVQEIFVMEVPWGYN 98
           N +RW  S+  S Y SL     L  DD+    VI S SG  L  ++ + + ++E+PWGY+
Sbjct: 52  NQLRW-GSVASSQYHSLPL---LFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYD 107

Query: 99  NIEEASVQDAFQLFHYSVGQVENGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILN 158
                S++ +FQ     V +      S IKK+LFHPK+  D C+V+L E+D I +FD+  
Sbjct: 108 G-AVTSIKSSFQRVFRDVNK-----SSDIKKILFHPKAADDGCVVILFENDVICLFDL-- 159

Query: 159 QQHKPIVLNKRSNSFGLDARVNDITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLL 218
           ++ + + LNK +N  G++ RV DI D+ FS+DGLTLY L+ T+GGD++AFYP LPP L L
Sbjct: 160 RKSEKLFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSL 219

Query: 219 GEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQLQLVSKLHENLDSQLGK--VEIDEEY 276
            +  L  + NKS ++Y+SLDST  I V++N++KQ++ ++ L ++   +     +EI  ++
Sbjct: 220 KKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSDETKNSCLEISNDF 279

Query: 277 RLVKMQGPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMS 336
           R VK QGPFT+ P+P++LYE TA  I T+ I N  NE+  + FD+G++ LL +DLE+SMS
Sbjct: 280 RQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGN-NNELFAITFDNGTVTLLLKDLELSMS 338

Query: 337 WDVDNYVHNNSLVLIERIKIQETDIKSLKTLPEELGKLYVFSEN--SVHQLDSTNWSAIL 394
           W+ DNYV+NNS VLIE +++    IK LK+     G++++ S+N  SV ++D+T WS  +
Sbjct: 339 WNADNYVYNNSFVLIESVEMGPESIKLLKS-SSLTGQMFI-SQNHSSVRKIDTTAWSFKV 396

Query: 395 SRCIEESDLNALGDVKFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISND 454
           S+CI  SDL +L DV F+SK+ ++   E+       S      ++  +   +  + +   
Sbjct: 397 SKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNSSVISRTLPES 456

Query: 455 KELQTTKFDANNKSDRID--AGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYR 512
                 K D  ++S  I+    K YE+SFTQPI+EI++LN+SFQ+ C  P +KII P  R
Sbjct: 457 DSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQPISEIMNLNDSFQRICRHPFKKIISPEER 516

Query: 513 QMPLKNEASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIIS 572
           Q  L N+++E QL   T IS + +  I++ QSLG  + NR+ EQQ+ELT+QL+ + ++I 
Sbjct: 517 QTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLKESIQLIE 576

Query: 573 KDADLQEKLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFK 632
           K + L+     +  +W+  + +Q +L++RF  L  NL++I ESK++ +  I+  E++WFK
Sbjct: 577 KQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTPISEKEVEWFK 636

Query: 633 EIRNQILQFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSK 692
           E+RNQIL+FN+FV   +++Q+ +++++K L+RIE++  +      +EW E +K+LE D+ 
Sbjct: 637 EVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQRSSHLTSEWAEFKKILETDTN 696

Query: 693 IIKECNEELMHVSQQL 708
           IIKECNEEL     QL
Sbjct: 697 IIKECNEELTKAHTQL 712

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  430 bits (1106), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 258/740 (34%), Positives = 414/740 (55%), Gaps = 54/740 (7%)

Query: 11  PIFQ--ASLSASQSPSYIFSSHNGTRVVFIQ--DNIIRWCNSLTESSYQSLDFSRHLILD 66
           PI Q  A L +  S  Y+F++  GT+ V++   + ++RW  S++E  Y S+        D
Sbjct: 24  PILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRW-GSVSEDEYNSMPLKISNFAD 82

Query: 67  DTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSL 126
            +  VI S SG+ L  ++   + V+EVPW Y N EE S      +F  S  ++   S   
Sbjct: 83  KSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSY-----VFQTSFKEIRKDS--F 135

Query: 127 IKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVNDITDLA 186
           IKKVLFHP++   +C+V+L EDDTI +FD+  + +  I LN  S + G++ R+  I D+ 
Sbjct: 136 IKKVLFHPRAIKKTCMVILFEDDTIYLFDV--EDNNKIALNVPSGNIGIEDRITSIADIE 193

Query: 187 FSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVK 246
           FS+DGLTLY L+  + GDV+A YP LPP+L + +K+L  ++N+S+++Y+SL  TT   VK
Sbjct: 194 FSQDGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVK 253

Query: 247 RNIIKQLQLVSKLHENLDSQLGK------VEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300
           + +IKQ++ +S+L +N+    GK      +EID  YRL K QGPFTI PFP++LY  TA 
Sbjct: 254 KGVIKQVEFISQL-QNISH--GKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKLYSATAT 310

Query: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQ-ET 359
            I  + I    NEI+C+ +D+G+   LF+DLE+SM+WDV    +NNSLVL+E   +Q E+
Sbjct: 311 EICPLNIGG-GNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTES 369

Query: 360 DIKSLKTLPEEL----------------------GKLYVFSENSVHQLDSTNWSAILSRC 397
            +  LK+   +                       G L V   + +  +D+  WS+++S C
Sbjct: 370 AVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDC 429

