Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Sklu_YGOB_Anc_6.20b6.20ON1088108857540.0
Sklu_YGOB_Anc_6.20singletonOFF84984944970.0
Ecym_30246.20ON1079105323510.0
KLTH0C11242g6.20ON1097109122510.0
TDEL0G044906.20ON1093110622400.0
Kwal_56.224246.20ON1089109721760.0
ACR006C6.20ON1071106021130.0
ZYRO0C07810g6.20ON1099110320730.0
Suva_13.1606.20ON1090110019420.0
Smik_13.1576.20ON1090110319220.0
Skud_13.1526.20ON1090109718560.0
KLLA0D01133g6.20ON1067110217630.0
Kpol_1037.256.20ON1105110316460.0
NCAS0H008206.20ON1146115314870.0
CAGL0L07634g6.20ON1130111314440.0
TPHA0J003306.20ON1107111314071e-176
YML002W6.20ON73773313611e-173
KNAG0M011606.20ON1131113213091e-161
NDAI0D008006.20ON1193119111981e-144
TBLA0A072606.20ON1204120611211e-133
KAFR0L004006.20ON9428296832e-74
YML003WsingletonOFF2902845342e-60
TBLA0C062908.876ON50355850.20
Ecym_20996.319ON207161751.8
CAGL0C01309g2.257ON111028772.1
Kwal_23.62186.319ON20295732.9
NDAI0K001708.876ON50655744.0
TDEL0B004508.876ON44455735.7
TBLA0I012402.467ON470109735.7
TBLA0G033808.44ON52774727.5
TDEL0D053603.88ON23674717.7
CAGL0H07755g3.565ON17277698.2
SAKL0B08822g3.401ON237678728.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Sklu_YGOB_Anc_6.20b
         (1088 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...  2221   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...  1736   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   910   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   871   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   867   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   842   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   818   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   803   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   752   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   744   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   719   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   683   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   638   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   577   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   560   0.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   546   e-176
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   528   e-173
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   508   e-161
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   466   e-144
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   436   e-133
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   267   2e-74
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   210   2e-60
TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa] ...    37   0.20 
Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON} ...    33   1.8  
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    34   2.1  
Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051...    33   2.9  
NDAI0K00170 Chr11 complement(26066..27586) [1521 bp, 506 aa] {ON...    33   4.0  
TDEL0B00450 Chr2 (79835..81169) [1335 bp, 444 aa] {ON} Anc_8.876...    33   5.7  
TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.4...    33   5.7  
TBLA0G03380 Chr7 (898442..900025) [1584 bp, 527 aa] {ON} Anc_8.4...    32   7.5  
TDEL0D05360 Chr4 (971225..971935) [711 bp, 236 aa] {ON} Anc_3.88...    32   7.7  
CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {O...    31   8.2  
SAKL0B08822g Chr2 (752590..759720) [7131 bp, 2376 aa] {ON} simil...    32   8.7  

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score = 2221 bits (5754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1076/1088 (98%), Positives = 1076/1088 (98%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120
            LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180
            TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR
Sbjct: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180

Query: 181  EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240
            EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR
Sbjct: 181  EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240

Query: 241  FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300
            FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE
Sbjct: 241  FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300

Query: 301  KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360
            KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED
Sbjct: 301  KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360

Query: 361  VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420
            VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF
Sbjct: 361  VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420

Query: 421  EDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQK 480
            EDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQK
Sbjct: 421  EDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQK 480

Query: 481  GNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIX 540
            GNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTI 
Sbjct: 481  GNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIN 540

Query: 541  XXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYA 600
                       WKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYA
Sbjct: 541  ELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYA 600

Query: 601  QMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKG 660
            QMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKG
Sbjct: 601  QMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKG 660

Query: 661  LTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTK 720
            LTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTK
Sbjct: 661  LTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTK 720

Query: 721  FGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPID 780
            FGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPID
Sbjct: 721  FGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPID 780

Query: 781  AVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRES 840
            AVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRES
Sbjct: 781  AVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRES 840

Query: 841  GRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCM 900
            GRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCM
Sbjct: 841  GRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCM 900

Query: 901  LFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGK 960
            LFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGK
Sbjct: 901  LFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGK 960

Query: 961  LTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSAQIKSCL 1020
            LTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSAQIKSCL
Sbjct: 961  LTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSAQIKSCL 1020

Query: 1021 ERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKDTMRHFKRSLK 1080
            ERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKDTMRHFKRSLK
Sbjct: 1021 ERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKDTMRHFKRSLK 1080

Query: 1081 NYKEQGYT 1088
            NYKEQGYT
Sbjct: 1081 NYKEQGYT 1088

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score = 1736 bits (4497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 837/849 (98%), Positives = 837/849 (98%)

Query: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
           MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120
           LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 121 TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180
           TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR
Sbjct: 121 TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180

Query: 181 EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240
           EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR
Sbjct: 181 EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240

Query: 241 FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300
           FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE
Sbjct: 241 FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300

Query: 301 KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360
           KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED
Sbjct: 301 KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360

Query: 361 VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420
           VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF
Sbjct: 361 VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420

Query: 421 EDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQK 480
           EDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQK
Sbjct: 421 EDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQK 480

Query: 481 GNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIX 540
           GNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTI 
Sbjct: 481 GNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIN 540

Query: 541 XXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYA 600
                      WKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYA
Sbjct: 541 ELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYA 600

Query: 601 QMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKG 660
           QMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKG
Sbjct: 601 QMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKG 660

Query: 661 LTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTK 720
           LTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTK
Sbjct: 661 LTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTK 720

Query: 721 FGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPID 780
           FGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPID
Sbjct: 721 FGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPID 780

Query: 781 AVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRES 840
           AVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRES
Sbjct: 781 AVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRES 840

Query: 841 GRKRTNVSR 849
           GRKRTNVSR
Sbjct: 841 GRKRTNVSR 849

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1053 (44%), Positives = 680/1053 (64%), Gaps = 19/1053 (1%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPYHLP+LLNPLVN+VFNCPTP+TSPLKK+F +++ QRFIL+VP+ ++LL YQDLD+G  
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120
            L +LCY Y+FVA+HI+I  ++SK ++QE++TLNG +V+IRSQ GIV++    P  R+C++
Sbjct: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSK---PELRKCRV 117

Query: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSLPLSTDLTQR 180
             + E+  NFNDYL    YFPL+HID+PL+   V+NDELQVFG    +  S   + +    
Sbjct: 118  KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISE 177

Query: 181  EVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRHERR 240
                FE+  RL+PQLG +  G F+  RQ I      LD L+  F     + + +I+ ++ 
Sbjct: 178  NHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKN 237

Query: 241  FENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPE 300
            F N+ +L      YVELN+Y+DIW ++ QL    E +    Y+  KYI+++ V T  YPE
Sbjct: 238  FRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPE 297

Query: 301  KQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIED 360
              + F L+ VT  EK + +ATDCF +L+ ++SH+EK KI++ T Q LT   E+   D   
Sbjct: 298  GTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID--- 354

Query: 361  VTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYF 420
             TIDADTLIGLM++V+CRSQVKNLKSHL YL+ F+   + +KFG+  Y+LST+EAVL YF
Sbjct: 355  PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414

Query: 421  EDAENSGKIRSLEFNCRRNKQFWDHL-SCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQ 479
            E  + + K++ L      N+ FWD + S  AVS   L SY++ L  R++  ES LS+CI 
Sbjct: 415  EAGDGTEKLKKLISLSEANRVFWDLIRSGVAVS---LSSYKNSLISRSSNCESSLSICIH 471

Query: 480  KGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTI 539
             G    I+ +L N++ ++ LED+L D     STLL+Q LETG+  +A++L++++  +CT 
Sbjct: 472  AGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTN 531

Query: 540  XXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDY 599
                          RT AHYL Q   + +KIG++ DW  KD++ HTPLF I R+YD   Y
Sbjct: 532  NEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHY 591

Query: 600  AQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKK 659
            ++M++ +F    ++   RGE+F+F+ H+D  GN+LLH+MK  I+ +L Q NI+VN+ N K
Sbjct: 592  SEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIK 651

Query: 660  GLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKT 719
            G+TPLM+Y KYNR++N++ IL D RLI+ K Q    L   DYVKNP+I   +G H A+ +
Sbjct: 652  GMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNS 711

Query: 720  KFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPI 779
             +G + A   +FE+N W+LWIT+K  D    + T++ +++ IQGLLQ Y +++PM+FLPI
Sbjct: 712  LYGLLSADGIKFEDNCWYLWITVKFSD--NSYSTLRQSVKNIQGLLQFYNKKHPMNFLPI 769

Query: 780  DAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRE 839
            D +L  L  IGK G++ V  LE   FL  LT +L +I Q+ E+   L    SDL  W+R 
Sbjct: 770  DHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRT 829

Query: 840  SG-RKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQAR 898
            +  + R N   RIEPEE++SIQSFL+FNLSE S I++K +IL+KL +F  LKAQDI  A+
Sbjct: 830  NNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQ 889

Query: 899  CMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQ 958
             +++ Q   +E  + S    +       +E+ S       I+F+  C   L  KI  +L 
Sbjct: 890  RIIYQQ---MEIVSNSVGPSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLD 946

Query: 959  GKLTRWWKLYAELLDARNQYNKNFPNSVKP---HLDDNKGLFGTYVEGKRSKLEEKLSAQ 1015
             K+T WW+LY EL   R +Y +NFP+  K      +++KG F +Y+EGKR K E+KL A+
Sbjct: 947  SKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQAR 1006

Query: 1016 IKSCLERLQTLTYEVKQEHEALAEELSIYLEFK 1048
            ++ C+ +LQTL+ E+K++HE LAEE+S ++ FK
Sbjct: 1007 LRVCITKLQTLSGELKKDHENLAEEISFFVTFK 1039

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1091 (40%), Positives = 676/1091 (61%), Gaps = 13/1091 (1%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPY+LP+LLNPL+N+VFNCPTP  SPL+K+F  +  QRF LV P   ILL Y+DL++GSS
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120
            LQDLCY+  FV++HI++L       ++E+KTL+GKT+ +R+Q   + TG+GF ++RRC++
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120

Query: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDE---LQVFGVRSTNTSSLPLSTDL 177
              TEL  NFN+Y +GS  +P+IH+D PL     + DE    + +   ST+T+S   S   
Sbjct: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTSANSSLAA 180

Query: 178  TQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRH 237
            +    +S EQ+ R HP  GD+ S + + QR  ++++    D+L   F +   +A   I+ 
Sbjct: 181  STEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240

Query: 238  ERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPF 297
            ++ F     L   +H YVE+NLYDD W Q+T   +D EIE   D+++L+ I+ISQVP+  
Sbjct: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300

Query: 298  YPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD 357
            YP  + KF ++ VT  EK+L +A +C +RL  ++SHS K K+I++TLQT++   E  D  
Sbjct: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360

Query: 358  IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVL 417
            I   ++DADTL+ L+V+VVC+++VK+LKSHLFYLQ F+ D N+I FG++AY +STLEAVL
Sbjct: 361  I---SVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVL 417

Query: 418  CYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKS--YRDILRIRTAGGESCLS 475
             YFE  E   K++ LE +C  N  +W+ L+   +   SL     +DILR RT  G SCLS
Sbjct: 418  SYFESRE---KLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLS 474

Query: 476  VCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ 535
            +C+Q    +    L   FEH  PLED+L+D+T+ GS LL+Q L+ G + ++   +E+L +
Sbjct: 475  ICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFR 534

Query: 536  SCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYD 595
            SCT             ++R++ HYL   L +  K+G F +WE +D +GHTPLFAI R+YD
Sbjct: 535  SCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYD 594

