Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Scer_YGOB_ADL119W (ADL119W)7.195ON96964893e-65
Skud_6.1257.195ON225964197e-53
Suva_6.1147.195ON268963263e-38
KLTH0E04576g7.195ON1151031763e-17
CAGL0D05148g7.195ON108951743e-17
Kwal_55.20373singletonOFF115941623e-15
Kwal_YGOB_ADL119W7.195ON115941623e-15
KLLA0D16192g7.195ON121931521e-13
NCAS0E018207.195ON114901328e-11
ZYRO0D15818g7.195ON118971275e-10
TDEL0H025207.195ON119971242e-09
Kpol_1063.107.195ON1221051214e-09
TBLA0J015107.195ON107811196e-09
KNAG0L012307.195ON128601191e-08
KAFR0G029907.195ON110821152e-08
TPHA0C045207.195ON1351021147e-08
NDAI0G019907.195ON101711111e-07
Ecym_43817.195ON120991083e-07
SAKL0F07480g7.195ON11390936e-05
ADL119W7.195ON18587770.022
KLLA0A09691g5.39ON69440632.0
SAKL0H03344g4.236ON88582622.2
CAGL0J08371g1.65ON62267613.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scer_YGOB_ADL119W
         (96 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...   192   3e-65
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)        166   7e-53
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)        130   3e-38
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    72   3e-17
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    72   3e-17
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    67   3e-15
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    67   3e-15
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    63   1e-13
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    55   8e-11
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...    54   5e-10
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...    52   2e-09
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    51   4e-09
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    50   6e-09
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    50   1e-08
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    49   2e-08
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    49   7e-08
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    47   1e-07
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    46   3e-07
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    40   6e-05
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    34   0.022
KLLA0A09691g Chr1 (849221..851305) [2085 bp, 694 aa] {ON} simila...    29   2.0  
SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} simila...    28   2.2  
CAGL0J08371g Chr10 complement(833113..834981) [1869 bp, 622 aa] ...    28   3.5  

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 96

 Score =  192 bits (489), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%)

Query: 1  MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQ 60
          MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQ
Sbjct: 1  MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQ 60

Query: 61 SFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI 96
          SFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI
Sbjct: 61 SFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI 96

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score =  166 bits (419), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 88/96 (91%)

Query: 1   MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQ 60
           MNVP APTPN+HLNIPDLRFEKVFKKALHRELAPSSS+  K  VITKVVVRDVLLMPLLQ
Sbjct: 130 MNVPLAPTPNRHLNIPDLRFEKVFKKALHRELAPSSSVPSKWAVITKVVVRDVLLMPLLQ 189

Query: 61  SFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI 96
           SFVLSL LMGVK+WL +IRL+GRTLG R+RQRLFPI
Sbjct: 190 SFVLSLVLMGVKDWLRFIRLEGRTLGGRLRQRLFPI 225

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score =  130 bits (326), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (87%)

Query: 1   MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQ 60
           MNVP+APTPNK LNIPDLRF KVF++AL+R+L PS+S SRK  V+ KVVVRDVLLMPL+Q
Sbjct: 173 MNVPSAPTPNKQLNIPDLRFGKVFERALYRDLTPSASRSRKLAVVAKVVVRDVLLMPLVQ 232

Query: 61  SFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI 96
           S VLS+ L+GVK+WL YIRLKG TLG R+RQRLFPI
Sbjct: 233 SIVLSVVLIGVKDWLRYIRLKGFTLGARLRQRLFPI 268

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score = 72.4 bits (176), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 60/103 (58%), Gaps = 12/103 (11%)

Query: 1   MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRK------------AGVITKV 48
           MN     T  + + +PDLRFE+ F++AL RE + +   + +            A VI KV
Sbjct: 1   MNGLKPMTGAQKVAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDADATISASVICKV 60