Query: 398 IEESDLNALGDVKFESKLENIVTIEHPSNLAYISWN--DTSNLVLTARGKLTFQNISNDK 455
           I+  D+NAL  V F+SK  +   I      +  +WN   T  +       +T + +    
Sbjct: 430 IDRHDINALITVSFKSK-GHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKELKKQV 488

Query: 456 ELQTTKFDANNKSDRIDAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMP 515
             +  +  ++ K  +       +  F+ PI+E+ +LN ++Q  C      II P  RQ P
Sbjct: 489 SWKPEQSTSSEKKKQ----AFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDRQKP 544

Query: 516 LKNEASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDA 575
           L N ++E QL++ T +S   L  + K Q LG ++YNR+ EQQ ELT+QLQ ++KI+ K  
Sbjct: 545 LLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQP 604

Query: 576 DLQEKLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIR 635
            + +KL  Q   W+ ++++Q KL ERF  L + L+ I ++KK  +  I   E  WFKE++
Sbjct: 605 AIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVK 664

Query: 636 NQILQFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIK 695
            + L FN+ V  Q+S+Q DL ++K+EL+   +++ +       EW  L++ML+ DS +++
Sbjct: 665 KEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLKHDSLLLR 724

Query: 696 ECNEELMHVSQQLTTNTQSK 715
              ++    S Q++    SK
Sbjct: 725 ADKKDKKDASSQVSRRASSK 744

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  425 bits (1093), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 266/712 (37%), Positives = 404/712 (56%), Gaps = 46/712 (6%)

Query: 11  PIFQ-ASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69
           PIFQ  S+     P  + ++ +G RVV IQ + IR C+S   S YQ ++   + +     
Sbjct: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSS-GNSQYQIIECGINTVAGAAL 65

Query: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKK 129
               + SG LL  +N  E+ V+ +P  +     +S     +   Y++       +S IK+
Sbjct: 66  ----NNSGTLLCAYNETELQVIVLPSPF----VSSHGGILKPHTYNIT-----VKSPIKQ 112

Query: 130 VLFHPKSYHDSCIVVLKEDDTITMFDILNQ--QHKPIVLNKRSNSFGLDARVNDITDLAF 187
           V +HP+   DS  VVL +DDTI M+++ N+  Q    VLN   N  G+ + + DI  + F
Sbjct: 113 VQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCF 172

Query: 188 SRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKR 247
           S+DGL LY LN++EGGDV+A YP LP VL++ E+ L     KS + YE+L S    TVKR
Sbjct: 173 SKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKR 232

Query: 248 NIIKQLQLVSKLHENLDSQL------GKV--EIDEEYRLVKMQGPFTINPFPDELYEYTA 299
           N+IKQLQ VS+LH+   S+       G +   I E YR  K+QGPFTINPF ++LY  TA
Sbjct: 233 NVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATA 292

Query: 300 ANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQET 359
             ITT+PID   NE++ V FD+G++   FQDL++SM W+  +   NNSLV++E + I   
Sbjct: 293 TQITTMPIDEF-NELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILSG 351

Query: 360 DIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIV 419
            I  L        K  V    S   +DS+ W+  LS CI  S+L  L  +  +S +    
Sbjct: 352 QIICLTP-----HKFAVLGPKSF-VVDSSEWTKALSECINFSNLEVLSQINIKSTIT--- 402

Query: 420 TIEHPSNLAYIS---WNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKH 476
               P N A+     W       L      + ++I+  +  +T   DA +K+ +      
Sbjct: 403 ----PVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTK--DAVSKTVQPVTEVK 456

Query: 477 YEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFL 536
           YE  F+QPI EIL LN+ FQ  C    + +IPP    +PL+N+++E+QL + T ISKE  
Sbjct: 457 YEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVF 516

Query: 537 QKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQV 596
            KII+ Q+LG  I+NR+ EQ++ELTRQL+ +S+I+ K   LQE+   QN +W+    +Q 
Sbjct: 517 SKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQE 576

Query: 597 KLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLS 656
            +  RF+KL   L++I+ S KL++  I++ EM+WFKEI++Q+  FN FV  Q+ +++ L 
Sbjct: 577 NIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLE 636

Query: 657 YMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQL 708
           +++ EL    A   +  ++   +W EL+++L  DS+IIKECNE L+  +++L
Sbjct: 637 FVQSELKT--AGERRVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKEL 686

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  415 bits (1066), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 265/724 (36%), Positives = 416/724 (57%), Gaps = 32/724 (4%)

Query: 11  PIFQ-ASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69
           PIF+  S+S   +  + FS++NGTR++  QD+ IRW  S     YQS+   R   +D T 
Sbjct: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVTG 65

Query: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEAS--VQDAFQLFHYSVGQVENGSRSLI 127
            +IS   GD L  +N  +I V+E+PWG  N++E S  +  + Q   Y+     N  +  +
Sbjct: 66  AIISDP-GDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNF----NEDKLSV 120

Query: 128 KKVLFHPKSYHDSCIVVLKEDDTITMFDILN---QQHKPI--VLN-KRSNSFGLDARVND 181
           K+VLFHP S     +VVL     I   D+ N       PI   LN   SN  G+D RV +
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 182 ITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTT 241
           I  + F+ D L+LY L  T   DV+ FYP LPPV  L +  +  ++NKS+V+YE+L    
Sbjct: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237