Query: 596  HPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNE 655
            H DY  MV  A+++A  W  ++G+ F  S H+D KGNTLLHV+K+N+ ++L+   ++VN 
Sbjct: 595  HTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNS 654

Query: 656  VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHA 715
             NKKGLTP+MVY +YNRLDN+K ILRD RLI++K Q   +L CFDY+KNPV+  ELG HA
Sbjct: 655  FNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHA 714

Query: 716  AEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMS 775
                +  ++ AH  +FE + W LW+TL G       + ++ +++ IQ  L  + + N M+
Sbjct: 715  FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMT 774

Query: 776  FLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVN 835
            F+P +++ E+L  + K  ++S+ +LE   FL   ++VL LIC++EEF+     P+  LVN
Sbjct: 775  FIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVN 834

Query: 836  WIRESGRKRTNVS-RRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDI 894
                   +  N +   IEPEE+ SIQ  ++FN +E+  I+    +L+KL+IF  LK +D+
Sbjct: 835  AAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDL 894

Query: 895  NQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKID 954
             ++  M  S         I ++  + G  +          L +N   L+  +  LV KID
Sbjct: 895  ERSHTMFQSHGNNFTKI-IGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKID 953

Query: 955  QLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSA 1014
            ++L   +  WWK Y EL+  R++YNKNFP+ V+P + +N G   +Y+E KR +LE+ L  
Sbjct: 954  KILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVG 1013

Query: 1015 QIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKDTMRH 1074
            +I    + L   +  +++ +E+LA EL+ ++ FK  +  +  I++     I  L++ +  
Sbjct: 1014 RINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVC 1073

Query: 1075 FKRSLKNYKEQ 1085
             + +L +YK++
Sbjct: 1074 LEEALYDYKDK 1084

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1106 (41%), Positives = 688/1106 (62%), Gaps = 38/1106 (3%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPYHLP+LLNPLVN+VFNCP PSTS LKK+F++L+D++FIL+VP  + LL   D  +GS 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LQDLCYTYEFVANHIIIL-KKDSKY------SDQEFKTLNGKTVLIRSQNGIVLTGDGFP 113
            LQ+LCY+YEFVA+H++++ +++++Y      S  +F TLNGK V++RSQN I+LT DGF 
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 114  SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF-----GVRSTNT 168
             K+RC IT T+LF+NFN+YL     FP++ ID+P+ +++V+   +Q+      G R T  
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 169  SSLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFN 228
             S P + D +Q   SSF+ + R+HP    +F+ LF E R    +  +G D  ++ F    
Sbjct: 181  GSSP-TLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDII 235

Query: 229  YEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYI 288
              A+  +R +  F +   L   +++YVELNLYDDIW +IT  ++D E+E+    N L+Y+
Sbjct: 236  RRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVES----NGLRYL 291

Query: 289  AISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLT 348
            ++ Q+ T  YP+K  +F+LK V   E ++E A + F RL  + +H++K   ++DTL+ L+
Sbjct: 292  SLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS 351

Query: 349  DYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAY 408
               +    ++  V I ADTL+ L VLV+CR+Q++NLK  LFYLQNF+ +E +I FGV+ Y
Sbjct: 352  RVDK-SIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGY 410

Query: 409  ALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTA 468
            A+STLEA +CYF++ + S K+  LE  C   +   D LS ++ S + L  Y+  L  RT 
Sbjct: 411  AISTLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVN-LIHYQKTLSYRTE 469

Query: 469  GGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADV 528
             GES LS+CI  G    ++ LL + E   PLEDIL+DQT  G TLLMQ+L+ GN   A +
Sbjct: 470  QGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASL 528

Query: 529  LLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLF 588
            +++++  SCT              KRTAAHYLT ++ + ++IG FFDW+ KD SGHT LF
Sbjct: 529  IVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALF 588

Query: 589  AIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ 648
             IFRSYD P+Y  M+  +FR A++WY  R   F F+ H+D K NTLLH++K +I ILLE 
Sbjct: 589  TIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY 648

Query: 649  ENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQ 708
            E++DVN  N+KGLTPLMVY KYNRLDN K IL D R+I+ K Q  L L   DY KNP+I 
Sbjct: 649  ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLIL 708

Query: 709  AELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVY 768
             E+   +A  T FG+   HT ++E++ W + IT++  DR+ +F+TV+ +++ +Q   +  
Sbjct: 709  HEIAKQSAMDTAFGKCFVHTLKYESSSWLVNITVQA-DRKGNFETVEFHLKTVQNFFRTV 767

Query: 769  LRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYL 828
            LR  PM+FLP+D+ L  L  +GK  L S+GKLE   +L  LT    ++   +E  K +  
Sbjct: 768  LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILA 827

Query: 829  PASDLVNWIRESGRKRTN-----VSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKL 883
              S L++WI+   +   N      S+++EPEE++ IQ FLRFN +ELS +R K+ +++KL
Sbjct: 828  NESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKL 887

Query: 884  SIFSELKAQDINQARCMLF---SQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNID 940
            +IF  LK+ D+ Q+  +L    S+ +          F  + +   D    S  +L  +ID
Sbjct: 888  AIFLRLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVYGND----SMILLVEDID 943

Query: 941  FLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVK-PHLDDNKGLFGT 999
             + +CT +L   I+ LLQ K+  WWKLY ELL+ R QY +NFP+ VK      + G+ G 
Sbjct: 944  LMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGIIGK 1003

Query: 1000 YVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQD 1059
             +EGK+ KLE++LS  I      +      +  +HE+LAE+LS ++EFK  Y+  G+I+ 
Sbjct: 1004 ILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKR 1063

Query: 1060 FTVGKINTLKDTMRHFKRSLKNYKEQ 1085
            +    I  LK+ + H +R L+N   Q
Sbjct: 1064 WVRENIKELKERLIHIQRDLRNISGQ 1089

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1097 (40%), Positives = 674/1097 (61%), Gaps = 27/1097 (2%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPY+LP+LLNPL+N+VFNCPTP  S LKK+F+++   RF+L+ P   +LL Y+DL++G  
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120
            LQDLCY   FV++HI++L       ++E+KTL+GKT+L+RSQ GI+ T   F ++RRC+I
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120

Query: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRST--NTSSLPLSTDLT 178
               EL  NFN+YLKG   FP+IH+D PL     + DE Q F V     +T+    S  L+
Sbjct: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180

Query: 179  QREVS-SFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRH 237
              + + S EQL R++P+ G+  + + K QR  +N++  G   L   F +   +A +++R 
Sbjct: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240

Query: 238  ERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPF 297
               F+    L   VH Y+ELNLYDD W Q+T   RD EIE++ DY+LLK+I++SQVP+  
Sbjct: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300

Query: 298  YPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD 357
            YP    KF L+ +T  EK+++ A + F+++A ++ HS K K+I++TLQTL   S     D
Sbjct: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTL---SRSLLVD 357

Query: 358  IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVL 417
               VTIDADTL+ L V+VVC +QVK+L+SHLFYLQ F+ D N + FG++AY +STLEAVL
Sbjct: 358  DRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVL 417

Query: 418  CYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSF--DSLKSYRDILRIRTAGGESCLS 475
            CYFE  E   K+ SLE  CR N   W  +S  ++    D+     D+L+IRT+ G+SCL+
Sbjct: 418  CYFESPE---KVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLA 474

Query: 476  VCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ 535
            VC+Q       E +    E   PLED+L D+T +GS LL+  LE+G  R+A +L+  L  
Sbjct: 475  VCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLIS 534

Query: 536  SCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYD 595
            +CT             ++R+  HYL    Q+ D +G   +WE +D +GHTPLFAI R+YD
Sbjct: 535  NCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYD 594

Query: 596  HPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNE 655
             PDY  MV+ A+R A    ++R   F  S H D KGNTLLHV+K+++ ILL    IDVN 
Sbjct: 595  RPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNA 654

Query: 656  VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHA 715
             N KGLTPLMVYV+YNR+ NV+ IL+D RLI+ KHQ   +L+CFDYVKNP +  ELG +A
Sbjct: 655  TNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYA 714

Query: 716  AEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMS 775
            +       +  H+ + E + W LWIT+ G +++   +  K ++R IQ  L ++   +PM+
Sbjct: 715  SYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMT 774

Query: 776  FLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDL-- 833
            F+P+D +L +L  + ++ ++ + K++  RFL   ++ L ++ Q+  F  A     S+L  
Sbjct: 775  FVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADA--FTDSNLNL 832

Query: 834  -VNWIRESGRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQ 892
              +    S    T   + +EPEE+ SIQS L+FNLSE+S ++  + +++KL++F  LK +
Sbjct: 833  SSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGK 892

Query: 893  DINQARCMLFSQSVRLEDTAISQAF----GISGLSEKDSEDLSATILTSNIDFLKECTNK 948
            D+++A CM F    +       Q+F     +   +  D E ++     +NI   + C++ 
Sbjct: 893  DLSEA-CMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIA-----NNIALCELCSSL 946

Query: 949  LVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKL 1008
            L   I Q+L   + +WW  Y ELL  R +Y K+FP++ +PH+ +N GLFG+Y+E KR+KL
Sbjct: 947  LCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKL 1006

Query: 1009 EEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTL 1068
            E+  +A+I     RL  ++ ++ Q++E LA EL+ ++ FK  +L++  I++     I  L
Sbjct: 1007 EQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSA-IKEHADTNIKRL 1065

Query: 1069 KDTMRHFKRSLKNYKEQ 1085
            ++ +   + +L +YK +
Sbjct: 1066 REQLVCSEEALYDYKHK 1082

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1060 (40%), Positives = 653/1060 (61%), Gaps = 34/1060 (3%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPYHLP+LLNPLVN+VFNCP P  SPLKK+F + +D++FILVVP   +LL YQD  T   
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120
            L +LCY YEFVA+H ++  ++++ ++ EF+T+NGK+V+IR Q+GI+      PS ++C+I
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQ---PSAKKCRI 117

Query: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGV--------RSTNTSSLP 172
               EL  +FNDYL G   F L++ID+PL+ +      L+VFG         R T T+  P
Sbjct: 118  QRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTADAP 177

Query: 173  LSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAF 232
            L            EQ  RLHPQLG++   +FK+ ++ +      L  LV  F +   + +
Sbjct: 178  LP----------LEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVY 227

Query: 233  ELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQ 292
             LI+ ++ F N+  L + V  YVELN+Y+D+W+++ QL   +E +    Y + + I+++Q
Sbjct: 228  CLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQ 287

Query: 293  VPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSE 352
            + T  YPE+  KF+L  VT  EK + QAT+CF +L  ++SH EK +I++ T Q LT  ++
Sbjct: 288  LSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLT--TK 345

Query: 353  FPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALST 412
               A + D  IDADTL+GLMV+VVCR+QVKNLKSHL YL+ F+ + + +KFG++ Y+LST
Sbjct: 346  TSQATL-DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLST 404

Query: 413  LEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGES 472
            LEAV+ YF+   +S K+  L   C+RNK FW+ +  + +  + LK + ++L  RT   ES
Sbjct: 405  LEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIE-QGIPIN-LKEHEEVLISRTPSCES 462

Query: 473  CLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEI 532
             LS+CIQ G       ++ N++    LEDIL D   +  +LL+Q L+ GN  + + ++++
Sbjct: 463  VLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDL 522

Query: 533  LCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFR 592
            L  +CT               RT  HYL Q+ ++ D++G F DW+ KD++ HTPLF + R
Sbjct: 523  LIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCR 582

