Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H26246gna 1ON55155125060.0
TDEL0G04770singletonON52651616950.0
KLLA0E09901gna 1ON56052815560.0
Kwal_56.22530na 1ON55432212981e-174
KLTH0C10450gna 1ON56633012921e-173
Ecym_24956.337ON4352602504e-22
NDAI0K015506.337ON4312552362e-20
AAR044W6.337ON4102532319e-20
YNR029C6.337ON4292622291e-19
Smik_14.3586.337ON4662672293e-19
CAGL0M10747g6.337ON4322602257e-19
KLTH0A06688g6.337ON4102742239e-19
Skud_14.3606.337ON4292632202e-18
TPHA0H022906.337ON4543252203e-18
Suva_14.3836.337ON4332632193e-18
SAKL0A01342g6.337ON4082752184e-18
KAFR0C045706.337ON4292612185e-18
Kwal_23.63166.337ON4082662158e-18
KNAG0D004106.337ON4252642141e-17
NCAS0A045206.337ON4422082105e-17
Kpol_325.26.337ON4392632096e-17
KLLA0C08613g6.337ON4222622061e-16
TBLA0F041006.337ON4663262052e-16
ZYRO0D08272g6.337ON4102631953e-15
TDEL0A075206.337ON4242651864e-14
TBLA0C028201.285ON73796723.9
TBLA0C025303.396ON81844714.9
KLLA0F02926g2.462ON33925697.6
KLTH0F11352g3.396ON63155698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H26246g
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H26246g Chr8 complement(2311294..2312949) [1656 bp, 551 aa]...   969   0.0  
TDEL0G04770 Chr7 (871701..873281) [1581 bp, 526 aa] {ON}              657   0.0  
KLLA0E09901g Chr5 complement(877366..879048) [1683 bp, 560 aa] {...   603   0.0  
Kwal_56.22530 s56 (171195..172859) [1665 bp, 554 aa] {ON} YNR029...   504   e-174
KLTH0C10450g Chr3 complement(867872..869572) [1701 bp, 566 aa] {...   502   e-173
Ecym_2495 Chr2 complement(970589..971896) [1308 bp, 435 aa] {ON}...   100   4e-22
NDAI0K01550 Chr11 (351617..352912) [1296 bp, 431 aa] {ON} Anc_6....    96   2e-20
AAR044W Chr1 (420088..421320) [1233 bp, 410 aa] {ON} Syntenic ho...    94   9e-20
YNR029C Chr14 complement(677199..678488) [1290 bp, 429 aa] {ON} ...    93   1e-19
Smik_14.358 Chr14 complement(635188..636588) [1401 bp, 466 aa] {...    93   3e-19
CAGL0M10747g Chr13 complement(1072542..1073840) [1299 bp, 432 aa...    91   7e-19
KLTH0A06688g Chr1 complement(557036..558268) [1233 bp, 410 aa] {...    91   9e-19
Skud_14.360 Chr14 complement(645289..646578) [1290 bp, 429 aa] {...    89   2e-18
TPHA0H02290 Chr8 complement(545849..547213) [1365 bp, 454 aa] {O...    89   3e-18
Suva_14.383 Chr14 complement(658484..659785) [1302 bp, 433 aa] {...    89   3e-18
SAKL0A01342g Chr1 (129065..130291) [1227 bp, 408 aa] {ON} simila...    89   4e-18
KAFR0C04570 Chr3 complement(914620..915909) [1290 bp, 429 aa] {O...    89   5e-18
Kwal_23.6316 s23 complement(1527371..1528597) [1227 bp, 408 aa] ...    87   8e-18
KNAG0D00410 Chr4 (60526..61803) [1278 bp, 425 aa] {ON} Anc_6.337...    87   1e-17
NCAS0A04520 Chr1 (907999..909327) [1329 bp, 442 aa] {ON} Anc_6.337     86   5e-17
Kpol_325.2 s325 complement(4458..5777) [1320 bp, 439 aa] {ON} co...    85   6e-17
KLLA0C08613g Chr3 (754098..755366) [1269 bp, 422 aa] {ON} simila...    84   1e-16
TBLA0F04100 Chr6 complement(1016306..1017706) [1401 bp, 466 aa] ...    84   2e-16
ZYRO0D08272g Chr4 (716261..717493) [1233 bp, 410 aa] {ON} simila...    80   3e-15
TDEL0A07520 Chr1 complement(1310807..1312081) [1275 bp, 424 aa] ...    76   4e-14
TBLA0C02820 Chr3 complement(674701..676914) [2214 bp, 737 aa] {O...    32   3.9  
TBLA0C02530 Chr3 complement(598108..600564) [2457 bp, 818 aa] {O...    32   4.9  
KLLA0F02926g Chr6 (273193..274212) [1020 bp, 339 aa] {ON} simila...    31   7.6  
KLTH0F11352g Chr6 complement(962701..964596) [1896 bp, 631 aa] {...    31   8.4  

>SAKL0H26246g Chr8 complement(2311294..2312949) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/551 (88%), Positives = 486/551 (88%)