Query: 242 DITVKRNIIKQLQLVSKLH------ENLDSQLG-KVEIDEEYRLVKMQGPFTINPFPDEL 294
           D  V++N+IKQLQL S L       EN + ++   VEID E+R  K QG F+I+P+P+ L
Sbjct: 238 DDIVRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESL 297

Query: 295 YEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERI 354
           Y  T   I+ +PI    NE+  V FD+G++ ++F+D E +MSWDV++Y  NNS  L+E I
Sbjct: 298 YTCTGKQISVLPIGE-GNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356

Query: 355 KIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESK 414
           K +  ++ ++  L  ELGK  V  E S   +D+T WS+++S+CI ++DL  L  ++ +S 
Sbjct: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416

Query: 415 LENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAG 474
           + +I +    ++    +  +  +L+L     +    +   KE++     A   S  ++  
Sbjct: 417 ITHINSDMQINSCGIWNSGEAKSLLLVDTNVVVGYQLFK-KEVEFKPESAEEISTELE-- 473

Query: 475 KHYEM-SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISK 533
            ++ +  FT P NE+ + N  FQ+A   P  K+IP   +Q+P  + A E QL+I   IS+
Sbjct: 474 -NFTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISR 532

Query: 534 EFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVS 593
           +   KI++ QSLG  +Y+R+ EQQ +L+ QL  T+KI+ +   +Q    AQ  K D ++ 
Sbjct: 533 DVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLK 592

Query: 594 RQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQ 653
           +Q  L +   K+  NL+ I ES+KL+   ++  E++ FKE+R+QIL FNNFV  QK  +Q
Sbjct: 593 KQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQKQ 652

Query: 654 DLSYMKKELTR-IEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNT 712
           ++ ++KKEL + I+    ++ +   NEW+ELR++L +D+KIIKECNE+L  +S++L T  
Sbjct: 653 NIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELDTKN 712

Query: 713 QSKN 716
              N
Sbjct: 713 TVTN 716

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  411 bits (1057), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 256/722 (35%), Positives = 398/722 (55%), Gaps = 41/722 (5%)

Query: 11  PIFQAS-LSAS---QSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILD 66
           PIF+ + LS+S    SP + F+++   RVV +QD  IRWC + +++ +     SR+  + 
Sbjct: 19  PIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDIK 78

Query: 67  DTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSL 126
           D+   + S SG  + +++  +I +ME+PW ++N   AS     Q + YS  +        
Sbjct: 79  DS---LISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLT---- 131

Query: 127 IKKVLFHPKSYHDSCIVVLKEDDTITM------FDILNQQHKPIVLNKRSNSFGLDARVN 180
           +K+VLFHP +  +SC+VVL  DDTI        FD+L+  +   +LNK+S S GL ++++
Sbjct: 132 VKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDY---ILNKKSKSIGLSSQIS 188

Query: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240
           DI  L FS+DGLTLY L+++   DV+AFYP LPP      + L  ++NKS+V YE L   
Sbjct: 189 DIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELRED 248

Query: 241 TDITVKRNIIKQLQLVSKLH--------ENLDSQLGKVEIDEEYRLVKMQGPFTINPFPD 292
               +K NIIKQL+  S L+        E+ DS+  K ++  EYRL++ QGPFTI+PFPD
Sbjct: 249 DPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTISPFPD 308

Query: 293 ELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIE 352
            LY  +  +I ++PID   NE++ + F DGS+  LFQDLE++MSWD DN+  NNSLVL+E
Sbjct: 309 SLYYSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLVLLE 367

Query: 353 RIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFE 412
            IK +E +I+ L T   + G  Y+       ++ +++WS+ L+ CI+ SD+  L ++  +
Sbjct: 368 LIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSNLLIK 427

Query: 413 SKLENIVTIEH----------PSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKF 462
           S ++      +          P+  + +  N ++ + L  + KL   +  +   L T++ 
Sbjct: 428 SVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSD--DTTHLLTSEL 485

Query: 463 DANNKSDRIDAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASE 522
                    D     E+     I+++ ++N  F++         IP   R + L N+ +E
Sbjct: 486 AQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFNKTNE 545

Query: 523 NQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLG 582
           NQLE  T ISK    KI   QSLGF IYN+I +QQ  +  QL+ T +++ K+  L  K  
Sbjct: 546 NQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILNTKYN 605

Query: 583 AQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFN 642
            Q  K  A   RQ KLM R   + E L +      L   +I++ E+++FKEIR Q+L FN
Sbjct: 606 EQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQVLLFN 665

Query: 643 NFVRSQKSLQQDLSYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELM 702
            FV  QK     L ++KKEL RI+ E    DE    +WD LR ML +D+  I+ C E + 
Sbjct: 666 EFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCTESIK 725

Query: 703 HV 704
           ++
Sbjct: 726 NI 727

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  356 bits (914), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 228/705 (32%), Positives = 395/705 (56%), Gaps = 45/705 (6%)