Query: 593  SYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENID 652
            +YDHP Y ++++  F+    +Y  RG+ F+F+ H+D  GNTLLH++K  I++ L     +
Sbjct: 583  AYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGAN 642

Query: 653  VNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELG 712
            VN+ N +G+TPLMVY KYNR++N++ IL D RLI+ K Q    L   DYVKNP+I   +G
Sbjct: 643  VNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIG 702

Query: 713  FHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRN 772
               A+ + +G +  H  ++E N W+LWIT         ++T  + ++ IQ LLQ+Y +++
Sbjct: 703  TAMAKNSLYGCLSVHNIKYEENAWYLWIT--SSLSPESYKTSSYALKDIQSLLQIYNKKH 760

Query: 773  PMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASD 832
            PMSFLPID  LE L  +GK+G++SV  LE    L  LT  L +I Q+E++K       S+
Sbjct: 761  PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820

Query: 833  LVNWIRESG-RKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKA 891
            L  W+R S  +++ N   +IEPEEI+SIQ+FL+F+L+E + +R+K ++L+KL IF   K+
Sbjct: 821  LSTWLRASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKS 880

Query: 892  QDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVG 951
             DI  ++ +L+SQ   +     S+    S    + ++ +        +DF+  C + L  
Sbjct: 881  HDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDP--FEQAVDFMCMCLDSLTS 938

Query: 952  KIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPH---LDDNKGLFGTYVEGKRSKL 1008
            KI ++L  K++ WW LY E+ + + +Y +NFP   KP+    +D+KG F +Y+E KR KL
Sbjct: 939  KIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKL 998

Query: 1009 EEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFK 1048
            E KL +++  C E LQ L  E+K  HE LAEE+S ++  K
Sbjct: 999  ESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSK 1038

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1103 (40%), Positives = 666/1103 (60%), Gaps = 43/1103 (3%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            M YH+P+LLNPLVNSVFNC  PS S  KK+F  L+ +RFIL+VP    LL++ D ++GSS
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LQDLCYTYEFVANHIIILKKDSKYSD---------QEFKTLNGKTVLIRSQNGIVLTGDG 111
            + DLC  Y+FVA+HI++L++D+ YSD          E+KTLN K V +RS +G +LT +G
Sbjct: 61   MNDLCQNYDFVASHILLLQQDT-YSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEG 119

Query: 112  FPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNTSSL 171
            FP +RR +I N EL  NFNDYL GS+ F L+HID PL+   ++  ++   G+   N + +
Sbjct: 120  FPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPR-GLAQGNFNGV 178

Query: 172  ----PLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKF 227
                 L  DLTQ+  SSFE + RLHP   +  +G F   R              + F   
Sbjct: 179  DAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTE----GPYEELFRMI 234

Query: 228  NYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKY 287
              +    + ++  F     L+  + +YVELNL+DD+W +I   YR DEI    D   LK+
Sbjct: 235  VKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEI----DTEPLKF 290

Query: 288  IAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTL 347
            ++I+++ T  Y +K  KF L+ VT  EK+++ A + F  L  + +H+EK   +++TLQ+L
Sbjct: 291  LSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSL 350

Query: 348  TDYSEFPDADIE--DVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGV 405
            ++  E  D DI+   +T+DADTLI   VLVVCR+QVKN+KSHLFYL+ FS DEN+IKFG+
Sbjct: 351  SNTRE-QDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGI 409

Query: 406  VAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAV--SFDSLKSYRDIL 463
            + YA+STLEAV+ YF+  + + K++ L+ +  + K+ +  +S K+   +   +  +R  L
Sbjct: 410  LGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNL 469

Query: 464  RIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNT 523
              RT  GES LS CI       +  LL+N+E   PLEDILDD+T++GSTLL+Q L+  N+
Sbjct: 470  EFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNS 529

Query: 524  RMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISG 583
              A +++E+L  SCT              +RT AHYLT ++ + + IG + +W+++D +G
Sbjct: 530  EAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNG 589

Query: 584  HTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIE 643
            HTPLF IFR YD  +Y  M++ AFR+A +WY+  GE+F FS H+D KGNTLLH++K N+ 
Sbjct: 590  HTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVS 649

Query: 644  ILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVK 703
            ILL+ +N+D+N  NKKGLTPLM+Y +YNR DNVK I+RD R+I++K Q   FLN FDY +
Sbjct: 650  ILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYAR 709

Query: 704  NPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLK-GKDRETDFQTVKHNIRAIQ 762
            NP++  EL   A + T F     H  ++E   WF  IT+K G   + +++TVK +I+ +Q
Sbjct: 710  NPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQ 769

Query: 763  GLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEF 822
             L QV L+ +  SFLP++  LEDL  + K+ + S+ KLE   F   LT    ++ + +  
Sbjct: 770  NLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNL 829

Query: 823  KKALYLPASDLVNWIRESGRKRTNV-----SRRIEPEEINSIQSFLRFNLSELSLIRDKI 877
             K L L  S LV+WIR   +K  N       + +EPEEI  + SFLRFN  ELS ++ K+
Sbjct: 830  NK-LVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKL 888

Query: 878  SILQKLSIFSELKAQDINQAR--CMLFSQSVRL-EDTAISQAFGISGLSEKDSEDLSATI 934
              ++KL IF +LK  D+  +     LF     L +D  + +   I+  +  +   ++   
Sbjct: 889  MTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATMT--- 945

Query: 935  LTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNK 994
                I FL+ CT KL+ +++QLL   +  WWKLY ++L+    Y + FPN  +   D   
Sbjct: 946  FVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRN--DSGT 1003

Query: 995  GLFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRT 1054
            G+  ++ EGKR K+E KLS+ +  C +R++ +   +   HE LAEELS Y+EFK+N+   
Sbjct: 1004 GIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFIN 1063

Query: 1055 GIIQDFTVGKINTLKDTMRHFKR 1077
            GI++      IN LK  +   ++
Sbjct: 1064 GILRRAVRENINILKGRLVEMRK 1086

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1100 (37%), Positives = 651/1100 (59%), Gaps = 43/1100 (3%)

Query: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62
            YHLP LLNPL+N++FNCP P  SPLKK+FA+L+ +RFIL+ P  ++LL+Y D+ T   L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118
            +LCY  +F+ +HI++  ++S  +    D  ++TL+GKTV+++ +N ++ T +GFP +RR 
Sbjct: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123

Query: 119  KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFG----VRSTNTSSLPLS 174
            KI +T++  NFNDY KG++YF +++ID+PL  + V ND L  F        T  ++  L 
Sbjct: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183

Query: 175  TDLTQREVSSFEQLFRLHP----QLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYE 230
             D +Q E SSFE +  +HP    QLG  FS     +R  +N      D     F++   +
Sbjct: 184  MDTSQLERSSFENILHIHPAWLTQLGQLFSNY---RRAALND-----DPSKKMFEELVEQ 235

Query: 231  AFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAI 290
            AF+ ++ +  F+N S L+  +H+Y ELNLY+DIW ++T  ++  E+         +Y ++
Sbjct: 236  AFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSV 291

Query: 291  SQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDY 350
            +Q+ T +Y +    F L  +T  E+ +  A+  F++LA S S++EK+KI+++TLQ L+  
Sbjct: 292  NQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGT 351

Query: 351  SEF----PDAD--IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFG 404
            ++     PD      ++T+DADTLI L VLVVCRS+ K+++SHL+YLQNFS + ++ KFG
Sbjct: 352  TDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFG 411

Query: 405  VVAYALSTLEAVLCYFEDAENSGKIRSLE-FNCRRNKQFWDHLSCKAVS--FDSLKSYRD 461
            ++ YA+STLEAV+CYFE+   +    +     C + +   D LSC+  +   + L +Y+D
Sbjct: 412  ILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKD 471

Query: 462  ILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETG 521
            IL  R   G+S LS+CI       +  +L  +E   P+EDIL+D+TI+GSTLL+++++ G
Sbjct: 472  ILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVG 531

Query: 522  NTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDI 581
            N     +L+ I+  +CT             + R+ AHYLT ++ +   IG + +W+ K+ 
Sbjct: 532  NLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNS 591

Query: 582  SGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTN 641
            SG TPLF+IFRSYD P+Y +MV  AF  AS WY+    +F +S H D KGN+LLHV+KT+
Sbjct: 592  SGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTD 651

Query: 642  IEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDY 701
            + ILL+   +++N  N KGLTPLMVYVKY RL N+  I +D+RLI+EK Q S F  CFDY
Sbjct: 652  VSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDY 711

Query: 702  VKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAI 761
             K+ ++ +++G   A  + FG +  H+ R+ N    + +T   K  E  F T   N++ I
Sbjct: 712  AKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEP-FVTAVINMKTI 770

Query: 762  QGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEE 821
            QGLL+  ++ NP +FLPID  ++ +  + ++ L  +GK +V   L +LT    ++   ++
Sbjct: 771  QGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKK 830

Query: 822  FKKALYLPASDLVNWIRESGRKRT------NVSRRIEPEEINSIQSFLRFNLSELSLIRD 875
              + L+   + ++ W+R +  +R       +  + +EPEEIN IQSFLRFN  E+   + 
Sbjct: 831  VPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKA 890

Query: 876  KISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATIL 935
             ++IL+K+ IF  LK+ D   A   L     ++ +   + AF     + K   DLS   L
Sbjct: 891  SLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDEL 950

Query: 936  TSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKG 995
              ++ FL+ECT +L   I  +L  ++  WWK Y E L     Y K FP++VKP       
Sbjct: 951  LEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTS 1010

Query: 996  ---LFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYL 1052
                 G ++E KR + E++LS QIK+  + L+ L  E+   HE LAEELS Y+EF+   L
Sbjct: 1011 SHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACL 1070

Query: 1053 RTGIIQDFTVGKINTLKDTM 1072
                I  F +  I+ L++ +
Sbjct: 1071 DQRTIVAFAIKNISVLQECI 1090

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1103 (37%), Positives = 649/1103 (58%), Gaps = 51/1103 (4%)

Query: 4    HLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQD 63
            HLP LLNPL+N++FNCP P  SPLKK+FA+L+  RFIL+ P    LL+Y D+ T   L +
Sbjct: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64

Query: 64   LCYTYEFVANHIIILKKDS----KYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCK 119
            LCY  EF+ +HI+++ ++S       D  ++TL+GKTV+I+ +N ++   +GF  +RR K
Sbjct: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124

Query: 120  ITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF----GVRSTNTSSLPLST 175
            I  T++  NFNDY +G+  F +I+I++PL  ++V ND LQ F     +  +  S   LS 
Sbjct: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184

Query: 176  DLTQREVSSFEQLFRLHP----QLGDRFSGLFKEQRQEINANFKGL----DSLVDFFDKF 227
            D +Q+E SSFE +  +HP    QLG+ FS            N++ L    D     F+  
Sbjct: 185  DSSQQERSSFENILHIHPTRLTQLGEMFS------------NYRTLAPSDDPSEKIFECI 232

Query: 228  NYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKY 287
              +AFE ++ +  F+    L+  +H Y ELNLYDDIW ++T  ++  E+  T +Y   KY
Sbjct: 233  VQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEV-GTEEY---KY 288

Query: 288  IAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTL 347
             +I+ +   FY +   +F L+ VT  EK +  A+  F++L  + S++EK+KI+++TLQ L
Sbjct: 289  FSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQEL 348

Query: 348  TDYSEFPDADIE------DVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTI 401
            +  ++     ++      ++ +DADTLI L VLV+CRS+ K+LKSHL+YLQNFS + ++ 
Sbjct: 349  SGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSS 408