Query: 49  VVRDVLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRIRQ 91
           V+RDVLLMP LQ  + + AL+ +K WL  +R++G+ +G RI +
Sbjct: 61  VLRDVLLMPFLQGILWTSALIALKPWLHMVRIRGQLVGHRIYE 103

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa]
          {ON} some similarities with KLLA0D16192g Kluyveromyces
          lactis and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 71.6 bits (174), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 10/95 (10%)

Query: 10 NKHLNIPDLRFEKVFKKALHRELAPSSSLSRK----------AGVITKVVVRDVLLMPLL 59
          N  + IPD RFE+ F++A+ RE+A  ++LS K          A VI KVVVRDVLLMP +
Sbjct: 2  NGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSAYVICKVVVRDVLLMPFI 61

Query: 60 QSFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLF 94
          QS + +  L+G+K WL  +   GR  G+ + + L+
Sbjct: 62 QSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALY 96

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score = 67.0 bits (162), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 13/94 (13%)

Query: 8   TPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAG------------VITKVVVRDVLL 55
           TP K ++IPDLRFE+ FK AL RE   +     K G            +I KVV+RDVLL
Sbjct: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLL 67

Query: 56  MPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
           +P LQ  + +  L+ ++ WL +++++G  LG RI
Sbjct: 68  LPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRI 101

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 67.0 bits (162), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (58%), Gaps = 13/94 (13%)

Query: 8   TPNKHLNIPDLRFEKVFKKALHRELAPSSSLSRKAG------------VITKVVVRDVLL 55
           TP K ++IPDLRFE+ FK AL RE   +     K G            +I KVV+RDVLL
Sbjct: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLL 67

Query: 56  MPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
           +P LQ  + +  L+ ++ WL +++++G  LG RI
Sbjct: 68  LPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRI 101

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 12/93 (12%)

Query: 14  NIPDLRFEKVFKKALHRELAPSSSLSRKAG------------VITKVVVRDVLLMPLLQS 61
           ++PDLRFE+ FK++L +E    + L+                ++ KVV RD+L+ P LQ 
Sbjct: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQG 76

Query: 62  FVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLF 94
             LSL  +  K WL Y R  GR +G  I + LF
Sbjct: 77  VFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLF 109

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
          Anc_7.195
          Length = 114

 Score = 55.5 bits (132), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 15/90 (16%)

Query: 13 LNIPDLRFEKVFKKALHRELA----------PSSSLSR-----KAGVITKVVVRDVLLMP 57
          LNIPDLR E+ FK+A+ +E            P S+++      KA + +KV++RD+L+MP
Sbjct: 6  LNIPDLRVEQTFKRAVAKETKEYIIKNKATFPRSTITELTRVEKAVICSKVILRDILVMP 65

Query: 58 LLQSFVLSLALMGVKEWLSYIRLKGRTLGD 87
           LQS   +  L+ +K WL      GR +G 
Sbjct: 66 FLQSVAWTGFLIVLKPWLRTTVTFGRKMGS 95

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score = 53.5 bits (127), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 22/97 (22%)

Query: 15  IPDLRFEKVFKKALHRELAPSSSLSRK----------------------AGVITKVVVRD 52
           IPD RFE  FK+AL+RE     +L  K                      + V+ KVV RD
Sbjct: 7   IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 53  VLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
           V+ MPL+Q  + +  L+ +K WL  +   GR  G  I
Sbjct: 67  VIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFI 103

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score = 52.4 bits (124), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 46/97 (47%), Gaps = 22/97 (22%)

Query: 15  IPDLRFEKVFKKALHRELAPSSSLS-RKAGVI---------------------TKVVVRD 52
           +PD RFE+ F++AL RE     +   RK GV+                      KVV+RD
Sbjct: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66

Query: 53  VLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
           V+ MPL+Q  + +  L+ +K WL      GR LG  I
Sbjct: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSI 103

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 51.2 bits (121), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 22/105 (20%)