Query: 31  NGTRVVFIQDNIIRW--CNSLTESSYQSLDFSRHLILDDTFRVISSASGDLLGFFNVQEI 88
           NG +++  Q+N +R+   N   + +++S+   + +I D    +I+   G+ L  FN  EI
Sbjct: 29  NGLKIILYQNNTVRYGFVND-ADGNFKSITLEKEMIGD--VSIIADQIGNYLCLFNEFEI 85

Query: 89  FVMEVPWG-YNNIEEASVQ--DAFQLFHYSVGQVENGSRSLIKKVLFHPKSYHDSCIVVL 145
            V+E+PW  ++  E++S Q  +  Q+  Y +        + I+K+LFHP      C+VVL
Sbjct: 86  RVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSF----GTTIQKILFHPLGLAYPCLVVL 141

Query: 146 KEDDTITMFDI---LNQQHKP---IVLNKRSNSFGLDARVNDITDLAFSRDGLTLYCLNT 199
            ++  I   DI   L  +  P   I         GL + ++DI D++FS D L+LY L  
Sbjct: 142 LKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIIDISFSSDKLSLYALTE 201

Query: 200 TEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQLQLVSKL 259
           T   D++ FYP L P + + + ++  +  KS++++E+L++ +   V+RNIIKQLQL+S L
Sbjct: 202 T---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQLLSTL 258

Query: 260 HENLDSQLGKV-----------EIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIPID 308
             ++ +Q+ +V           +I+ EYR V  QG F+I PFP+ELY+ +A N++ I I 
Sbjct: 259 SGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLSVIQIG 318

Query: 309 NMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKTLP 368
           +  NE+  + +DDG++ +L++DLE SMSWD ++Y  NNS +L+E++K    + KS+  +P
Sbjct: 319 H-GNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSILDIP 377

Query: 369 EELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHPSNLA 428
            + G   +  + +V+ +D++ WS ILS+CI+++D+  L  +  ES  + I T+E P+  +
Sbjct: 378 FKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESHKQTINTLEEPN--S 435

Query: 429 YISWNDTSN--LVLTARGKLTFQNI--SNDKELQTTKFDANNKSDRIDAGKHYEMSFTQP 484
            I WN+ +   L+     KL   +I  SN++  +     A N   +I+  K    +++QP
Sbjct: 436 CILWNEHNKKELLFITETKLISSDILESNNESAEKLPVPAINDIKKIE--KLQLKNYSQP 493

Query: 485 INEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQS 544
           I EI    + ++ +C  P  K+IP   RQ P  N+ +E+QL   T IS+E   KI++ Q+
Sbjct: 494 IKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYITEISQEIGSKILQGQT 553

Query: 545 LGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKK 604
           +   ++ R++EQQ     QL  T+K +  +  +++    Q+ K      R  KL ER  K
Sbjct: 554 IALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITERNTKLNERTSK 613

Query: 605 LTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTR 664
           L E + +I +S++ +   IN  E K FKEI+ Q+L FN+ V  Q+  Q+ + +++ EL  
Sbjct: 614 LIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNN 673

Query: 665 IEAETIKTDEKT----QNEWDELRKMLEEDSKIIKECNEELMHVS 705
           I  +  ++ +      ++EW+EL  +L  D+KII++CN EL   S
Sbjct: 674 IIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSAS 718

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  339 bits (870), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 224/724 (30%), Positives = 368/724 (50%), Gaps = 71/724 (9%)

Query: 11  PIFQASL-SASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTF 69
           PIF     S+ +S  ++F+    ++   +Q N +RWC S     YQ L+F   +   D  
Sbjct: 7   PIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWC-SAGGHEYQYLEFEPRI---DYT 62

Query: 70  RVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKK 129
            V+ + SG LL  +N +++ ++ V W      + S  D   L     G         IK+
Sbjct: 63  SVVINESGSLLCLYNSKQVQILAVSW------DESKSDTI-LISPPAG---------IKQ 106

Query: 130 VLFHPKSYHDSCIVVLKEDDTITMFDILNQQH--KPIVLNKRSNSFGLDARVNDITDLAF 187
            L+HP+    SC+ VL   D I ++++L + +     +LN  +   G+ + V DIT ++F
Sbjct: 107 ALWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSF 166

Query: 188 SRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKR 247
           S DGLTLY L+T+EG D+++ YP LP  + +    L  + NK+L+ Y+ L+      ++R
Sbjct: 167 SSDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRR 226

Query: 248 NIIKQLQLVSKLHEN---LDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITT 304
            + KQLQ VSKL +     D++   V I + +R  + QGPFTINPFPD LY  T   +  
Sbjct: 227 KVTKQLQFVSKLQKKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEV 286

Query: 305 IPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQE------ 358
           I +     E++ + FDDG++   F D E  MSW+ + +  NNSL+++  + I        
Sbjct: 287 IKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNIGGEIALVN 346

Query: 359 ----TDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLN---ALGDVKF 411
                 + S K     L KL    E+S++  D + +        +E+DL+      + +F
Sbjct: 347 GYTFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYF--------DEADLSEEVVEKNGRF 398

Query: 412 ESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRI 471
            S +  I      S +A +S   TS++ +      +         L T K D        
Sbjct: 399 CSAI--ICASSEKSCVALLSETTTSHIDI----PFSLDAPKMRTALGTAKTDV------- 445