Query: 402  KFGVVAYALSTLEAVLCYFED-AENSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKS 458
            KFG++ YA+STLEAV+CYFED  +NS  +       ++ K+  + LSC+ V+   ++L +
Sbjct: 409  KFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLAT 468

Query: 459  YRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTL 518
            Y+DIL  R   G+S LS+CI       +  +L  ++   PLED+L+D+TI+GSTLL++++
Sbjct: 469  YKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESI 528

Query: 519  ETGNTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEA 578
            ++GN   A +L+ I+  +CT             + RT AHYLT ++ +   IG + DW+ 
Sbjct: 529  KSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKR 588

Query: 579  KDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVM 638
            K+  G TPLF+IFRSYD P+Y  MV  AF  A+ WY  +  +F++  H D KGN LLHV+
Sbjct: 589  KNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVL 648

Query: 639  KTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNC 698
            KT+  ILL+   +D+N  N KGLTPLMVYVKY RL+N++ I++D RL++EK QKS F  C
Sbjct: 649  KTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTC 708

Query: 699  FDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNI 758
            FDY K+  + +++G   A+ + FG +  H+ R+ N    + IT    D E  F     N+
Sbjct: 709  FDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITF-ASDTEKPFSNTVINM 767

Query: 759  RAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQ 818
            + IQGLL+  L+ NP +FLP++  ++++ ++ ++ +  +GK +V   L +L+    ++  
Sbjct: 768  KTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLF 827

Query: 819  KEEFKKALYLPASDLVNWIRESGRKRTNVS------RRIEPEEINSIQSFLRFNLSELSL 872
             ++  K+L+   + ++ W+R +  KR          + +EPEEIN IQSFLRFN  E+S 
Sbjct: 828  LKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISS 887

Query: 873  IRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSA 932
             +  +SIL+K+ IF  LK+ D       L      + +   + AF  +  +     D S 
Sbjct: 888  FKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSL 947

Query: 933  TILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKP-HLD 991
              L  ++ FL+ECT +L   +  +L  K+  WWK Y EL+     Y K FP+ VKP    
Sbjct: 948  AKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTT 1007

Query: 992  DNKG--LFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKT 1049
            D  G    G ++E KR + E++L+ QIK   + L+ L  E+   HE LAEELS Y+EF+ 
Sbjct: 1008 DTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRK 1067

Query: 1050 NYLRTGIIQDFTVGKINTLKDTM 1072
              L    I  F    I+ L++ +
Sbjct: 1068 ACLNQRNIVAFAATNISVLQENI 1090

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1097 (35%), Positives = 646/1097 (58%), Gaps = 41/1097 (3%)

Query: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62
            YHLP LLNPL+N++FNCP P  SPLKK+FA+L+ +RFIL+ P +  LL+Y D+ T   L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118
            +LCY  +F+ +HI++  ++S  +    D  ++TL+GK V+I+ +N I+   +GFP ++R 
Sbjct: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123

Query: 119  KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGV------RSTNTSSLP 172
            KI  T++  NFNDY +G+  F ++ ID+PL  +   ND L+ F         + + S+LP
Sbjct: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183

Query: 173  LSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAF 232
            +++   ++E SSF+ +  +H     +   LF   R+    +    D     F+    ++F
Sbjct: 184  VNS--YEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPND----DPSKKMFEDIVQQSF 237

Query: 233  ELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQ 292
            + ++ +  F+N S L+  +H+Y ELNLYDDIW ++   ++  E+    D    KY +++Q
Sbjct: 238  DGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEV----DTEKYKYFSVNQ 293

Query: 293  VPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSE 352
            +   F+ +   +F L  +T  E+ +  A+  F++L  + S++EK+KI+++TLQ L+  +E
Sbjct: 294  LLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTE 353

Query: 353  -------FPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGV 405
                    P+  +  +T+DADTL+ L VLVVCRS+ K+LKSHL+YLQNFS + ++ KFG+
Sbjct: 354  ISSHQQELPNG-LNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGI 412

Query: 406  VAYALSTLEAVLCYFEDAE-NSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKSYRDI 462
            + YA+STLEAV+CYFED + N+  +     + ++ ++  D LS +  +   ++L +Y D 
Sbjct: 413  LGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDN 472

Query: 463  LRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGN 522
            L+ R   G+S LS+CI       +  +L  +E   P+EDIL+D+T++GSTLL+++++TGN
Sbjct: 473  LQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGN 532

Query: 523  TRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDIS 582
               A +L+ I+  +C+             + RT AHYLT ++ +   IG + DW+ K+ S
Sbjct: 533  IEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSS 592

Query: 583  GHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNI 642
            G TPLF+IFR+YD P+Y +MV  AF  A+ WY+    +F++  H D+KGN+LLH++K+++
Sbjct: 593  GQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDV 652

Query: 643  EILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYV 702
             ILL+   +D+N  N KGLTPLM+YVKY R+ N+  I +D+RLI+EK Q S F  CFDY 
Sbjct: 653  SILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYA 712

Query: 703  KNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQ 762
            K+  + +++G   A  + FG V  H+ R+ N      IT    + +  F T   N++ IQ
Sbjct: 713  KDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNIT-TASNTDKPFLTTVINMKTIQ 771

Query: 763  GLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEF 822
            GLL+  L+ N  +FLP+++ ++++  + ++ L  +GK +V   L +LT    ++   ++ 
Sbjct: 772  GLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKV 831

Query: 823  KKALYLPASDLVNWIRESGRKRT------NVSRRIEPEEINSIQSFLRFNLSELSLIRDK 876
             + L+   + ++ W+R +  KR       +  + +EPEEIN IQSFLRFN  E+S  +  
Sbjct: 832  PQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKAS 891

Query: 877  ISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILT 936
            ++IL+K+ IF  LK+ D       L     ++ +   + AF     +     DL+   L 
Sbjct: 892  LNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELL 951

Query: 937  SNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKG- 995
             ++ FL++CT +L   +  +L  K+T+WWK Y E L  +  Y K FP+ VKP    +   
Sbjct: 952  EHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPS 1011

Query: 996  --LFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLR 1053
                G+++E KR + E++L+ QIK+  + L+ L  E+   HE LAEELS Y+EF+   L 
Sbjct: 1012 HIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLD 1071

Query: 1054 TGIIQDFTVGKINTLKD 1070
               I  F    I   ++
Sbjct: 1072 QRTIVAFATTNIGIFQE 1088

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1102 (35%), Positives = 622/1102 (56%), Gaps = 56/1102 (5%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            MPYHLP+LLNPL+N++FNCP+P TS LK++F+ L D+RF ++VP+   LL +QDL++G  
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LQDLCYTYEFVANHIIILKKDSK-YSDQ------EFKTLNGKTVLIRSQNGIVLTGDGFP 113
            L +LCY Y+FVA+HI+++K  +K   DQ      +F TLNG+ + IR +N  ++TGDGF 
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 114  SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF----GVRSTNTS 169
             +R+  I    L   FNDYLKGS Y P++HI  PL  D V  DELQVF    G + +   
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 170  SLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNY 229
              PL  D  Q++V  FEQ  +    + +R +  F   +  I      +    ++ +  + 
Sbjct: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRD- 239

Query: 230  EAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIA 289
               ++I  ++R  +   L   +++YVEL L+ DI +Q++++  D E+E  +D+  L+ I+
Sbjct: 240  SIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSIS 299

Query: 290  ISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTD 349
            ++QVPT FYP+ +  FSL  V   EKS+  A +  K +   ++HS K +++  T++ L+ 
Sbjct: 300  LNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLS- 358

Query: 350  YSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYA 409
                   +I  ++ DADTL+ L VL++CRSQV  L   L YL NF + E +IKFG+  Y 
Sbjct: 359  ------REINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYV 412

Query: 410  LSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAG 469
            LST EA L +F    +   + SL   C  NK+ W  +   +     L S    LRIRT  
Sbjct: 413  LSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSN--LRIRTDS 466

Query: 470  GESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVL 529
            GES LS+CIQ  N   +  LL NFE E PLEDILDD+    STLL+Q L+  N++ A +L
Sbjct: 467  GESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAIL 526

Query: 530  LEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFA 589
             EI+ +SCT               R  AHY+ QD+ + + +G +F+WE KDI+GHTPLFA
Sbjct: 527  SEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFA 586

Query: 590  IFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQE 649
            +FRSYD  +Y ++VT       KWY    + FNF  H+D KGNTLLHVMK+ IE LL+  
Sbjct: 587  VFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLP 646

Query: 650  NIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQA 709
            +++VN+ + KGLTPLM+Y +YNR+ N++ I++D RL+ +  Q+ L +   D+ KNP +  
Sbjct: 647  DVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTK 706

Query: 710  ELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYL 769
             +      +     VV H+ RFE  +W + I  +G  ++     +++ +R ++ +     
Sbjct: 707  TILDATFNREP---VVIHSLRFEERKWKIGIFSEGIFKKYSLDLIQYYLRYLKIMY---- 759

Query: 770  RRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQK---------E 820
               P SF P+  +  +L  +G  G+  V +L+ +    +L ++   +  +         E
Sbjct: 760  ---PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEE 816

Query: 821  EFKKALYLPASDLVNWIRESGRKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISIL 880
            E K  L +P      ++ ES R       ++EPEEIN IQ+FL++NL+E   +R+ + IL
Sbjct: 817  ELKVLLDVPTP----YLSESER-----FIKLEPEEINGIQTFLKYNLAEFQKLRNCLIIL 867

Query: 881  QKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNID 940
            +KL+I  ++K +D+   R    S   ++    ++++F  +  +   S DLS    T N++
Sbjct: 868  KKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAW--SYDLSYYEFTRNLE 925

Query: 941  FLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTY 1000
            +L+     L+   + LL  K T WWK + EL++ + ++ KNFPN   P    N+    TY
Sbjct: 926  YLEHSVVTLLNNFESLL-AKTTLWWKHFGELMELKKEWKKNFPNDKAPPSSANRNFIDTY 984

Query: 1001 VEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDF 1060
            +EGKRSK   KLS Q+K     L+ +  E+K  HE++A  +++++EFK  +    I++  
Sbjct: 985  IEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSI 1044

Query: 1061 TVGKINTLKDTMRHFKRSLKNY 1082
               +I   K  M+    ++K +
Sbjct: 1045 VDQRIRENKQIMQQLIDTMKGH 1066

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1103 (34%), Positives = 626/1103 (56%), Gaps = 46/1103 (4%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            + YH+P+LLNPL+N+VFNCP P  SPL+K+F  ++ + F+L+VP   ILLHY+D + G +
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LQDLCYTYEFVANHIIILKKDSKYS------------DQEFKTLNGKTVLIRSQNGIVLT 108
            L++LCY +EFVA+HII+   +S  +            D  +K+LN   +LI++ N I L 
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 109  GDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVRSTNT 168
             +    K++ KI + ++  NFN+YL GS+ + +I+ D P  +  +   E++ F +    +
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 169  SSL----------PLSTDLTQREVSSFEQLFRLHPQLGDRF-SGLFKEQRQEINANFKGL 217
            +++          PLS DL Q+  SSF  +  +H +  + F S +   + +++N     L
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNKQLN-----L 238

Query: 218  DSLVDFFDKFNYEAFELIRHERRFEN-HSKLHQTVHNYVELNLYDDIWKQITQLYRDDEI 276
             SL  +F +   +A++ ++ E  F + H+ L+  +  Y+E + Y+ IW  I +   D++ 
Sbjct: 239  TSLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQF 298

Query: 277  EATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEK 336
              T    ++ +++I Q+    Y +   KF+L  V   E+ ++ ATD FK++  S SHSEK
Sbjct: 299  LHT---EMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEK 355

