Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Sklu_YGOB_MFA1na 1ON33331729e-19
Kthe_YGOB_MFA1na 2ON33331225e-11
Sklu_YGOB_MFA2na 3ON33321156e-10
Kpol_1039.70a2.114ON33331112e-09
Kwal_YGOB_MFA1na 2ON33331103e-09
Klac_YGOB_MFA1na 3ON33331086e-09
Kpol_1039.70na 4ON33331077e-09
Kpol_1039.70bsingletonON33331077e-09
Ecym_4022na 1ON34341061e-08
Ecym_6479singletonON34271034e-08
TBLA0A01280singletonON34341017e-08
TBLA0B04930singletonON34341009e-08
YNL145W (MFA2)2.114ON3832991e-07
NDAI0K011702.114ON3434973e-07
NDAI0B044702.114ON3434973e-07
NCAS0B05140singletonON3434956e-07
ABL196Cna 1ON3333957e-07
NDAI0K01420singletonON3434948e-07
CAGL0C01919gsingletonON3434921e-06
TBLA0J00550singletonON3434921e-06
TPHA0I012802.114ON3434912e-06
TPHA0I01275na 4ON3434912e-06
NCAS0G021802.114ON3434894e-06
Smik_14.1822.114ON3831887e-06
Suva_14.1942.114ON3831887e-06
Smik_4.739na 5ON3624888e-06
YDR461W (MFA1)na 5ON3625888e-06
TBLA0A01750singletonON3434871e-05
Skud_14.1872.114ON3831861e-05
Suva_2.636na 5ON3623861e-05
Skud_4.736na 5ON3624852e-05
TBLA0A02390singletonON3434826e-05
KAFR0K02130singletonON3531792e-04
KAFR0F005802.114ON3531792e-04
Klac_YGOB_MFA2singletonON3225650.020
Zrou_YGOB_MFA12.114ON3428650.021
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_YGOB_MFA1
         (33 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON} ANNO...    71   9e-19
Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON} ANNO...    52   5e-11
Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON} ANNO...    49   6e-10
Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa] {...    47   2e-09
Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa] {O...    47   3e-09
Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]...    46   6e-09
Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa] {O...    46   7e-09
Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa] {...    46   7e-09
Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON} sim...    45   1e-08
Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to ...    44   4e-08
TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON}                 44   7e-08
TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa] {O...    43   9e-08
YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating ...    43   1e-07
NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}                42   3e-07
NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}               42   3e-07
NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}       41   6e-07
ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON} Non-s...    41   7e-07
NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}                41   8e-07
CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON...    40   1e-06
TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}      40   1e-06
TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}...    40   2e-06
TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}       40   2e-06
NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}       39   4e-06
Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W ...    39   7e-06
Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W ...    39   7e-06
Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W ...    39   8e-06
YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating...    39   8e-06
TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON}                 38   1e-05
Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W ...    38   1e-05
Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W ...    38   1e-05
Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W ...    37   2e-05
TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON}                 36   6e-05
KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}      35   2e-04
KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}...    35   2e-04
Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON} ANNOT...    30   0.020
Zrou_YGOB_MFA1 Chr7 complement(448893..448997) [105 bp, 34 aa] {...    30   0.021

>Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 70.9 bits (172), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA
Sbjct: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33

>Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 51.6 bits (122), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 22/33 (66%), Positives = 26/33 (78%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M   T ATQK S+E+K+NWI KG AWDPQC+IA
Sbjct: 1  MPPITQATQKDSSENKDNWIQKGLAWDPQCVIA 33

>Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 48.9 bits (115), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCII 32
          M+  ++ATQK S E+K+NWII+G AW+PQC+I
Sbjct: 1  MQPKSNATQKDSAENKDNWIIEGLAWNPQCVI 32

>Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa]
          {ON} complement(187909..188010) [102 nt, 34 aa]
          Length = 33

 Score = 47.4 bits (111), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 28/33 (84%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M++ T+A QK S+E K+N+I+KG+ WDP+C+IA
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIA 33

>Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 33

 Score = 47.0 bits (110), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 25/33 (75%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M+    ATQ  S+++K+NWI KG AWDPQC+IA
Sbjct: 1  MQPIAQATQNDSSDNKDNWIHKGLAWDPQCVIA 33

>Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB - similar to Scer MFA1 pheromone
          Length = 33

 Score = 46.2 bits (108), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M+    A+Q  S E+KENWII GF W PQC++A
Sbjct: 1  MQPTQQASQNESAENKENWIIPGFVWVPQCVVA 33

>Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa]
          {ON} complement(186672..186773) [102 nt, 34 aa]
          Length = 33

 Score = 45.8 bits (107), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 27/33 (81%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M++ T+A QK S+E K+N+I+KG+ WDP+C+I 
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIV 33

>Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa]
          {ON} complement(189037..189138) [102 nt, 34 aa]
          Length = 33

 Score = 45.8 bits (107), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 27/33 (81%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M++ T+A QK S+E K+N+I+KG+ WDP+C+I 
Sbjct: 1  MQSTTYAAQKNSSEKKDNYIVKGWFWDPECVIV 33

>Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON}
          similar to Ashbya gossypii ABL196C MFa2
          Length = 34

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 29/34 (85%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQKGS-TEDKENWIIKGFAWDPQCIIA 33
          M+ AT A+Q  + +++K+NWI+KG+AW+PQC+IA
Sbjct: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34

>Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to
          Ashbya gossypii ABL196C
          Length = 34

 Score = 44.3 bits (103), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 22/27 (81%)

Query: 7  ATQKGSTEDKENWIIKGFAWDPQCIIA 33
            Q G +E+K++WIIKGF W+PQC+IA
Sbjct: 8  GNQNGESENKDHWIIKGFVWNPQCVIA 34

>TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 43.5 bits (101), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M++ T ATQK  S+E+K+N+I+ G  WDP CIIA
Sbjct: 1  MQSTTQATQKDNSSENKDNYIVPGLFWDPACIIA 34

>TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa]
          {ON} 
          Length = 34

 Score = 43.1 bits (100), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+  T ATQK  S+E+K+N+II G  WDP CIIA
Sbjct: 1  MQPTTQATQKENSSENKDNYIIPGLFWDPACIIA 34

>YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA1
          Length = 38

 Score = 42.7 bits (99), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 1/32 (3%)

Query: 3  AATHATQKG-STEDKENWIIKGFAWDPQCIIA 33
          A+T ATQK  S+E K+N+IIKG  WDP C+IA
Sbjct: 7  ASTQATQKDKSSEKKDNYIIKGLFWDPACVIA 38

>NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 42.0 bits (97), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+ +T AT+K  S+E K+N+I+KG  WDP C+IA
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 42.0 bits (97), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+ +T AT+K  S+E K+N+I+KG  WDP C+IA
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 41.2 bits (95), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQKGST-EDKENWIIKGFAWDPQCIIA 33
          M+ +  A+QK +T E+K+N+I+KG  WDP C+IA
Sbjct: 1  MQPSAQASQKDNTAENKDNYIVKGLFWDPACVIA 34

>ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YNL145W (MFA2)
          Length = 33

 Score = 41.2 bits (95), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 1  MKAATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          M+   +  +  STE+K+NWI KG+ W PQC+I 
Sbjct: 1  MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV 33

>NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 40.8 bits (94), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQKGST-EDKENWIIKGFAWDPQCIIA 33
          M+ +T AT+K S+ E ++N+I+KG  WDP C+IA
Sbjct: 1  MQPSTEATKKDSSFEKRDNYIVKGLFWDPACVIA 34

>CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON}
          highly similar to uniprot|P34166 Saccharomyces
          cerevisiae YNL145w MFA2
          Length = 34

 Score = 40.0 bits (92), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQKGSTEDK-ENWIIKGFAWDPQCIIA 33
          M+    ATQK +T++K +N+I+KGF W P C+IA
Sbjct: 1  MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA 34

>TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}
          
          Length = 34

 Score = 40.0 bits (92), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+  T AT+K  S+E+K+N+I+ G  WDP CII 
Sbjct: 1  MQPTTQATRKDNSSENKDNYIVPGLFWDPACIIV 34

>TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 39.7 bits (91), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQKGST-EDKENWIIKGFAWDPQCIIA 33
          M+  T A +K +T E K+N+I+KG  WDP+C+IA
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA 34

>TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 39.7 bits (91), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQKGST-EDKENWIIKGFAWDPQCIIA 33
          M+  T A +K +T E K+N+I+KG  WDP+C+IA
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA 34

>NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 38.9 bits (89), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+  T AT K  S E ++N+I+KG  WDP C+IA
Sbjct: 1  MQPTTQATHKDNSAEKQDNYIVKGLFWDPACVIA 34

>Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 38.5 bits (88), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 3  AATHATQKGSTEDKENWIIKGFAWDPQCIIA 33
          +A  A +  S+E K+N+IIKG  WDP C+IA
Sbjct: 8  SAQAAQKNKSSEKKDNYIIKGLFWDPACVIA 38

>Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 38.5 bits (88), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 4  ATHATQKG-STEDKENWIIKGFAWDPQCIIA 33
          +  A+QK  S+E K+N+IIKG  WDP C+IA
Sbjct: 8  SAQASQKDKSSEKKDNYIIKGLFWDPACVIA 38

>Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 38.5 bits (88), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 20/24 (83%)

Query: 10 KGSTEDKENWIIKGFAWDPQCIIA 33
          K +TE+K+N+IIKG  WDP C+IA
Sbjct: 13 KTNTENKDNYIIKGVFWDPACVIA 36

>YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA2
          Length = 36

 Score = 38.5 bits (88), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 20/25 (80%)

Query: 9  QKGSTEDKENWIIKGFAWDPQCIIA 33
          +K S+E K+N+IIKG  WDP C+IA
Sbjct: 12 EKTSSEKKDNYIIKGVFWDPACVIA 36

>TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 38.1 bits (87), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+     TQK  S+E+K+N+II G  WDP CII 
Sbjct: 1  MQYNIQTTQKENSSENKDNYIIPGLFWDPACIIV 34

>Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 4  ATHATQKG-STEDKENWIIKGFAWDPQCIIA 33
          +  A+QK  S+E K+N+IIKG  WDP C+IA
Sbjct: 8  SAQASQKDRSSEKKDNFIIKGLFWDPACVIA 38

>Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 37.7 bits (86), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 18/23 (78%)

Query: 10 KGSTEDKENWIIKGFAWDPQCII 32
          K STE K+N+IIKG  WDP CII
Sbjct: 14 KTSTEKKDNYIIKGVFWDPACII 36

>Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 37.4 bits (85), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 10 KGSTEDKENWIIKGFAWDPQCIIA 33
          K S+E K+N+IIKG  WDP C+IA
Sbjct: 13 KTSSEKKDNYIIKGVFWDPACVIA 36

>TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 36.2 bits (82), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 1  MKAATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          M+    A QK  S+E+K+N+II G  WDP CII 
Sbjct: 1  MQYNAQAGQKETSSENKDNYIIPGLFWDPACIIV 34

>KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}
          
          Length = 35

 Score = 35.0 bits (79), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 4  ATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          +T ATQK  S+E K+N+++    WDP C+IA
Sbjct: 5  STSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}
          Anc_2.114 YNL145W
          Length = 35

 Score = 35.0 bits (79), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 4  ATHATQK-GSTEDKENWIIKGFAWDPQCIIA 33
          +T ATQK  S+E K+N+++    WDP C+IA
Sbjct: 5  STSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 32

 Score = 29.6 bits (65), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 9  QKGSTEDKENWIIKGFAWDPQCIIA 33
          Q  + E  ++W+  G  W+P+CII+
Sbjct: 8  QTRTHESSDHWVFPGLTWNPKCIIS 32

>Zrou_YGOB_MFA1 Chr7 complement(448893..448997) [105 bp, 34 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 34

 Score = 29.6 bits (65), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 6  HATQKGSTEDKENWIIKGFAWDPQCIIA 33
           AT+K ++ DK++  + G  +DP C+IA
Sbjct: 7  QATKKDNSSDKKDNFMLGSNYDPACVIA 34

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.127    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,611,451
Number of extensions: 55434
Number of successful extensions: 149
Number of sequences better than 10.0: 36
Number of HSP's gapped: 149
Number of HSP's successfully gapped: 36
Length of query: 33
Length of database: 53,481,399
Length adjustment: 8
Effective length of query: 25
Effective length of database: 52,564,071
Effective search space: 1314101775
Effective search space used: 1314101775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)