Query: 472 DAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGI 531
              + Y   + QP+NE+L+LNE  Q     P +  + P+ RQ  L NE++E+QL + T I
Sbjct: 446 ---EQYR-PYGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSI 501

Query: 532 SKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQ 591
           SKE + +I  AQ+L  S+Y R+  QQ ELT+ L+  SK+    + +  +L  Q+ +W+A 
Sbjct: 502 SKEVMTRIASAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAA 561

Query: 592 VSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSL 651
            ++   +  R ++++  L Q++ S K + + I+  E++WFKEIR+Q+++FN  V  Q+SL
Sbjct: 562 QAKNKSISSRLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSL 621

Query: 652 QQDLSYMKKELTRIEA-------ETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHV 704
              LS +K EL  +          +   D K +  WDELR +L +D +II EC + L  V
Sbjct: 622 GNTLSNLKCELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGV 681

Query: 705 SQQL 708
           ++QL
Sbjct: 682 AKQL 685

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  325 bits (834), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 222/714 (31%), Positives = 392/714 (54%), Gaps = 35/714 (4%)

Query: 16  SLSASQSPSYIFSSHNGTRVVFIQD-NIIRWCNSLTESSYQSLDFSRHLILDDTFRVISS 74
           + + + +  ++FSS +GT++V I D   +RWC+S T ++Y+SLDF            +SS
Sbjct: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS-TSTTYKSLDFDLQF-EGKVEGAVSS 69

Query: 75  ASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKVLFHP 134
            + D +  +N  E+ V+EVPW Y+  EE  ++    ++ +     EN S   IK+VLFHP
Sbjct: 70  TTADYVCIYNRDELHVLEVPWMYSG-EENGLKHLCHIYSHKFD--ENHS---IKQVLFHP 123

Query: 135 KSYHDSCIVVLKEDDTITMFDIL-NQQHKPIV-LNKRSNSFGLDARVNDITDLAFSRDGL 192
           KSY DS I+VL  DD+I M +   N+  K ++ LN ++++ GL  R+NDI  + FS+DGL
Sbjct: 124 KSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGL 183

Query: 193 TLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQ 252
           +L  L+  EG D+F  YP LP    +   ++  +  KSL++Y +++  T    KRNI+KQ
Sbjct: 184 SLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQ 243

Query: 253 LQLVSKLHEN---LDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIPIDN 309
           L  + K+        +    + +++ Y   + QGPF++ P+P+ELY++ A +I  I I  
Sbjct: 244 LNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQ 303

Query: 310 MQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKTLPE 369
             + ++ + F +G++ L   DLE  MSWD+  +  +NSL L+E+IK++ TD     ++P 
Sbjct: 304 NIS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPG 362

Query: 370 ELGKLYVFSEN--SVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENI--VTIEHPS 425
             GK +V ++N  S   +++ +WS IL++ I++SD+  L ++K +S +EN+  +     S
Sbjct: 363 TYGK-FVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKS 421

Query: 426 NLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSD-----RID----AGKH 476
            + + + N + N +++ +       +  D    TTK    ++S+     ++D        
Sbjct: 422 IIYWKNENISCNYIISDKKIEELDML--DGISSTTKHKLIDQSNSQVESKLDLPELKNGL 479

Query: 477 YEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFL 536
           YE+ F +P+ EI    + + K   +     IP   R  PLKN ++ENQLE  T IS+ ++
Sbjct: 480 YEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYM 539

Query: 537 QKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQV 596
           + I  AQ+LG+    R+ +   E +RQ++ T +I     + ++    QN K D    +Q 
Sbjct: 540 KMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQ 599

Query: 597 KLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLS 656
           KLMER   L + +    E   +   NI+  E +WF EI+  +++FN++VR   +  Q+L 
Sbjct: 600 KLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELE 659

Query: 657 YMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKII----KECNEELMHVSQ 706
           ++K++  +I  +      +   EW++L+++L  D KII    K+C+  +  ++Q
Sbjct: 660 FIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEFEKKCDTAVNGINQ 713

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  325 bits (832), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 227/725 (31%), Positives = 377/725 (52%), Gaps = 65/725 (8%)

Query: 9   ALPIFQA-SLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDD 67
           A PIFQA SL  S+S      + + +R + ++ N ++WC  +   +Y+ ++   + I + 
Sbjct: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWC-LMDAPNYEYMEL--NAISNY 61

Query: 68  TFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLI 127
           T  V++  SG LL   NV EI V+ + W     E   ++            V  G    +
Sbjct: 62  TSAVLND-SGTLLCLNNVDEIQVLALSWDQTRPESYRIK------------VPAG----V 104

Query: 128 KKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKP--IVLNKRSNSFGLDARVNDITDL 185
           K+VL+HP+   DSC+ VL + D I ++++L++       VLN  +N  G+ + V DI  +
Sbjct: 105 KQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESV 164

Query: 186 AFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITV 245
            FS DGLTLY ++ +EG DVF+ YP +P  L +  K L +  NK+L+ Y+ L       +
Sbjct: 165 CFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPEL 224

Query: 246 KRNIIKQLQLVSKL----HENLDSQ---LGKVEIDEEYRLVKMQGPFTINPFPDELYEYT 298
           K    +QL  +S L    H+  DSQ   L    I + YR  + QGPFTI+PFP++LY  T
Sbjct: 225 KLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLAT 284