Query: 337  TKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSL 396
             +I++D LQ LT Y    D   E + +DADTL+ L +LV+CRS+V  L++HL+YLQNFS 
Sbjct: 356  CQILIDALQKLTSYD---DVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFST 412

Query: 397  DENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKA-VSFDS 455
            DEN +KFG++ Y +ST EA LCY +D +   K      NC RNK+    +S +A  S   
Sbjct: 413  DENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQ 472

Query: 456  LKSYRDILRIRTAGGESCLSVCIQ-KGNFSGIECLLQNFEHELPLEDILDDQTINGSTLL 514
            +K Y+D  + R   GES L++CI+ K N +  E LL NFE   PLEDILDD+ I G+TLL
Sbjct: 473  VKLYKDCFKFRNEMGESILALCIKHKKNETLFEILL-NFEDMFPLEDILDDEDIEGTTLL 531

Query: 515  MQTLETGNTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFF 574
            M+ L+  N   A +++++L  SC+              +R AAHY+T  + +  +IG+FF
Sbjct: 532  MKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFF 591

Query: 575  DWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTL 634
            +W+ KD  G+TPL  I R+YD   Y QM+  AF  A KWYE R +  NF  H D+K NTL
Sbjct: 592  NWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTL 651

Query: 635  LHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSL 694
            LH++K +I++LL+ +NI++N  N K +TPLM YVKYNR+ N++ I+RD RLI+ K+QK  
Sbjct: 652  LHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHT 711

Query: 695  FLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTV 754
            FL+C+D+VKN +I  +LG  +   + F    A++ R EN+ W L+ T K  ++++ + T 
Sbjct: 712  FLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDS-YITK 770

Query: 755  KHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVS-VGKLEVHRFLCELTLVL 813
              +++ +  +++ Y +  P+ F+P   VL  L  I K    + + KL+   FL  ++   
Sbjct: 771  SVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYF 830

Query: 814  KLICQKEEFKKALYLPASDLVNWIRESGR--KRTNVSRRIEPEEINSIQSFLRFNLSELS 871
              + + ++F   L+     L  WI+   R  K+ N  +R+  ++IN I+SF++FN++EL 
Sbjct: 831  GTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELG 890

Query: 872  LIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAIS-QAFGISGLSEKDSEDL 930
             +   ++IL+KL  F  LK  D+N++  +  +    L+   IS Q   I GL +      
Sbjct: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQS 950

Query: 931  SATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPN-SVKPH 989
               IL   I FL+ CT  +    + L++  +  W  ++  L + + QY ++F +   +  
Sbjct: 951  IFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNG 1010

Query: 990  LDDNKGLFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKT 1049
            L++N  +   Y + KR   E+++S +I         +T  +   HE LAEE + +L FK+
Sbjct: 1011 LNEN--ILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKS 1068

Query: 1050 NYLRTGIIQDFTVGKINTLKDTM 1072
             + +  I+       I TLKD +
Sbjct: 1069 RFFKDVILNMIIPSAIATLKDQV 1091

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1153 (33%), Positives = 621/1153 (53%), Gaps = 105/1153 (9%)

Query: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62
            YHLP LLNPL+NS+FNCP PS SPLKK++ASL+D+ FIL+VP    LL+Y D  T   L+
Sbjct: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 63   DLCY-TYEFVANHIIILKKDSKY--------------SDQEFKTLNGKTVLIRSQNGIVL 107
            DLCY   +F+  HI++  KDS                S ++F TLNG  +L++ +N  ++
Sbjct: 64   DLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLV 123

Query: 108  TGDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVK-NDELQVFGVRS- 165
               G P++++ KI   ++  NFNDYL+GS YF L+HIDKPLM D ++ NDEL+ F   + 
Sbjct: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTL 183

Query: 166  ------TNTSSLPLSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDS 219
                  ++  + PL  D++Q E S FE +   +     RF     E +    A     + 
Sbjct: 184  HDNDGDSSPDARPLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAE----EP 239

Query: 220  LVDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYR-DDEIEA 278
                F +    A+  ++  + F+    L + +H Y+E+NLYD +W QIT L   DDE + 
Sbjct: 240  NETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKG 299

Query: 279  TYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTK 338
            T     +K I+I ++   FY      F L  +T  EK++ ++T+   +L   +S +EK++
Sbjct: 300  TR----IKNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSE 351

Query: 339  IIMDTLQTLTDYSEFPDADIE-------DVTIDADTLIGLMVLVVCRSQVK--NLKSHLF 389
             ++ TLQ LT+    P  ++        +  IDADTLI L++L++CRS++   +LK ++F
Sbjct: 352  NLIATLQILTNMDN-PIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIF 410

Query: 390  YLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCK 449
            YL+ F+ DEN I FG+++Y +ST E V+  FE+     K++S           +  +  K
Sbjct: 411  YLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDKLKS-----------YSEIIEK 459

Query: 450  AVSFDSLKS------YRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDIL 503
             +  D LK       +   L  R+  GES L  CI          LL ++E    +++IL
Sbjct: 460  LIKVDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNIL 519

Query: 504  DDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQD 563
            DD  + G+TLLMQ L   N +++ VL+ +L ++C+             + R   HYL  +
Sbjct: 520  DDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINE 579

Query: 564  LQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNF 623
            L++   IG + +W+ +D+ G TPLF IFR YD P+Y ++++  F     WY   G  F  
Sbjct: 580  LEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQM 639

Query: 624  SAHKDTKGNTLLHVMKTNIEILLEQEN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKC 678
            S H D K N++LH++++NI+IL          ID+N+ N KG TPLM+YVKY+RL NVK 
Sbjct: 640  SDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKL 699

Query: 679  ILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAE-KTKFGEVVAHTF--RFENNR 735
            IL D+RL+  ++Q+ L+  CFDY  +  I  ELG HA +  T FG +  H+   R   N 
Sbjct: 700  ILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNA 759

Query: 736  WFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIG--KTG 793
             F  +T    D+E +  TV   ++AI  LL+V  +++ +S LP+D +++ L ++   +  
Sbjct: 760  TF-SLTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENN 818

Query: 794  LVSVGKLEVHR---FLCELTLVLKLICQKEEFKKALYLPASD--LVNWI-RESGRKRTNV 847
             + V K+E+ R    L  LT  L  +   +     L L   +  L+ W+  E+ + + NV
Sbjct: 819  KIIVRKIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNV 878

Query: 848  S------RRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCML 901
            +      + ++PE+IN IQSFL+FN+ EL  +   +  L+KL  F  LK+ D+ ++R   
Sbjct: 879  NKTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAF 938

Query: 902  FSQSVRLEDTAISQAFG-----ISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQL 956
                  +++  I+QA       I  +   +++  + T++   +DFLK CT  L G I+ +
Sbjct: 939  VHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDI 998

Query: 957  LQGKLTRWWKLYAELLDARNQYNKNFP-------------NSVKPHLD-DNKGLFGTYVE 1002
            L+ ++  WWKLY ELL+    YNK FP             +S +   D +N G+FG  +E
Sbjct: 999  LRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIE 1058

Query: 1003 GKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTV 1062
             +R+K  +KL   I      L+ L  E+ ++HE LAEEL+ Y+EFK  + +  II+++  
Sbjct: 1059 NQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRR 1118

Query: 1063 GKINTLKDTMRHF 1075
            G +  + D +  F
Sbjct: 1119 GDLEAVNDDLITF 1131

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/1113 (32%), Positives = 595/1113 (53%), Gaps = 86/1113 (7%)

Query: 15   SVFNCPTPSTSPLKKIFASL-RDQRFILVVPNVNILLHYQDLDTGSSLQDLCYTYEFVAN 73
            ++ NC  P++SPLKK++  L +  +++++VP   +LL+Y D ++ S L DLCYT  F + 
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HIIILKKDS------------------------KYSDQEFKTLNGKTVLIRSQNGIVLTG 109
            HI++L                            K  DQ +K +N K  +I   N +   G
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL---G 135

Query: 110  DGFPSKRRCKITNTELFINFNDYLKGS-KYFPLIHIDKPLMSDAVKN------DELQVFG 162
            D    K R KI + E    FN+Y+K +     +++ID   ++  ++       D L+   
Sbjct: 136  DQI--KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPS 193

Query: 163  VRSTNTSSLPL-----STDL-TQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKG 216
            +RS  T+  P      STD    +  ++F+ + R++     +F   F++ R   N +   
Sbjct: 194  MRSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQD--- 250

Query: 217  LDSLVDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEI 276
             D  +D F     E  E +  +  F+N   L   ++ YVELNL+DDIWK I ++ ++ EI
Sbjct: 251  -DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI 309

Query: 277  EATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEK 336
                D N    I+I QV + F   + SKF L+ V   E+++++A+   +++  +S++  K
Sbjct: 310  ----DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSK 365

Query: 337  TKIIMDTLQTLTD-------YSEFPDADIE--DVTIDADTLIGLMVLVVCRSQVKNLKSH 387
              I++ TL+TLT         S+  D ++    + IDAD L+ L VLV CR+Q+KNLK H
Sbjct: 366  ANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCH 425

Query: 388  LFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLS 447
            L YLQNF  +++  KFG++ YALSTLEAV+CYFE  +     R L   C  N++    LS
Sbjct: 426  LSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLS 485

Query: 448  C-------KAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLE 500
                     A+ F  L+ Y   LR R + G+S L++CI  G    +  +L  +E   P+E
Sbjct: 486  STKKYETNAALYF--LRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIE 543

Query: 501  DILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYL 560
            D+L D++I+GSTLL+Q ++  N   A +LL IL  +CT              KRTA H+L
Sbjct: 544  DLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFL 603

Query: 561  TQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGEN 620
            T +L++   +G + +W  KD +G TPLF IFRSYD  +Y +MV+ +   A+ WY + G+N
Sbjct: 604  TNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKN 663

Query: 621  FNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCIL 680
            FN+  H D KGNTLLH++K N+ ILL  ++I+VN  N+ G TPLM  ++Y R +N++ +L
Sbjct: 664  FNYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLL 723

Query: 681  RDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWI 740
             D RL ++  QK+  L  FD+ K+  I   LG H    + +  V AHT ++ N+RW L +
Sbjct: 724  CDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSL 783

Query: 741  TLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKL 800
            T+K KD     +T    ++ ++G+L+V ++ N   FLP+  ++EDL    +     + ++
Sbjct: 784  TVKLKDAP---KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRI 840

Query: 801  EVHRFLCELTLVLKLICQKEEFKKALYLPASDLVNWIRESGR--KRTNVSRRIEPEEINS 858
            +V   L  ++  L  +   +     ++    + + W++ +G   K+TN +  I PE+I+ 
Sbjct: 841  KVLEMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISM 900

Query: 859  IQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDI---NQARCMLFSQ--SVRLEDTAI 913
            IQ+FL+FN++E+   ++K+ I +KLS+FS LK++D+   N+    + SQ  S R   T  
Sbjct: 901  IQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLK 960

Query: 914  SQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLD 973
              A     LS +     +   L S I +LK C  KL   I  +    ++ WW +Y ELL+
Sbjct: 961  YSAEDTKLLSVR-----AEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLN 1015

Query: 974  ARNQYNKNFPNSVKPHLDDNK-GLFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQ 1032
            A   Y + FP       ++    L       KR KLEE+LS +IK   E+L ++ +++KQ
Sbjct: 1016 AHKHYTRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQ 1075

