Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Sklu_YGOB_Anc_6.66.6ON61613141e-39
Klac_YGOB_Anc_6.66.6ON61612508e-30
Kthe_YGOB_Anc_6.66.6ON62612316e-27
Kwal_56.223336.6ON62622255e-26
TDEL0G046506.6ON62622152e-24
Kpol_1045.826.6ON62622152e-24
ZYRO0F00418g6.6ON62602031e-22
KAFR0B064906.6ON66611952e-21
Suva_16.346.6ON62621934e-21
TBLA0A072006.6ON65621926e-21
Skud_16.66.6ON62621919e-21
CAGL0A01111g6.6ON69611873e-20
Smik_6.4796.6ON62621855e-20
YPL271W (ATP15)6.6ON62621813e-19
NDAI0I027406.6ON66591804e-19
TPHA0J002306.6ON62601796e-19
KNAG0E027906.6ON65631701e-17
Ecym_30086.6ON61611682e-17
NCAS0D022006.6ON85601651e-16
ACR021W6.6ON62621465e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_YGOB_Anc_6.6
         (61 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...   125   1e-39
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...   100   8e-30
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    94   6e-27
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    91   5e-26
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    87   2e-24
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    87   2e-24
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    83   1e-22
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    80   2e-21
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    79   4e-21
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    79   6e-21
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       78   9e-21
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    77   3e-20
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    76   5e-20
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    74   3e-19
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    74   4e-19
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    74   6e-19
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    70   1e-17
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    69   2e-17
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    68   1e-16
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    61   5e-14

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score =  125 bits (314), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK 60
          MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score =  100 bits (250), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (86%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK 60
          MS WRKAGLT+NNY+S+AA TVRAALK E QT  VL+RSKSEAKFIKFENG  S+P+PLK
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVASEPVPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 93.6 bits (231), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 54/61 (88%), Gaps = 1/61 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59
          MSAWRKAGLTYNNY++IAA+TVR+ALK + QTAQVL RSK+EA+FIK+E GTP ++  PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 60 K 60
          K
Sbjct: 61 K 61

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 91.3 bits (225), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (88%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPS-DPIPL 59
          MSAWRKAGLTYNNY++IAA+TVR+ALK E QTA+VL RSK+EA+F+K+ENGT + +  PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 60 KK 61
          K+
Sbjct: 61 KE 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 54/62 (87%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGT-PSDPIPL 59
          M+AWRKAGLTYN YLS+AA+TVRAALK E Q A+VL+RSK++A+++K+E G+  SD +PL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 60 KK 61
          ++
Sbjct: 61 QE 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 87.4 bits (215), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59
          MSAWRKAG+TYN Y++IAA+TVR ALK E +T  VL+RSK+EAKF+ FENG P  +P+P+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 60 KK 61
          ++
Sbjct: 61 QQ 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 82.8 bits (203), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 1/60 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59
          MSAWRKAGLTYN YLS+AAKTVR+ALK E QTA VLSR + ++K+ KFE G P  +P PL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 79.7 bits (195), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 48/61 (78%), Gaps = 1/61 (1%)

Query: 2  SAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLK 60
          S WRKAGLTY +YLSIA+KT+R  LKTE+QTA V SRS +EA    ++NG+P SDP PL+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 61 K 61
          K
Sbjct: 63 K 63

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 79.0 bits (193), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 52/62 (83%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGT-PSDPIPL 59
          MSAWRKAG++Y  YL++AA+T+R++LKTE QTA VLSRS+++A + K++NGT  S+P+ +
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 78.6 bits (192), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59
          MSAWRKAG+TYN Y++IAAKTVR ALK E QTA V+ RS +EA+F K+  G+P +DP  L
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 60 KK 61
          K+
Sbjct: 61 KE 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 78.2 bits (191), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENG-TPSDPIPL 59
          MSAWRKAG++Y  YL++AA+T+R++LKTE QTA VLSRSK++A + K++NG   S+P P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 76.6 bits (187), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 50/61 (81%), Gaps = 1/61 (1%)

Query: 2  SAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLK 60
          +AWRKAGL+Y+++L+IAA+TVR +LK E QT  V+ R K++A + K+E G+P SDPIPL+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 61 K 61
          +
Sbjct: 69 E 69

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 50/62 (80%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENG-TPSDPIPL 59
          MSAWRKAG++Y  YL++AAK +R++LKTE QTA VLSRSK++A + +++NG   S+P P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 74.3 bits (181), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 51/62 (82%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGT-PSDPIPL 59
          MSAWRKAG++Y  YL++AA+ +R++LKTE QTA VL+RS+++A + +++NGT  S+P P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 60 KK 61
           K
Sbjct: 61 TK 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 73.9 bits (180), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (1%)

Query: 4  WRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLKK 61
          WRKAG+TY+ YLSIAA+T+RAALK E QTA V++RS ++A F K+++G P S+P  L+K
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 73.6 bits (179), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (76%), Gaps = 1/60 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59
          MS WRKAGLTY+NYL++AAKTVR +LK + +T  VLSRSK++ K+  FE GT  S+P  +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 70.1 bits (170), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 47/63 (74%), Gaps = 2/63 (3%)

Query: 1  MSA-WRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIP 58
          MSA W+KAG+TY  YL++ AKT+R+ALK E QT  VLSR  ++A +  +E GTP +DP P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 59 LKK 61
          L++
Sbjct: 61 LQE 63

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 69.3 bits (168), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 49/61 (80%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTPSDPIPLK 60
          MSAWRKAGL+YN Y+++AA+ VR+ALK E + A VLSRS +EAK I +++G  SD +PLK
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVPLK 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 68.2 bits (165), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 46/60 (76%), Gaps = 1/60 (1%)

Query: 2  SAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLK 60
          +  RKAG+TY  YL +A++T+RA+LKTE QT  V++RS ++A + K+E G+P +DP PL+
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 60.8 bits (146), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 51/62 (82%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFEN-GTPSDPIPL 59
          MSAWRKAGLTYN+YL++AA+TVRAALK E Q+  VL+RS +EAK I + + G+ ++ +PL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 60 KK 61
          +K
Sbjct: 61 RK 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.124    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,736,179
Number of extensions: 136133
Number of successful extensions: 344
Number of sequences better than 10.0: 21
Number of HSP's gapped: 344
Number of HSP's successfully gapped: 21
Length of query: 61
Length of database: 53,481,399
Length adjustment: 34
Effective length of query: 27
Effective length of database: 49,582,755
Effective search space: 1338734385
Effective search space used: 1338734385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)