Query: 299 AANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQE 358
           A  I  I +++   E++ + FDD ++   F DL   MSW+       NSL+ +  +K   
Sbjct: 285 AKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLK--- 341

Query: 359 TDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAI-----LSRCIEESDLNALGDVKFES 413
                   LP  +  +Y     S   L S   +A+     L+R IE S  +       E 
Sbjct: 342 --------LPGSISLIY----GSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEE 389

Query: 414 KLENIVTIEHPSNLAYISWNDTS--NLVLTARGKLTFQNISNDKELQTTKFDANNKSDRI 471
            L   +T +  +  +   W ++    +VL +  ++T  +IS+   +QT       K ++ 
Sbjct: 390 DLTEEITEKKGTFQSAGLWPESGMQKIVLLSEKEITSIDISS---MQTPASSTTEKIEKS 446

Query: 472 DAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGI 531
           +  +  +  ++QP++E+ +LN+  Q    SP   +IP A RQ  L N  +E+QL + T I
Sbjct: 447 ETNR--QRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDI 504

Query: 532 SKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQ 591
           SKE L ++  AQ+LG S++ R+  QQ EL + L+  S++ +K   +   L +Q  +W+A 
Sbjct: 505 SKEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAI 564

Query: 592 VSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSL 651
             +   +  RF+ L  N++QI++S +L+ + I + EM+WFKE+RNQ+++FN  V  Q+ L
Sbjct: 565 QEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDL 624

Query: 652 QQDLSYMKKELTRIEAETIKTDEKTQNE--------WDELRKMLEEDSKIIKECNEELMH 703
            + LS +K  L  +  ++ +   +++          WDEL+ ML +DS+IIKEC  EL  
Sbjct: 625 AEALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQC 684

Query: 704 VSQQL 708
            +Q+L
Sbjct: 685 TTQEL 689

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  322 bits (825), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 214/704 (30%), Positives = 370/704 (52%), Gaps = 51/704 (7%)

Query: 11  PIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFR 70
           PIFQ     + S  ++    N T++V   D  +R+   +TE +++S    +HL +  +  
Sbjct: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYAR-VTEHTFKS----KHLDIKHSEH 61

Query: 71  VISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKV 130
            I + SG L+ F+            G N++E   +          +G         IK+V
Sbjct: 62  SILNNSGTLIAFY------------GSNDVELFDMDGKKSCLRVELG---------IKQV 100

Query: 131 LFHPKSYHDSCIVVLKEDDTITMFDIL--NQQHKPIVLNKRSNSFGLDARVNDITDLAFS 188
           L+HP +Y DSC+VVL +++TI ++++   N  +  +VLN++    G+ + V++I  +AFS
Sbjct: 101 LWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFS 160

Query: 189 RDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRN 248
            DGLTLY L+  EGGDV+A +PLLP  L +          K+  +YES+D  T    K  
Sbjct: 161 PDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIA 220

Query: 249 IIKQLQLVSKLHENLD--SQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIP 306
           +I+    VSK+++ +D  S+   V I E  R+V  +GPF+I  FP+ELY  TA  + T+P
Sbjct: 221 MIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLP 280

Query: 307 IDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWD--VDNYVHNNSLVLIERIKIQETDIKSL 364
           +++    ++ + FDDG++  LF D+E+ MSW   ++N     S VLIE+ +    +I ++
Sbjct: 281 VNDEGAYVLILSFDDGTILSLFPDIELLMSWSRSLNNAC---SFVLIEKFR-AGGEIFAI 336

Query: 365 KTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVTIEHP 424
           ++       + +  +N+ H +      A L  CI+E D+  + DVK  S +  +    H 
Sbjct: 337 ES------GVAILEKNNAHIVRFPYLKA-LGECIKEGDIAPMVDVKLTSDITPLAGSYH- 388

Query: 425 SNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEMSFTQP 484
                ++WN+ S   +   G    ++I +D  L + K   +     I     Y + F   
Sbjct: 389 ---TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVD---PAISQNGKYTVCFPST 442

Query: 485 INEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKIIKAQS 544
           + E+L  N++ Q     P   ++P   + +PL +E +E+QL   T IS E + +II AQS
Sbjct: 443 MEELLKTNKALQHTLRQPL-PLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQS 501

Query: 545 LGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLMERFKK 604
           LG+ +YNR   QQFEL RQL+  SK+  +   L++   +   + D+   + + L  R +K
Sbjct: 502 LGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEK 561

Query: 605 LTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMKKELTR 664
           L ++L ++ ES K  E  ++  E  WF+E++N +L FN +V     L ++L+++KKEL  
Sbjct: 562 LQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELEL 621

Query: 665 IEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQL 708
           IE+       +    +++L+ +L  DSK+I +CN++L+  ++ L
Sbjct: 622 IESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  273 bits (699), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 201/711 (28%), Positives = 351/711 (49%), Gaps = 63/711 (8%)

Query: 11  PIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFR 70
           PIF A    +    +  +  +GT++V   +  +R     TE +Y+S     H  +D    
Sbjct: 7   PIFNADALGASHRLHAHTHGDGTKIVGYYNKHLRL-GRFTEQTYKSW----HAEVDAKAS 61