Query: 1033 EHEALAEELSIYLEFKTNYLRTGIIQDF-TVGK 1064
             HE  AEE+S +++ KT +     +Q + T+ K
Sbjct: 1076 MHELAAEEVSRFIDLKTKFTLEYALQSYLTISK 1108

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  546 bits (1407), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 368/1113 (33%), Positives = 585/1113 (52%), Gaps = 64/1113 (5%)

Query: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60
            M Y +P+L NPL+N+VFNCP P  SP KK++  LRD+ F+L+VPN  ILL+Y+D  +  S
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 61   LQDLCYTYEFVANHIIILKKDS----------KYSDQEFKTLNGKTVLIRSQNGIVLTGD 110
             ++LCYTY+FVA HI+IL K+S          K  D   K+LNGK VL+R    + +   
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQ--SLCIPIK 118

Query: 111  GFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPL-MSDAVKNDELQVFGVRSTNTS 169
            G+ SKR+ ++ +  L  NFNDYL GS +F ++HID PL +SD    DEL+ F      + 
Sbjct: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGF----EESR 174

Query: 170  SLPLSTDLTQREVSSFEQLFRLHPQLGDR--FSGLFKEQR------QEINANFKGLDSLV 221
             LP  +    ++     Q  R      DR  F  LF+E++      ++    ++ ++ L 
Sbjct: 175  ELPFHSQ--DKDKPGLLQ--RTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ 230

Query: 222  DFFDKFNYEAFELI----RHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIE 277
            +   +  ++   +I    + E+RF+  + L+   + Y+E  LY DIW ++ + YRD    
Sbjct: 231  NIGSELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRD---- 286

Query: 278  ATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKT 337
               D+ L+  +++  + T FY      F L  + + E  + QA   FK +  ++S+S+K 
Sbjct: 287  KILDFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKV 346

Query: 338  KIIMDTLQTLTDYSEFPDADIEDVT------IDADTLIGLMVLVVCRSQVKNLKSHLFYL 391
             +I  TL  +T   +  D  I D T      IDADTL+ L  L++CR+ V+++  H+ YL
Sbjct: 347  DVIFKTLNIIT--GKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYL 404

Query: 392  QNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAV 451
            Q+F  DENT+KFG + Y LST+EA L YF +  NS + R         + F   +  +  
Sbjct: 405  QSFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHD 464

Query: 452  SFDSLKSYRDILRIRTAGGESCLSVCI-QKGNFSGIECLLQNFEHELPLEDILDDQTING 510
                +  ++D  R RT  GES LS+ I  K N +  E LL NFE   PL+D+L D  ++G
Sbjct: 465  DLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALL-NFEDIFPLDDLLYDTDVSG 523

Query: 511  STLLMQTLETGNTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKI 570
            STLL++ L+  N   A++L+EI   SCT              KRT AHY+T ++++ +KI
Sbjct: 524  STLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKI 583

Query: 571  GIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTK 630
            G + +W  KD+ G T LF IFRSYD   Y+  +  A   A  WY+     F  S H D  
Sbjct: 584  GKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLF 643

Query: 631  GNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKH 690
            G++LLH++K+ + +LL+ E++D+N  N KG+TPLM YVKYNR+DN+K IL D RLI++K 
Sbjct: 644  GDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKL 703

Query: 691  QKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRE-- 748
            QK  +LNC DY KN  +   L    ++   F        R+E + W+L I+++  D E  
Sbjct: 704  QKDKYLNCLDYGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYT 763

Query: 749  TDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKT-GLVSVGKLEVHRFLC 807
            T+   +K     I  + ++Y       F+P   +L+ L +I +   ++ + +L++  +L 
Sbjct: 764  TNIIKLKKYYNLINAMQKIY----KSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLN 819

Query: 808  ELTLVLKLICQKEEFKKALYLPASDLVNWI------RESGRKRTNVSRRIEPEEINSIQS 861
             L+  L  +   E+      L  + ++ WI      +E      +  + +  E+IN+I++
Sbjct: 820  FLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKA 879

Query: 862  FLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFG-IS 920
            F  F+  E+    + I    KLSIF E+K  D+N +  +L        +  IS+  G + 
Sbjct: 880  FCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQ 939

Query: 921  GLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNK 980
             +S      +    L+ +I F+K+CT  L  K+   ++ KL+ W K   +LL+ R +Y+ 
Sbjct: 940  SISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSI 999

Query: 981  NF--PNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSAQIKSCLER-LQTLTYEVKQEHEAL 1037
             F   N    +L +N  +F         K EE+        LER L+ L  E++ +HE L
Sbjct: 1000 KFLQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEEL 1059

Query: 1038 AEELSIYLEFKTNYLRTGIIQDFTVGKINTLKD 1070
            AEE S Y+  K+ +    +++ F    +  LK+
Sbjct: 1060 AEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKE 1092

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  528 bits (1361), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 289/733 (39%), Positives = 433/733 (59%), Gaps = 14/733 (1%)

Query: 352  EFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALS 411
            E PD  + ++T+DADTLI L VLVVCRS+ K+LKSHL+YLQNFS + ++ KFG++ YA+S
Sbjct: 7    ELPDG-LNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVS 65

Query: 412  TLEAVLCYFED-AENSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKSYRDILRIRTA 468
            TLEAV+CYFED  +N+G +      C + K   D LSC+  +   + L +Y+DIL  R  
Sbjct: 66   TLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNE 125

Query: 469  GGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADV 528
             G+S LS+CI       +  +L  +E++ P+ED+L+D+TI+GSTLL+++++ GN   A V
Sbjct: 126  QGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKV 185

Query: 529  LLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLF 588
            L++I+  +CT             + RT AHYLT ++ +   IG + DW+ K+ SG TPLF
Sbjct: 186  LIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLF 245

Query: 589  AIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ 648
            +IFRSYD P+Y +MV  AF  A+ WY      F++  H D KGN+LLHV+KTNI ILL+ 
Sbjct: 246  SIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL 305

Query: 649  ENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQ 708
              +D+NE N KGLTPLMVYVKY RL N+  I +D RLI+EK Q S F  CFDY K+  + 
Sbjct: 306  TKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVL 365

Query: 709  AELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVY 768
            +++G    + + FG +  H+ R+ N      IT    + E  F T   N++ IQGLL+  
Sbjct: 366  SKIGERGVKDSLFGLIYFHSLRYHNLNATTNIT-SVSNAEKPFATTVINMKTIQGLLRSI 424

Query: 769  LRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYL 828
            L+ NP +FLP++  ++++  + ++ L  +GK +V   L +LT    ++   ++  + L+ 
Sbjct: 425  LKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFT 484

Query: 829  PASDLVNWIRESGRKRTNV------SRRIEPEEINSIQSFLRFNLSELSLIRDKISILQK 882
              + ++ W+R +  KR          + +EPEEIN IQSFLRFN  E+S  +  ++IL+K
Sbjct: 485  DEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRK 544

Query: 883  LSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFL 942
            + IF  LK+ D   A   L     +L ++  S AF     +     +LS   L  N+ FL
Sbjct: 545  VLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFL 604

Query: 943  KECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDN---KGLFGT 999
            ++CT +L   +  +L  K+  WWK Y E L     Y K FPN VKP    +   +   G 
Sbjct: 605  EQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGG 664

Query: 1000 YVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQD 1059
            ++E KR + E++L+ QIK+  + L+ L  E+   HE LAEELS Y+EF+   L    +  
Sbjct: 665  FIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQRSLVA 724

Query: 1060 FTVGKINTLKDTM 1072
            F    I+ L++ +
Sbjct: 725  FATTNISVLQECV 737

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  508 bits (1309), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 354/1132 (31%), Positives = 593/1132 (52%), Gaps = 86/1132 (7%)

Query: 5    LPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQDL 64
            +P LLNPLV++VFNC     SPL+K+++SL D  FIL+VP    L +Y D +T   L +L
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 65   CYTYEFVANHIIIL--KKDSKYSDQE-----------FKTLNGKTVLIRSQNGI-----V 106
            C++ EFV++HI+     KD+K  D +           F T NGK +     NG+     +
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKII-----NGLFSKQSL 115

Query: 107  LTGDGFPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLM--SDAVKNDELQVFGVR 164
             T DGF  +   +I   E   +F +YL+GS  F LI+ID+PL+  +  +K ++L  F   
Sbjct: 116  YTTDGFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNL 175

Query: 165  STNTSSLPLS-TDLTQREVSSFEQLF---RLHPQLGDRFSGLFKEQRQEINANFKGLDSL 220
            + NT+    S  +L+  EV           +H Q   +F  +F+  R+EI    +    L
Sbjct: 176  TINTTPSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEIT---QSESML 232

Query: 221  VDFFDKFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQI-----TQLYRDDE 275
            +  F K   + ++ +  +  F     + Q +  YVE N+YDD+W+ +      +  ++ +
Sbjct: 233  IPGFRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQ 290

Query: 276  IEATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSE 335
             E++   ++ ++I++ Q+ T FY  K SKF LK +   EK++ +AT  F+ L+ + ++ E
Sbjct: 291  SESS---DIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVE 347

Query: 336  KTKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFS 395
            K +++++TLQ L+            V I ADTL+ L +L++ R+++KN++ HL+YLQNF 
Sbjct: 348  KCRVLVETLQILS--KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFH 405

Query: 396  LDENTIKFGVVAYALSTLEAVLCYFEDAE-NSGKIRSLEFNCRRNKQFWDHLS-CKAVSF 453
             DEN+IKFG++ YA+STLEAV+CY E  E +  ++  +E N    ++F   L+  K VS 
Sbjct: 406  QDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSN 465

Query: 454  DSL--KSYRDILRIRTAGGESCLSVCIQKGNFSG---IECLLQNFEHELPLEDILDDQTI 508
            + L    Y    R R   G S LS+CI   NF      E L +N+E     ED+L+DQT 
Sbjct: 466  EGLDLSKYSHNFRYRNGDGNSTLSLCII--NFKNDIFFELLSENYESYFAFEDLLEDQTT 523

Query: 509  NGSTLLMQTLETGNTRMADVLLEILCQSCTIXXXXXXXXXXXXWKRTAAHYLTQDLQMAD 568
             G+TLLMQ+L+  N  + + L +I+ ++ T             +KR   HY+     +  
Sbjct: 524  EGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQ 583

Query: 569  KIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYE-IRGENFNFSAHK 627
            KIG +  W++KD +G TPL  IFRSYD   Y  MV  +F  A +WY  ++   F F  H 
Sbjct: 584  KIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHT 643

Query: 628  DTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIM 687
            D+KGNTLLH++K NI  LL+  ++D+N+VN +GL+PL     Y+R +NV+ +L+D RLI 
Sbjct: 644  DSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIF 703

Query: 688  EKHQKSLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAH--TFRFENNRWFLWITLKGK 745
                   FL  +   K+  I +   +    +  F  ++A    FR  N R  +  +   +
Sbjct: 704  SSFD---FLKQYPNTKSAPILSH--YCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKE 758

Query: 746  DRETDFQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLV-SVGKLE-VH 803
            D +    +    ++ ++ L ++ L+++P +F P++ +L++L  + KT    S+ K     
Sbjct: 759  DAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSSFCS 818

Query: 804  RFLCELTLVLKLICQKEEFKKALYLPASDLVNWIR-------ESGRKRTNVSRRIEPEEI 856
            + L +LT  L  + + E    A     + L   I        E   KR +  ++++PE I
Sbjct: 819  KVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESI 878

Query: 857  NSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQA 916
             +I +FL++ L  L  ++  I  L+K SI S+LK++DI++++ ++ +    +    I +A
Sbjct: 879  GTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRA 938