Query: 6   APTPNKHLNIPDLRFEKVFKKALHRELAPSSSLS-RKAGVIT------------------ 46
           AP P  +  +PD+RFE+ F +A+++E       S +K G+ T                  
Sbjct: 4   APGPT-NFPVPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVTTYI 62

Query: 47  --KVVVRDVLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
             KV+VRD+L+MP +Q  + S  L+ +K WL  +   GR  G  I
Sbjct: 63  VWKVIVRDMLIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFI 107

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa]
          {ON} Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 50.4 bits (119), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 15 IPDLRFEKVFKKALHRELAPSSSLS---------RKAGVITKVVVRDVLLMPLLQSFVLS 65
          IPD RFE  F++ L +EL  ++  S         RK   + KV+ RDV+ MP +Q   + 
Sbjct: 12 IPDTRFESTFRRKLDKELNKNNVNSNSIIKDERVRKLLCLGKVICRDVIFMPFVQGMFMC 71

Query: 66 LALMGVKEWLSYIRLKGRTLG 86
           A + +K WL  +   G+ +G
Sbjct: 72 GAFILIKPWLLKLLRNGKNIG 92

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON}
          Anc_7.195 Scer_YGOB_ADL119W
          Length = 128

 Score = 50.4 bits (119), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%)

Query: 13 LNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQSFVLSLALMGVK 72
          + IP++RF  VF  AL  E A  +       ++ KVV +DVLLMP LQSF+ +  L+ +K
Sbjct: 34 IKIPEMRFNYVFNNALKAEAARHNVAEPTTWMVCKVVCKDVLLMPFLQSFLWTALLISMK 93

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
          Scer_YGOB_ADL119W
          Length = 110

 Score = 48.9 bits (115), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 10 NKHLNIPDLRFEKVFKKALHREL-------APSSSLSRKAGVITKVVVRDVLLMPLLQSF 62
          N +L IPD RF  VF+KA+ +EL          +    K  +I KV+ RDV+LMP +QS 
Sbjct: 9  NNNLAIPDTRFGYVFRKAVQKELRKQVKETDSDNKHINKNLIICKVIARDVILMPFIQSI 68

Query: 63 VLSLALMGVKEWL-SYIRLKGR 83
          + +  L+  K  L  +IR   R
Sbjct: 69 LWTGFLISFKPCLRGFIRFCQR 90

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 48.5 bits (114), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 21/102 (20%)

Query: 9   PNKHLNIPDLRFEKVFKKALHRELAPSSSLS-RKAG--------------------VITK 47
           P + L +PD+R E+ F  AL +E         +K G                    ++ K
Sbjct: 19  PQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWK 78

Query: 48  VVVRDVLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
           V++RD++LMP +Q  + +  LM VK WL  +   GR  G  I
Sbjct: 79  VILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYI 120

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
          Anc_7.195
          Length = 101

 Score = 47.4 bits (111), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 9/71 (12%)

Query: 11 KHLNIPDLRFEKVFKKALHRE---LAPSS------SLSRKAGVITKVVVRDVLLMPLLQS 61
          K + IPD RF++VF+ AL RE   L P +      +L  ++ VI KV++RDV+L+P +QS
Sbjct: 2  KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVIFKVILRDVILLPFIQS 61

Query: 62 FVLSLALMGVK 72
           + +  L+  K
Sbjct: 62 VLWTEFLIVCK 72

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 46.2 bits (108), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 20/99 (20%)

Query: 11  KHLNIPDLRFEKVFKKALHRE-----------LAPSSSL--SRKAG-------VITKVVV 50
           K L IPD+RFE+ F  AL +E           L  S  +  S   G       V+ KV+V
Sbjct: 4   KPLAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAKVIV 63

Query: 51  RDVLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89
           RDV+L+PL+   + +  L+ +K WL      GR LG  I
Sbjct: 64  RDVVLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGI 102

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON}
          conserved hypothetical protein
          Length = 113

 Score = 40.4 bits (93), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 11/90 (12%)