Query: 71  VISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKV 130
            I + SG LL F+    I V++         E             +    NG    IK+V
Sbjct: 62  SILNGSGSLLAFYGDHIIEVVD--------REGK----------KITLTVNGG---IKQV 100

Query: 131 LFHPKSYHDSCIVVLKEDDTITMFDILNQQH-KP-IVLNKRSNSFGLDARVNDITDLAFS 188
           L+HP +Y DSC+VVL   +TI ++++   ++ KP +VLN+ ++  G+ +RV DIT++AF+
Sbjct: 101 LWHPLAYLDSCLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFA 160

Query: 189 RDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITVKRN 248
            DGL+LY  +T+EGGDV    PLLP  +           NK+  +Y +L   T    K  
Sbjct: 161 PDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVA 220

Query: 249 IIKQLQLVSKLHENLD--SQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAANITTIP 306
            I+ L+ V++L + ++     G++ I E  R    QGP+ I+ FP++LY      +T +P
Sbjct: 221 TIEYLEFVTQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVVP 280

Query: 307 IDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETDIKSLKT 366
           +   +  ++ + FDD +  LLF   E+ MSW  D   +  +L+L+E      T   +   
Sbjct: 281 LGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKD-LKNAYTLMLVEEFTATGTAFATCD- 338

Query: 367 LPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFES-------KLENIV 419
                  + V   +S  +++     A L  CI + +L AL D+ F S       K  ++ 
Sbjct: 339 ------GVAVLGIDSAQRVEIPYLQA-LEDCIRDCNLAALQDINFTSSICKIPGKFHSVA 391

Query: 420 TIEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGKHYEM 479
               P N   I   D    ++ +      +   +D E   T+ D+    +       Y +
Sbjct: 392 RFNAPGNKGIILVGDHHAKIVPST-----EAAKSDTE---TELDSQPGKEPT-----YTV 438

Query: 480 SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKI 539
            F   + EIL+ N+  Q+    P   ++PPA + +PL ++ +E  L   T ISKE + +I
Sbjct: 439 CFPNSLEEILNTNKELQRRKHQPL-PLVPPALKNIPLNSDLNEQHLATLTNISKEVMDRI 497

Query: 540 IKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLM 599
           I +QS G  ++NR+  QQ+EL RQ++  + I S+ + L++   A + +  + + R  +L 
Sbjct: 498 ILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLK 557

Query: 600 ERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMK 659
           +R   L   L++I  S K  +  +++ E  WF+E++NQ + FN++V     L+ +L+++K
Sbjct: 558 QRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLK 617

Query: 660 KELTRIEAETIKTDEKTQNEWD--ELRKMLEEDSKIIKECNEELMHVSQQL 708
            EL  +  E  + D + +  +D   L+++L+ DSKII EC + L   +++L
Sbjct: 618 NELESL-PEHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAAREL 667

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  233 bits (594), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 210/722 (29%), Positives = 348/722 (48%), Gaps = 87/722 (12%)

Query: 12  IFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFRV 71
           IFQ     S +PS     +N   +   QDNI+R   S  E+ Y+S +     + +   ++
Sbjct: 12  IFQ---EVSLNPSDRLVCNNSNTIYLWQDNILR-VQSDHETQYRSYNVELPFVPE---QM 64

Query: 72  ISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKVL 131
           + S SG L+ F    E++VMEV       E++ ++   + F+ S+G         IKK+L
Sbjct: 65  VISPSGGLVAFHANSELYVMEVN------EQSRLR---KHFNTSLG---------IKKLL 106

Query: 132 FHPKSYHDSCIVVLKEDDTITMFDILNQQHKPI-VLNKRSNSFGLDARVNDITDLAFSRD 190
           +HP + +    V+L +D TI ++D+ + + + I V N++S SFGL   V  + D+AF   
Sbjct: 107 WHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPT 166

Query: 191 GLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLG-------------WILNKSLVMYESL 237
           GLTLY L++    D++A +P LP    L   D               ++L+KSL +Y SL
Sbjct: 167 GLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSL 226

Query: 238 D------STTD-------ITVKRNIIKQLQLVSKLHEN--LDSQLGKVEIDEEYRLVKMQ 282
           D      S +D       +T+K +++KQ+Q      +N  +D+   K       R    Q
Sbjct: 227 DKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKA-----IRNSVPQ 281

Query: 283 GPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNY 342
           GPF I  FP  L       +T IP+      ++ + F DG+  +LF D E+ MSW + + 
Sbjct: 282 GPFIIKKFPTALNAKEVTGLTIIPVGERLG-LLNLQFIDGTNVVLFSDSEIVMSWSLRSN 340

Query: 343 VHNNSLVLIERIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESD 402
              N+L +I     +       + L     KL VF+ +S   +    W   L++CI   D
Sbjct: 341 TTFNNLSVITMFNAK----GQCQLLNSSEPKL-VFTGDSSTTIMEMPWLEPLAQCIRLHD 395

Query: 403 LNALGDVKFESKLENI--VTIEHPSNLAY-ISWNDTSNLVLTARGKLTFQNISNDKELQT 459
            + + DVKFE+K+  +    +   S L+  I +N  S  V+ +  K T Q   N    +T
Sbjct: 396 FSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPIN----RT 451

Query: 460 TKFDANNKSDRIDAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNE 519
            +     K     +GK  +M  T+   E            IS     IP +   +PLKN 
Sbjct: 452 DEVKYTYKPSLPTSGKELDMLLTKYKTE--------ANGFISG----IPDSLAPLPLKNN 499

Query: 520 ASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQE 579
           ++E QLE+ + + KE ++++   Q + F ++N+  E+  EL RQL+ T++I      L  
Sbjct: 500 SNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNG 559

Query: 580 KLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQIL 639
            LG   +++     +   L +R  KL E  S I  ++KLR  +I+  E+ WFK I+NQ+L
Sbjct: 560 NLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVL 619

Query: 640 QFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNE 699
           +FNN+V     L+++L ++    T++ + T   D  ++ E+  L++ML  D K+I  C  
Sbjct: 620 KFNNYVHLTNKLREELEFLD---TQLRSTTKGDDFFSELEFSSLQQMLLNDKKVINSCMN 676

Query: 700 EL 701
           EL
Sbjct: 677 EL 678

>CAGL0J01221g Chr10 (115478..116533) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q03151 Saccharomyces cerevisiae YMR097c
          Length = 351

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 12/69 (17%)

Query: 595 QVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQD 654
           QVK +++FKKL+  L+ + E + +R               RN I  F+N +RS +SL++ 
Sbjct: 31  QVKAIKKFKKLSPGLNMLIELRDIRAP----------LSTRNVI--FDNILRSNRSLERL 78

Query: 655 LSYMKKELT 663
           + Y KK++T
Sbjct: 79  VVYTKKDMT 87

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 9/115 (7%)

Query: 176 DARVNDITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYE 235
           +A++ND+    F  D + L C N+TE          LPP L  G++ L W  N  L +  
Sbjct: 280 EAKMNDLISTIFGDDYIQLSC-NSTECLHYSQVPGYLPPDLKHGQRKLSWTFNLLLTLII 338

Query: 236 SLDSTTDITVKRNIIKQLQLVSKLHENLDSQLGKVEID---EEYRLVKMQGPFTI 287
            +  ++   +  NI K     S    N+ + +G+ +++   ++Y  +K   P T+
Sbjct: 339 LILGSSFYYITNNISK-----SPFFTNITTAIGQNQVELPNDQYDFLKNDIPATL 388

>TDEL0H01030 Chr8 (177680..179890) [2211 bp, 736 aa] {ON} Anc_1.221
           YJL132W
          Length = 736

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 217 LLGEKDLGWILNKSLVMYESLDSTTDITVKRNIIKQLQLVSKLHENLDSQLGKVEID 273
           L GE DL  +L K L +Y++L  T   ++ +N I+Q+QL   L   L S  G + ID
Sbjct: 254 LGGEFDLIAMLQKCLPVYQNLFDTN--SLDQNSIRQIQLCGNLPNTLSSSHGALRID 308

>Kwal_26.7448 s26 complement(369897..372041) [2145 bp, 714 aa] {ON}
           [contig 51] FULL
          Length = 714

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 15/71 (21%)

Query: 259 LHENLDSQLGK--------VEIDEEYRLVKMQGPFTI-NPFPDELYEYT-----AANITT 304
           + ENL+  LG         +   E  R V MQ  FTI NPFPD+L++Y      A NI  
Sbjct: 488 IFENLEESLGPFAEYSIRLLSFMERRRHV-MQNFFTIENPFPDDLHKYRFESRQAVNIKE 546

Query: 305 IPIDNMQNEIV 315
             I +++NE++
Sbjct: 547 KHIRSLRNELI 557

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 21/139 (15%)

Query: 336 SWDVDNYVHNNSLV-LIERIKIQETDIKSLKTLPEELGKLYVFSENS--VHQLDSTNWSA 392
           +W++D   H+N +  +++++ I E D++S +  PE     +VF ++      ++ TNW  
Sbjct: 117 AWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPE-----FVFPQDQDFDRMINMTNWDL 171

Query: 393 IL---SRCIEESDLNALGDVKFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQ 449
            L   S    +++       K  S    I +I H            S   L  +G +T +
Sbjct: 172 FLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILH----------QFSPYSLQPKGPITLE 221

Query: 450 NISNDKELQTTKFDANNKS 468
            + +   L+ T +  +NKS
Sbjct: 222 GLKSMAALRYTLYPFHNKS 240

>ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR186C
          Length = 1562

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 7/64 (10%)

Query: 254 QLVSKLHENLDSQLGKVEIDEEYRLVKMQGPF----TINPFPDELYEYTA-ANITTIPID 308
           +LV  +H N+D+  GK+E+  +  L + QGP     +IN  P+ L       N++T+ + 
Sbjct: 473 KLVDDMHHNMDNGSGKLEV--QALLQQRQGPVRSETSINGMPESLNSRNPMGNLSTMSLA 530

Query: 309 NMQN 312
           NM N
Sbjct: 531 NMNN 534

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,568,474
Number of extensions: 3543774
Number of successful extensions: 17675
Number of sequences better than 10.0: 609
Number of HSP's gapped: 18286
Number of HSP's successfully gapped: 820
Length of query: 716
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 599
Effective length of database: 40,065,477
Effective search space: 23999220723
Effective search space used: 23999220723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)