Query: 917  F-GISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLD-- 973
                S +  K   + S  +L   I F + C + ++  ID LL  K+  WWK Y +LL+  
Sbjct: 939  MVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELS 998

Query: 974  -------ARNQYNKNFPNS---VKPHLDDNK---GLFGTYVEGKRSKLEEKLSAQIKSCL 1020
                   AR   +K  PN+   V     D+    G+ GT++EGKR K +E+  A I    
Sbjct: 999  KEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQ 1058

Query: 1021 ERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKDTM 1072
             RL+ L  E+   +  +  E  I++ F++ ++ + +++ +    IN LK ++
Sbjct: 1059 RRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKKSL 1110

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  466 bits (1198), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 372/1191 (31%), Positives = 606/1191 (50%), Gaps = 143/1191 (12%)

Query: 3    YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62
            YHLP LLNPL+N+VFNCP PS SP KK+F +L++Q+FIL+VP  + LL+Y D     SL 
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 63   DLCY-TYEFVANHIIIL------KKDSKYS--DQEFKTLNGKTVLIRSQNGIVLTGDGFP 113
            +LCY   +F+ +HI+         KDS  +  D+EF  LNG   +I+ ++ I+ T   F 
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFS 123

Query: 114  SKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPL-MSDAVKNDELQVFGVRSTNTSS-- 170
            + +R KI       NFNDY  GSK F LI IDKP+ +S  + ND L+     + +  S  
Sbjct: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQE 183

Query: 171  --LPLSTDLTQREVSSFEQLFRLHPQLGDRFSGL---FKEQRQEINANFKGLDSLVDFFD 225
               PL  DL+Q+  SSFE     +     +F  L   +K +  E+  N K    LV+   
Sbjct: 184  KETPLVQDLSQQSKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVN--- 240

Query: 226  KFNYEAFELI-----RHERRFENHSKLHQTVHNYVELNLYDDIWKQITQL-------YRD 273
                EAF  I       +++     +L Q  H+Y+E +LYD+IW +I ++       Y D
Sbjct: 241  ----EAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYAD 296

Query: 274  DEIEATYDYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSH 333
            D+ +A +   L+K+ +I ++   FY      F LK V   EK+L+ +  C  +L  + S+
Sbjct: 297  DQ-KAQH---LIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSY 348

Query: 334  SEKTKIIMDTLQTLTDYS----EFPDADIEDVTIDADTLIGLMVLVVCRSQV--KNLKSH 387
            +EK+ I++++LQ +TD +    E  D +     IDAD L+ L+ LV+ +S +   +LK++
Sbjct: 349  TEKSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKAN 408

Query: 388  LFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLS 447
            L+YL+ FS DE++  FG++ Y ++T   V    E+  +  +++  + +        D LS
Sbjct: 409  LYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKE-KSDLIEELIMTDDLS 467

Query: 448  CKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQT 507
              + +F++ K  + +L  R + GES L++ I           L  +E  L ++ I +DQ+
Sbjct: 468  TLSSTFENDK--KTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQS 525

Query: 508  INGSTLLMQTLETGNTRMADVLLEILCQSC-TIXXXXXXXXXXXXWKRTAAHYLTQDLQM 566
            ++ STLL+Q + + N   A +L+++L Q+C                 R   HYL  +L +
Sbjct: 526  MDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTI 585

Query: 567  ADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAH 626
               IG F +W+ KD++G TPLF IFRSYD  +Y ++V   F+ A KWY      F  + H
Sbjct: 586  LKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDH 645

Query: 627  KDTKGNTLLHVMKTNIEILLEQEN-----IDVNEVNKKGLTPLMVYVKYNRLDNVKCILR 681
             D+ GN+LLH+++ NI ILL+        I++N++N KG TPLM+Y KY R DN++ I++
Sbjct: 646  DDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIK 705

Query: 682  DNRLIMEKHQKSLFLNCFDYVKNPVIQAELG-FHAAEKTKFGEVVAHTFRFENNRW---- 736
            + +LI  K Q   F++CFDY  +  I  ++G F  +    FG+++  + + + +      
Sbjct: 706  EEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLP 765

Query: 737  -FLWITLKGKDRETDFQTVKHNIR--AIQGLLQVYLRRNPMSFLPIDAVLEDL------- 786
              L+I       E D  T+   ++  ++   L++  R+  +SFLP+D +L +        
Sbjct: 766  RGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKK 825

Query: 787  ----HEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKA--LYLPASDLVNWI--R 838
                + +    L  + KL + RFL  L   L ++   ++   A  L L  ++L+ WI   
Sbjct: 826  SKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIE 885

Query: 839  ESGRKRTNVSRRIEPE----------------EINSIQSFLRFNLSELSLIRDKISILQK 882
            ES  +R++ +   + +                 IN IQ+FL+FNL+EL+ I   + +L K
Sbjct: 886  ESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSK 945

Query: 883  LSIFSELKAQDINQARCMLFSQSVRLED----TAISQAFGISGLSEKDSEDLSATILTS- 937
            L IF  LK  DI+ A+         L +    + I ++F +   S  D  D    +L S 
Sbjct: 946  LVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYD--DDKGVLLESL 1003

Query: 938  --NIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSV--------- 986
              +I F  ECT KL+  ++ +++ K+  WWKLY ELL+    Y+KNFPN V         
Sbjct: 1004 HEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLL 1063

Query: 987  ---------------------------KPHLDDNKGLFGTYVEGKRSKLEEKLSAQIKSC 1019
                                       +   + N G+F   +E +++KLE K S  I   
Sbjct: 1064 SGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDET 1123

Query: 1020 LERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKD 1070
            +  L++L   +  +HE LAEEL+ Y+EFK  +    I+++F    I  L++
Sbjct: 1124 ISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEE 1174

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  436 bits (1121), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 353/1206 (29%), Positives = 581/1206 (48%), Gaps = 167/1206 (13%)

Query: 8    LLNPLVNSVFNCPTPST--SPLKKIFASLRDQRFILVVPNVNILLHYQDLDT-------- 57
            +LNPL+  +F+     T   PLKK+F  L+  +F+L+ P  +ILL+Y D           
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 58   GSS---LQDLCY-TYEFVANHIIILKKDSKYSDQ-EFKTLNGKTVLIR--SQNGIVLTGD 110
            GS+   L+DLC  +Y+F+A+HI++       +DQ   +++NGKT+ I+  + NG +  G+
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124

Query: 111  GF---PSK------RRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF 161
                 PSK      +  KI   +L+ NFN YL+G + +P+ +ID PL  + +KN+ L  F
Sbjct: 125  MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184

Query: 162  GVRSTNTS-----SLPLS--TDLTQREVSSFEQLFRLHPQLG--DR--FSGLFKEQR--- 207
              +   T      + P++   + T+ +      + +L P +   DR  F+ L K+ R   
Sbjct: 185  DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIW 244

Query: 208  ---------------------QEINANFKGLDSLVDFFDKFNYEAFELIRHERR--FENH 244
                                 Q I+ N    D  ++     N + FE ++ E+R  F +H
Sbjct: 245  QPLINSYRATTKHIEQAEGLPQAIDEN--QTDVNIEMVRDINCDLFEQLKDEKRYNFLSH 302

Query: 245  SKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPEKQSK 304
              L + ++ ++E+ L+DDIW +I+  +     E+ +D++ L  I+++++   FY     K
Sbjct: 303  DNLMELIYEFIEIKLHDDIWGRISFKFT----ESDFDFSKLSNISVNKLLLNFYSTNNFK 358

Query: 305  -FSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIEDVTI 363
             F L  +   EK + +A   F++     +  EK+  ++ TLQ LT         I  +T 
Sbjct: 359  NFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT---------INKLT- 408

Query: 364  DADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA 423
            DADTLIGL+ +V+CR +V+NLKSHLFYLQNF+ D NTIKFG++ Y++STLEA+  YF+  
Sbjct: 409  DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHI 468

Query: 424  ENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNF 483
             +S K   + F C +    +D +     S D+     DIL  R+  GES LS+CI     
Sbjct: 469  SHSHKADLIAF-CDKLHNLYDTILNNIKSLDN-----DILSYRSQNGESLLSLCIINNKM 522

Query: 484  SGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIXXXX 543
                 LL  +EH  P+EDILDD  +NGS+LLMQ  +  N   +++L+ IL  SC      
Sbjct: 523  DIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKNSCNEEELR 582

Query: 544  XXXXXXXXWKRTAAHY--LTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQ 601
                    + R+ AHY  +   + +  + G   DWE KDI   TPL  IF+ +       
Sbjct: 583  IFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNES 642

Query: 602  MVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ----ENIDVNEVN 657
             +   FR    WY+I  + FN  AH D  GN LLHVMK  I  L+E     E I++N  N
Sbjct: 643  FIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANN 702

Query: 658  KKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAE 717
             KGL+P MVY K NR DN++ IL++  LI  + Q    +   + + N  +   L  H   
Sbjct: 703  NKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTN-LYNSKVNHLLATHFLR 761

Query: 718  KTKFGEVVAHTFRFENNR---------WFLWITLKGKDRETDFQTVKHNI--------RA 760
               F  +  H+ RF +           W + I++   ++E++F T   +I        + 
Sbjct: 762  TLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISI--LEKESEFPTSHPSICRTKTLKLKT 819

Query: 761  IQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTG--------------LVSVGKLEVHRFL 806
            I+ LL  ++R+   S LP+ + LE  +++ K+                + + KLE+   L
Sbjct: 820  IKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNL 879

Query: 807  CELTLVLKLICQKEEFKKALYLPASDLVNWIRESGRK------------------RTNVS 848
              ++  L  +    +F   L      L  +++ + +K                   T +S
Sbjct: 880  KLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELS 939

Query: 849  RRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRL 908
            +  +PE+IN+IQ+F++FNL EL   ++ I+ ++ +SI  + K  D+N ++      ++++
Sbjct: 940  KAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKI 999

Query: 909  --------------EDTAISQAFGISGLSEKDSEDLSATILT---SNIDFLKECTNKLVG 951
                          +   I+ A+      + +S D     L     N+ F ++   KL  
Sbjct: 1000 GINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYY 1059

Query: 952  KIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKR-----S 1006
              + L  G +  WW  Y  LLD   QYNK++PN  K  +++N   F T  + +      +
Sbjct: 1060 DFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNR-KIDINNNFESFNTMFDKRVNFDSIT 1118

Query: 1007 KLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKIN 1066
              E  +   IK+    L+    ++K  HE LA EL+ ++ FK  ++R  II+  T+  I 
Sbjct: 1119 HFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIK 1178

Query: 1067 TLKDTM 1072
             LKD +
Sbjct: 1179 ILKDNI 1184

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  267 bits (683), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 242/829 (29%), Positives = 393/829 (47%), Gaps = 99/829 (11%)

Query: 256  ELNLYDDIW-KQITQLYRDDEIEATYDYNLLKYIAISQVP-TPFYPEKQSKFSLKKVTHF 313
            E  LY  IW K + Q      I+  Y      YI+  ++    +Y    +KFSL+ V   
Sbjct: 179  EARLYSSIWNKLVHQTSEPQNIDKFYGC----YISFHELNINDYYSLPFNKFSLRDVVFI 234

Query: 314  EKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIEDVTIDADTLIGLMV 373
            E  ++ A   F +L  S S  EK  I++ T   LT  S+ P  +I     DAD L+  M+
Sbjct: 235  ENVVDLACKEFVKLRESLSFDEKIDILLSTFNILT--SKLPQLEI-----DADNLLNFML 287

Query: 374  LVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDAENSGKIRSLE 433
            +++ R ++ NL  H  YLQNF+  +N   FG++ YA+STL AVL Y ++           
Sbjct: 288  IIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN----------- 335

