Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Sklu_YGOB_MFA2na 1ON33331692e-18
Kthe_YGOB_MFA1na 2ON33321261e-11
Kwal_YGOB_MFA1na 2ON33321242e-11
Sklu_YGOB_MFA1na 3ON33321156e-10
Klac_YGOB_MFA1na 1ON33321139e-10
NCAS0B05140singletonON34331122e-09
TBLA0J00550singletonON34341112e-09
TBLA0B04930singletonON34331086e-09
NDAI0K011702.114ON34331061e-08
NDAI0B044702.114ON34331061e-08
NDAI0K01420singletonON34331061e-08
NCAS0G021802.114ON34331061e-08
TBLA0A01280singletonON34331033e-08
Ecym_4022na 3ON34331034e-08
ABL196Cna 3ON33331026e-08
Kpol_1039.70na 4ON33331018e-08
Kpol_1039.70bsingletonON33331018e-08
TPHA0I012802.114ON3433982e-07
TPHA0I01275na 4ON3433982e-07
Ecym_6479singletonON3431982e-07
YNL145W (MFA2)2.114ON3837982e-07
Kpol_1039.70a2.114ON3332972e-07
CAGL0C01919gsingletonON3433964e-07
TBLA0A02390singletonON3434956e-07
Suva_14.1942.114ON3837948e-07
TBLA0A01750singletonON3434931e-06
Skud_14.1872.114ON3837931e-06
YDR461W (MFA1)na 5ON3636887e-06
Smik_14.1822.114ON3837871e-05
Skud_4.736na 5ON3635862e-05
Smik_4.739na 5ON3635852e-05
KAFR0K02130singletonON3534842e-05
KAFR0F005802.114ON3534842e-05
Suva_2.636na 5ON3636825e-05
NCAS0B071402.114ON3434825e-05
Klac_YGOB_MFA2singletonON3232801e-04
TDEL0B047802.114ON3433757e-04
NCAS0F01250singletonON3536690.006
NCAS0B01270singletonON3535630.041
AER097C4.293ON58228650.087
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_YGOB_MFA2
         (33 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON} ANNO...    70   2e-18
Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON} ANNO...    53   1e-11
Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa] {O...    52   2e-11
Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON} ANNO...    49   6e-10
Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]...    48   9e-10
NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}       48   2e-09
TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}      47   2e-09
TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa] {O...    46   6e-09
NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}                45   1e-08
NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}               45   1e-08
NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}                45   1e-08
NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}       45   1e-08
TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON}                 44   3e-08
Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON} sim...    44   4e-08
ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON} Non-s...    44   6e-08
Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa] {O...    44   8e-08
Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa] {...    44   8e-08
TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}...    42   2e-07
TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}       42   2e-07
Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to ...    42   2e-07
YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating ...    42   2e-07
Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa] {...    42   2e-07
CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON...    42   4e-07
TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON}                 41   6e-07
Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W ...    41   8e-07
TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON}                 40   1e-06
Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W ...    40   1e-06
YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating...    39   7e-06
Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W ...    38   1e-05
Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W ...    38   2e-05
Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W ...    37   2e-05
KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}      37   2e-05
KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}...    37   2e-05
Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W ...    36   5e-05
NCAS0B07140 Chr2 (1356259..1356363) [105 bp, 34 aa] {ON}               36   5e-05
Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON} ANNOT...    35   1e-04
TDEL0B04780 Chr2 complement(846043..846147) [105 bp, 34 aa] {ON}...    33   7e-04
NCAS0F01250 Chr6 complement(245664..245771) [108 bp, 35 aa] {ON}       31   0.006
NCAS0B01270 Chr2 (212581..212688) [108 bp, 35 aa] {ON}                 29   0.041
AER097C Chr5 complement(823125..824873) [1749 bp, 582 aa] {ON} S...    30   0.087

>Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 69.7 bits (169), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII 33
          MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII
Sbjct: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII 33

>Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 53.1 bits (126), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (87%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          M P + ATQKDS+ENKDNWI +GLAW+PQCVI
Sbjct: 1  MPPITQATQKDSSENKDNWIQKGLAWDPQCVI 32

>Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 33

 Score = 52.4 bits (124), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 23/32 (71%), Positives = 28/32 (87%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          MQP + ATQ DS++NKDNWI +GLAW+PQCVI
Sbjct: 1  MQPIAQATQNDSSDNKDNWIHKGLAWDPQCVI 32

>Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 48.9 bits (115), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          M+  ++ATQK S E+K+NWII+G AW+PQC+I
Sbjct: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCII 32

>Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB - similar to Scer MFA1 pheromone
          Length = 33

 Score = 48.1 bits (113), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 24/32 (75%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          MQP   A+Q +SAENK+NWII G  W PQCV+
Sbjct: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVV 32

>NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 47.8 bits (112), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 28/33 (84%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP + A+QKD +AENKDN+I++GL W+P CVI
Sbjct: 1  MQPSAQASQKDNTAENKDNYIVKGLFWDPACVI 33

>TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}
          
          Length = 34

 Score = 47.4 bits (111), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 28/34 (82%), Gaps = 1/34 (2%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVII 33
          MQP + AT+KD S+ENKDN+I+ GL W+P C+I+
Sbjct: 1  MQPTTQATRKDNSSENKDNYIVPGLFWDPACIIV 34

>TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa]
          {ON} 
          Length = 34

 Score = 46.2 bits (108), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 27/33 (81%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP + ATQK+ S+ENKDN+II GL W+P C+I
Sbjct: 1  MQPTTQATQKENSSENKDNYIIPGLFWDPACII 33

>NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 27/33 (81%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP + AT+KD S+E KDN+I++GL W+P CVI
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVI 33

>NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 27/33 (81%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP + AT+KD S+E KDN+I++GL W+P CVI
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVI 33

>NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 27/33 (81%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKDSA-ENKDNWIIEGLAWNPQCVI 32
          MQP + AT+KDS+ E +DN+I++GL W+P CVI
Sbjct: 1  MQPSTEATKKDSSFEKRDNYIVKGLFWDPACVI 33

>NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP + AT KD SAE +DN+I++GL W+P CVI
Sbjct: 1  MQPTTQATHKDNSAEKQDNYIVKGLFWDPACVI 33

>TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 44.3 bits (103), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQ  + ATQKD S+ENKDN+I+ GL W+P C+I
Sbjct: 1  MQSTTQATQKDNSSENKDNYIVPGLFWDPACII 33

>Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON}
          similar to Ashbya gossypii ABL196C MFa2
          Length = 34

 Score = 44.3 bits (103), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 28/33 (84%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKDS-AENKDNWIIEGLAWNPQCVI 32
          MQP ++A+Q ++ ++ KDNWI++G AWNPQCVI
Sbjct: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVI 33

>ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YNL145W (MFA2)
          Length = 33

 Score = 43.9 bits (102), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII 33
          MQ  +N  + +S ENKDNWI +G  W PQCVI+
Sbjct: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33

>Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa]
          {ON} complement(186672..186773) [102 nt, 34 aa]
          Length = 33

 Score = 43.5 bits (101), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 26/33 (78%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII 33
          MQ  + A QK+S+E KDN+I++G  W+P+CVI+
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIV 33

>Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa]
          {ON} complement(189037..189138) [102 nt, 34 aa]
          Length = 33

 Score = 43.5 bits (101), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 26/33 (78%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVII 33
          MQ  + A QK+S+E KDN+I++G  W+P+CVI+
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIV 33

>TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 27/33 (81%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKDS-AENKDNWIIEGLAWNPQCVI 32
          MQP + A +KD+ +E KDN+I++G+ W+P+CVI
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVI 33

>TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 27/33 (81%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKDS-AENKDNWIIEGLAWNPQCVI 32
          MQP + A +KD+ +E KDN+I++G+ W+P+CVI
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVI 33

>Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to
          Ashbya gossypii ABL196C
          Length = 34

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 2  QPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          Q   +  Q   +ENKD+WII+G  WNPQCVI
Sbjct: 3  QHSKDGNQNGESENKDHWIIKGFVWNPQCVI 33

>YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA1
          Length = 38

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (72%), Gaps = 5/37 (13%)

Query: 1  MQP----KSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP     + ATQKD S+E KDN+II+GL W+P CVI
Sbjct: 1  MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVI 37

>Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa]
          {ON} complement(187909..188010) [102 nt, 34 aa]
          Length = 33

 Score = 42.0 bits (97), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 25/32 (78%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          MQ  + A QK+S+E KDN+I++G  W+P+CVI
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVI 32

>CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON}
          highly similar to uniprot|P34166 Saccharomyces
          cerevisiae YNL145w MFA2
          Length = 34

 Score = 41.6 bits (96), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP   ATQKD + E +DN+I++G  W+P CVI
Sbjct: 1  MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVI 33

>TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 41.2 bits (95), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVII 33
          MQ  + A QK+ S+ENKDN+II GL W+P C+I+
Sbjct: 1  MQYNAQAGQKETSSENKDNYIIPGLFWDPACIIV 34

>Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 40.8 bits (94), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 5/37 (13%)

Query: 1  MQP----KSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP     + A+QKD S+E KDN+II+GL W+P CVI
Sbjct: 1  MQPVATVSAQASQKDKSSEKKDNYIIKGLFWDPACVI 37

>TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 40.4 bits (93), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVII 33
          MQ     TQK+ S+ENKDN+II GL W+P C+I+
Sbjct: 1  MQYNIQTTQKENSSENKDNYIIPGLFWDPACIIV 34

>Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 40.4 bits (93), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 5/37 (13%)

Query: 1  MQPKSN----ATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP +     A+QKD S+E KDN+II+GL W+P CVI
Sbjct: 1  MQPTATVSAQASQKDRSSEKKDNFIIKGLFWDPACVI 37

>YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA2
          Length = 36

 Score = 38.5 bits (88), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 26/36 (72%), Gaps = 5/36 (13%)

Query: 1  MQPKSNAT----QKDSAENKDNWIIEGLAWNPQCVI 32
          MQP S AT    +K S+E KDN+II+G+ W+P CVI
Sbjct: 1  MQP-STATAAPKEKTSSEKKDNYIIKGVFWDPACVI 35

>Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 38.1 bits (87), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 5/37 (13%)

Query: 1  MQP----KSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP     + A QK+ S+E KDN+II+GL W+P CVI
Sbjct: 1  MQPITTTSAQAAQKNKSSEKKDNYIIKGLFWDPACVI 37

>Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 37.7 bits (86), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 3/35 (8%)

Query: 1  MQPKS-NATQKD--SAENKDNWIIEGLAWNPQCVI 32
          MQP +  A  KD  S+E KDN+II+G+ W+P CVI
Sbjct: 1  MQPSTITAAPKDKTSSEKKDNYIIKGVFWDPACVI 35

>Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 37.4 bits (85), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 3/35 (8%)

Query: 1  MQPKS-NATQKD--SAENKDNWIIEGLAWNPQCVI 32
          MQP +  A  KD  + ENKDN+II+G+ W+P CVI
Sbjct: 1  MQPSTITAAPKDKTNTENKDNYIIKGVFWDPACVI 35

>KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}
          
          Length = 35

 Score = 37.0 bits (84), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 2/34 (5%)

Query: 1  MQPKS-NATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP S +ATQKD S+E KDN+++    W+P CVI
Sbjct: 1  MQPTSTSATQKDNSSEKKDNYMVSSGVWDPVCVI 34

>KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}
          Anc_2.114 YNL145W
          Length = 35

 Score = 37.0 bits (84), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 2/34 (5%)

Query: 1  MQPKS-NATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP S +ATQKD S+E KDN+++    W+P CVI
Sbjct: 1  MQPTSTSATQKDNSSEKKDNYMVSSGVWDPVCVI 34

>Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 36.2 bits (82), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 4/36 (11%)

Query: 1  MQPKSNAT----QKDSAENKDNWIIEGLAWNPQCVI 32
          MQP +  +     K S E KDN+II+G+ W+P C+I
Sbjct: 1  MQPITTVSAAPKDKTSTEKKDNYIIKGVFWDPACII 36

>NCAS0B07140 Chr2 (1356259..1356363) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 36.2 bits (82), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVII 33
          MQP + ATQKD SAENKDN  +     N  CVI+
Sbjct: 1  MQPSTQATQKDTSAENKDNDFVFNCLSNISCVIV 34

>Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 32

 Score = 35.4 bits (80), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32
          M+ K+ A Q  + E+ D+W+  GL WNP+C+I
Sbjct: 1  MEDKAQA-QTRTHESSDHWVFPGLTWNPKCII 31

>TDEL0B04780 Chr2 complement(846043..846147) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 33.5 bits (75), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 1  MQPKSNATQKD-SAENKDNWIIEGLAWNPQCVI 32
          MQP + AT+KD S+E KDN+++ G      CVI
Sbjct: 1  MQPTTQATKKDTSSEKKDNFMLGGSTSYYGCVI 33

>NCAS0F01250 Chr6 complement(245664..245771) [108 bp, 35 aa] {ON}
          Length = 35

 Score = 31.2 bits (69), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 25/36 (69%), Gaps = 4/36 (11%)

Query: 1  MQPKSNATQKD-SAENKD--NWIIEGLAWNPQCVII 33
          MQP + ATQKD +AENKD  N +I  L+ N  CVI+
Sbjct: 1  MQPSTQATQKDNTAENKDNHNMVINCLS-NICCVIV 35

>NCAS0B01270 Chr2 (212581..212688) [108 bp, 35 aa] {ON}
          Length = 35

 Score = 28.9 bits (63), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 2/35 (5%)

Query: 1  MQPKSNATQKD-SAENKDNW-IIEGLAWNPQCVII 33
          MQP ++A QKD S E KDN+ ++     N  CVI+
Sbjct: 1  MQPSTHAAQKDNSEEKKDNFDLVINCLSNVSCVIV 35

>AER097C Chr5 complement(823125..824873) [1749 bp, 582 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL191W
           (DPH2)
          Length = 582

 Score = 29.6 bits (65), Expect = 0.087,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 4   KSNATQKDSAENKDNWIIEGLAWNPQCV 31
           K+ A  KDSA+ +  WI+   A++P CV
Sbjct: 119 KTCADSKDSADGRKIWILADTAYSPCCV 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,906,439
Number of extensions: 69405
Number of successful extensions: 199
Number of sequences better than 10.0: 40
Number of HSP's gapped: 193
Number of HSP's successfully gapped: 40
Length of query: 33
Length of database: 53,481,399
Length adjustment: 8
Effective length of query: 25
Effective length of database: 52,564,071
Effective search space: 1314101775
Effective search space used: 1314101775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)