Query: 8  TPNKHLNIPDLRFEKVFKKALHRELA-------PSSSLSRKAGVI----TKVVVRDVLLM 56
          TP + + +PD RFE+ FK AL +E           ++L   A V      KVVVRDVLLM
Sbjct: 7  TPIQTIVVPDTRFEQTFKNALKKEAKRMKAARLGITTLDDNAPVTPMVVAKVVVRDVLLM 66

Query: 57 PLLQSFVLSLALMGVKEWLSYIRLKGRTLG 86
          PL+Q  + +  L+ +K WL     +GR  G
Sbjct: 67 PLVQGVLWTSFLIAIKPWLRNAVWQGRRFG 96

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 34.3 bits (77), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 48/87 (55%), Gaps = 14/87 (16%)

Query: 11  KHLNIPDLRFEKVFKKALHRELA----------PSSSLSRKAGV----ITKVVVRDVLLM 56
           K + IPD+RFE+ F+ AL +E A            ++   +AG+    + KVVVRDVLLM
Sbjct: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADGEAGISALVVAKVVVRDVLLM 137

Query: 57  PLLQSFVLSLALMGVKEWLSYIRLKGR 83
           PL+Q  + +  L+ +K  L    L GR
Sbjct: 138 PLVQGALWTGLLITMKPCLPLCMLGGR 164

>KLLA0A09691g Chr1 (849221..851305) [2085 bp, 694 aa] {ON} similar
           to uniprot|P53326 YGR266W Saccharomyces cerevisiae
           probably contains a single transmembrane span
          Length = 694

 Score = 28.9 bits (63), Expect = 2.0,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 57  PLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLFPI 96
           P ++S +    L    EW  Y   KG T   R  QR FPI
Sbjct: 229 PEMRSDMDQFYLKEYLEWFGYGHWKGSTENSRTTQRCFPI 268

>SAKL0H03344g Chr8 (318176..320833) [2658 bp, 885 aa] {ON} similar
           to uniprot|P11325 Saccharomyces cerevisiae YLR382C NAM2
           Mitochondrial leucyl-tRNA synthetase also has a direct
           role in splicing of several mitochondrial group I
           introns indirectly required for mitochondrial genome
           maintenance
          Length = 885

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 14/82 (17%)

Query: 1   MNVPTAPTPNKHLNIPDLRFEKVFKKALHRELAPSSSLSR------KAGVITKVVVRDVL 54
           M+ P+AP      +IP++ FEK+  K+ +    P+  +SR      +A ++ +  V DVL
Sbjct: 619 MSDPSAPVIKGTGDIPNISFEKM-SKSKYNGADPAECISRHGPDATRAHILFQAPVNDVL 677

Query: 55  LMPLLQSFVLSLALMGVKEWLS 76
                        ++G++ WL+
Sbjct: 678 NWD-------ESKIVGIERWLA 692

>CAGL0J08371g Chr10 complement(833113..834981) [1869 bp, 622 aa]
           {ON} similar to uniprot|P53835 Saccharomyces cerevisiae
           YNL279w PRM1
          Length = 622

 Score = 28.1 bits (61), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 12  HLNIPDLRFEKVFKKALHRELAPSSSLSRKAGVITKVVVRDVLLMPLLQSFVLSLALMGV 71
           H+ +P +   ++   A H ++ PSS+ S     + K+V  ++     L    + LAL+G+
Sbjct: 543 HIKLPRINTTELINIAGHTKMLPSSNESHMFDQVEKIV--NIARKTALNELYVPLALIGI 600

Query: 72  KEWLSYI 78
             WL+ I
Sbjct: 601 --WLTQI 605

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,321,698
Number of extensions: 302235
Number of successful extensions: 1015
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1002
Number of HSP's successfully gapped: 24
Length of query: 96
Length of database: 53,481,399
Length adjustment: 67
Effective length of query: 29
Effective length of database: 45,798,777
Effective search space: 1328164533
Effective search space used: 1328164533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)