Query: 434  FNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNF 493
             N  + K++ D +    +S + LK        R   GES L  CI   +   +  LL + 
Sbjct: 336  -NLDKFKRYTDAIQDSKISEEKLK-------YRNENGESYLCHCIITKDNDTLRELLFSS 387

Query: 494  EH--ELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTIXXXXXXXXXXXX 551
            E+    P+EDILDDQTI+GSTLLM  ++  NT  A +L+ I+  + T             
Sbjct: 388  EYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDE 447

Query: 552  WKRTAAHYLTQDLQMADKIGIFFDWEAKDI-SGHTPLFAIFRSYDHP--DYAQMVTNAFR 608
              R   H++T    +  KIG + +W  KD  +G TPLF IFRSYD     Y +M   +FR
Sbjct: 448  NNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFR 507

Query: 609  TASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYV 668
             A     +   +F    H D   NTLLH++KTNI+++L   ++ +N  N  G+TPLMV+ 
Sbjct: 508  FA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFC 562

Query: 669  KYNRLDNVKCIL----RDNRLIMEKHQ-KSLFLNCFDYVKNPVIQAELG-FHAAEKTKFG 722
            KY RL N++ +L    +D   I E  Q  + + NCF    +  I   LG F     + FG
Sbjct: 563  KYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFG 622

Query: 723  EVVAHTFR--------FENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNP- 773
                H+ +           N++ + ITLK    E  ++T++ NI+ I+ L+ + L  N  
Sbjct: 623  NCFTHSLKQFLHKSKHGNKNQYSVKITLKF---EKKYKTIRFNIKTIKALINMVLTSNSH 679

Query: 774  -MSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASD 832
              SFLP+  V  +L+  G   ++S     +  F+  L ++L  I   E   +  ++  + 
Sbjct: 680  VSSFLPLYKVFNELN--GIASMISTKSKIL--FINNLNVILDTILFLELVPREGFILEAR 735

Query: 833  LVNWIRESGRKRTNV--SRRIEPEEINSIQSFLRFNLSELSLIRDKI-SILQKLSIFSEL 889
            L +++R   + +T    S++++ E+IN I +FL+FNL+EL+  ++ +  IL+++      
Sbjct: 736  LKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQM------ 789

Query: 890  KAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKL 949
                 N     LF Q +   D  +     +         +L+  IL SN   L+   +  
Sbjct: 790  -----NSINLKLFDQRISYMD--LLHCPDVVVHLNNPLWNLNYNILISNFQILENSIDNT 842

Query: 950  VGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLE 1009
            +  +      K+ +WWKL  EL+           N  K   + +  L  ++   K     
Sbjct: 843  LHFLKVFQNEKIRKWWKLNNELI-----------NLTKLASNSDDDLLRSFFNRK----- 886

Query: 1010 EKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYL-RTGII 1057
            EKLS +I   +  +  L  ++   HE LA E++ +++FK  ++ RT ++
Sbjct: 887  EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLVV 935

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  210 bits (534), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 172/284 (60%), Gaps = 12/284 (4%)

Query: 3   YHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQ 62
           YHLP LLNPLVN++FNCP P  SPLKK+FA+L+ +RFIL+ P    LL+Y D+ +   L 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  DLCYTYEFVANHIIILKKDSKYS----DQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRC 118
           DLCY  EF+ ++I+++ ++S  +    D  ++TL+GKTV+I+ +N ++   +GF  +RR 
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIRRRL 123

Query: 119 KITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGVR---STNTSSLP-LS 174
           KI  T++  NFNDY +G+  F ++ ID+PL  + V ND LQ F        N  ++P LS
Sbjct: 124 KILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMPNLS 183

Query: 175 TDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFEL 234
            D  Q+E SSFE +  +HP    +   LF   R        G D     F+    +AF+ 
Sbjct: 184 IDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLA----PGDDPSRSIFESIVQQAFDG 239

Query: 235 IRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEA 278
           ++ +  F+N S L+  +H+Y ELNLYDDIW ++T  ++  E++ 
Sbjct: 240 MKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDT 283

>TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa]
           {ON} Anc_8.876 YML097C
          Length = 503

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 365 ADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCY 419
           ADT I L++  + +S ++NL S++ Y++ F   EN I+ G  +Y LS+L+A + +
Sbjct: 258 ADTFIPLLIYTLLKSDIENLVSNVRYIERFRF-ENFIR-GEESYYLSSLQAAINF 310

>Ecym_2099 Chr2 complement(176120..176743) [624 bp, 207 aa] {ON}
           similar to Ashbya gossypii AAR063C
          Length = 207

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 67/161 (41%), Gaps = 42/161 (26%)

Query: 578 AKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHV 637
           +KD +G+T +     SY H D  +++ N +            + N    +D  G+T LH 
Sbjct: 29  SKDPNGYTAVHGAA-SYGHVDLLRLLVNKYHG----------DINV---RDNDGDTPLHH 74

Query: 638 MK--TNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLF 695
            +     ++++E+ N D    N +G TPL V+                    E+ Q+S+ 
Sbjct: 75  TEDVATAKVIIEELNADFQATNNEGKTPLDVF--------------------EEDQESIE 114

Query: 696 LNCFDYVKN----PVIQAELGFHAAEKTKFGEVVAHTFRFE 732
           L    Y+K     P+ Q  LG  A +  +F + + +T   E
Sbjct: 115 L--IQYMKEKCGLPLNQDSLGIDAEQLAQFKDNLRYTLEHE 153

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 653 VNEVNKKGLTPLMVYVKYNRLDNVKCIL 680
           +N+ NK+G+TPLM+ V  N L  VK +L
Sbjct: 598 INKFNKEGMTPLMIAVGRNHLGTVKLLL 625

>Kwal_23.6218 s23 (1495388..1495996) [609 bp, 202 aa] {ON} YCR051W -
           Hypothetical ORF [contig 15] FULL
          Length = 202

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 574 FDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNT 633
           F  E+KD +G+TP+ A   SY H D  +      +  S  Y     N N +  KD  G+T
Sbjct: 23  FQAESKDPNGYTPIHAAA-SYAHIDLLK------KLCSDPY-----NGNINV-KDNDGDT 69

Query: 634 LLHVMK--TNIEILLEQENIDVNEVNKKGLTPLMV 666
            LH  +  T   ++LE+   D    N +G T L V
Sbjct: 70  PLHHCEDATTARVILEELGGDATLTNNEGKTALAV 104

>NDAI0K00170 Chr11 complement(26066..27586) [1521 bp, 506 aa] {ON}
           Anc_8.876 YML097C
          Length = 506

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 365 ADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCY 419
           AD+ I L++  + +S+V+ L S++ Y++ F L+E     G  +Y LS+++A + +
Sbjct: 283 ADSFIPLLIYTILKSKVQFLVSNVKYIERFRLEE--FLRGEESYYLSSIQAAIDF 335

>TDEL0B00450 Chr2 (79835..81169) [1335 bp, 444 aa] {ON} Anc_8.876
           YML097C
          Length = 444

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 365 ADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCY 419
           AD+ I L++  + +  ++ L S++ Y++ F  +E     G  +Y L++LEA + Y
Sbjct: 237 ADSFIPLLIFTILKGDIRVLVSNVRYIERFRYEE--FIRGEASYYLNSLEAAINY 289

>TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.467
           YMR094W
          Length = 470

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 6/109 (5%)

Query: 855 EINSIQSFLRFNLSELSLIRDKISILQ---KLSIFSELKAQDINQARCMLFSQSVRLEDT 911
           +IN     L   L E+S ++  +  L    KL+I SELK  D +   C   S   + EDT
Sbjct: 159 DINDFNVRLNMELFEMSTMKKLLEYLHRRNKLNIISELKFYDPDIDEC---SNETKHEDT 215

Query: 912 AISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGK 960
            +++   +    +K   D    I  +NI+ + E  N+++   +  +QG+
Sbjct: 216 RVNKQKILENFHKKKLRDSFYDISDTNIELVGEYLNRMLRLTNINIQGE 264

>TBLA0G03380 Chr7 (898442..900025) [1584 bp, 527 aa] {ON} Anc_8.44
            YFL027C
          Length = 527

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 39/74 (52%), Gaps = 11/74 (14%)

Query: 964  WWKLYAELLD-ARNQYNKNFPNSVKPHLDDNK------GLFGTYVEG--KRSKLEEKLSA 1014
            W++L    LD ARN  N+NF N+ KPH D+N+        FG +VE   ++ KL   L  
Sbjct: 76   WYELLLNQLDLARNFSNQNFENA-KPHPDENQVHLDVLRSFG-FVEDHKQKEKLRSLLEK 133

Query: 1015 QIKSCLERLQTLTY 1028
             I + L +  TL Y
Sbjct: 134  IIVNILRKYPTLRY 147

>TDEL0D05360 Chr4 (971225..971935) [711 bp, 236 aa] {ON} Anc_3.88
           YOL102C
          Length = 236

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 656 VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFL----NCFDYVKNPVIQAEL 711
           ++  G  P+ V +++NRL + KC L D   I+E + K  F     +  D  +  VI A  
Sbjct: 31  IDNNGFIPVSVLLRHNRLKSHKCTLEDIHRIVENNDKKRFQIMNKDLEDGGQQEVICATQ 90

Query: 712 GFHAAEKTKFGEVV 725
           G   A  T   EV+
Sbjct: 91  GHSIATITPDNEVL 104

>CAGL0H07755g Chr8 complement(756294..756812) [519 bp, 172 aa] {ON}
           highly similar to uniprot|P53066 Saccharomyces
           cerevisiae YGL242c
          Length = 172

 Score = 31.2 bits (69), Expect = 8.2,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 600 AQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTN-----IEILLEQEN-IDV 653
           + ++++ F T     E   E  N S  KD  GNT LH+         ++ +L+QE  ID+
Sbjct: 21  SDLLSSIFETLGHDAEKIAELINTS--KDPLGNTALHLCCKYGSWEVLDTILDQEGGIDI 78

Query: 654 NEVNKKGLTPLMVYVKY 670
           +  N  G TPL V V+Y
Sbjct: 79  DPQNVDGDTPLHVTVRY 95

>SAKL0B08822g Chr2 (752590..759720) [7131 bp, 2376 aa] {ON} similar to
            uniprot|Q02580 Saccharomyces cerevisiae YBR136W MEC1
            Central regulator of the Mec1p/Tel1p signaling network;
            required for mitotic growth, DNA repair and mitotic
            recombination, regulates phosphorylation of Rad53p,
            required for dmc1 arrest and meiotic recombination;
            similar to phosphatidylinositol (PI)3- kinases required
            for DNA damage induced checkpoint responses in G1, S/M,
            intra S, and G2/M in mitosis
          Length = 2376

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 327  LAFSSSHSEKTKIIMDTLQTLTDYS-EFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLK 385
            L F+S H   T I +  L  L D S +F  AD+E     A+ +  + VL V R ++K   
Sbjct: 1078 LDFASKHGSITDISL-LLGALLDTSHKFRTADLEICQKSANCISMVGVLDVTRHELKRGA 1136

Query: 386  SHLFYLQNFSLDENTIKF 403
            +HL  + NF+    T+KF
Sbjct: 1137 THLNTVCNFNDQNQTVKF 1154

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,227,675
Number of extensions: 5367135
Number of successful extensions: 17362
Number of sequences better than 10.0: 73
Number of HSP's gapped: 17709
Number of HSP's successfully gapped: 73
Length of query: 1088
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 968
Effective length of database: 39,721,479
Effective search space: 38450391672
Effective search space used: 38450391672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)