Query: 1   MTVAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQN 60
           MTVAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQN
Sbjct: 1   MTVAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQN 60

Query: 61  HSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFS 120
           HSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFS
Sbjct: 61  HSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFS 120

Query: 121 MEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLA 180
           MEFSEMLLETPGGIPED          MGGLHKITKIDTCVTVIDALNFLSNIETTQFLA
Sbjct: 121 MEFSEMLLETPGGIPEDEEKLLKKVLEMGGLHKITKIDTCVTVIDALNFLSNIETTQFLA 180

Query: 181 DRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXXGLNPVAKILK 240
           DRWGDNGQGEADRTITDLMVDQIEFADVVIINKVS               GLNPVAKILK
Sbjct: 181 DRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSLIKKRKLRKIEKIIKGLNPVAKILK 240

Query: 241 TDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGV 300
           TDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGV
Sbjct: 241 TDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGV 300

Query: 301 NNFVYTARRPFHPERLYSMLKDKFFIIEQTEIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 360
           NNFVYTARRPFHPERLYSMLKDKFFIIEQTEI                            
Sbjct: 301 NNFVYTARRPFHPERLYSMLKDKFFIIEQTEIDDQADGEEMDEDEDGEDKDGEDSSVSDQ 360

Query: 361 XXXXXXXXXXXXAGLTEKQILKNKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTL 420
                       AGLTEKQILKNKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTL
Sbjct: 361 EEEIEEESEDGSAGLTEKQILKNKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTL 420

Query: 421 KGGTPWFAVSGLESVPDDTAKLIKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLN 480
           KGGTPWFAVSGLESVPDDTAKLIKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLN
Sbjct: 421 KGGTPWFAVSGLESVPDDTAKLIKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLN 480

Query: 481 DEEFATFVAATKGKKNILKVEKELATIFEDGFEDWFIFNEEDLEDIAAEGPSKEVVKAID 540
           DEEFATFVAATKGKKNILKVEKELATIFEDGFEDWFIFNEEDLEDIAAEGPSKEVVKAID
Sbjct: 481 DEEFATFVAATKGKKNILKVEKELATIFEDGFEDWFIFNEEDLEDIAAEGPSKEVVKAID 540

Query: 541 EEQYNHVDLVK 551
           EEQYNHVDLVK
Sbjct: 541 EEQYNHVDLVK 551

>TDEL0G04770 Chr7 (871701..873281) [1581 bp, 526 aa] {ON} 
          Length = 526

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/516 (64%), Positives = 397/516 (76%), Gaps = 4/516 (0%)

Query: 8   RKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQNHSVTKKE 67
           ++ PIP+T+LSGFLGSGKTTLLE+ILT NHGLK+AVIINDMS++N+DA LVQ H V+ +E
Sbjct: 5   QRQPIPVTILSGFLGSGKTTLLERILTENHGLKIAVIINDMSQVNVDAALVQQHKVSNQE 64

Query: 68  EKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSMEFSEML 127
           EKLIQLQNGCICCTLRGDLLEEL GL+E G F YIVIESTGIAEPMQVAETFS +FS+ L
Sbjct: 65  EKLIQLQNGCICCTLRGDLLEELLGLSEQGAFDYIVIESTGIAEPMQVAETFSTDFSQAL 124

Query: 128 LETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDNG 187
           L+TPGGIPE+          +GGL K+ KIDTCVTV+DA NFLSNIETT+FLA R+G++G
Sbjct: 125 LDTPGGIPENEELLLKRVVELGGLEKVAKIDTCVTVVDAANFLSNIETTEFLAQRFGESG 184

Query: 188 QGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXXGLNPVAKILKTDYCNVP 247
           Q E++RT+T+LMVDQIEFADV+IINKVS                LNPVAKIL++DYC VP
Sbjct: 185 QNESERTVTNLMVDQIEFADVIIINKVSRVKKNDLLKIGKMISSLNPVAKILRSDYCKVP 244

Query: 248 MEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGVNNFVYTA 307
           ++EIINT L+DFEKAS+SAGWLQSI+EMT+R GF DK KS+LTPKPETEEYGVN+FVY +
Sbjct: 245 IKEIINTGLYDFEKASSSAGWLQSIHEMTLREGFGDKTKSVLTPKPETEEYGVNSFVYNS 304

Query: 308 RRPFHPERLYSMLKDKFFIIEQTEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 367
           RRPFHPERLY +LKDKFFIIE+T                                     
Sbjct: 305 RRPFHPERLYYLLKDKFFIIEET----PTAEEETDNEEGEQEDEEETANEKDEQGDEEED 360

Query: 368 XXXXXAGLTEKQILKNKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTLKGGTPWF 427
                  ++E+++LKNKK S FGPLLRSKGFFWLATRHIMRGEWSSAG MLTLKGG PWF
Sbjct: 361 QDGEEDEVSEEELLKNKKSSPFGPLLRSKGFFWLATRHIMRGEWSSAGLMLTLKGGIPWF 420

Query: 428 AVSGLESVPDDTAKLIKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLNDEEFATF 487
            VSGLE +P+DTA++I+QEFE   GDRRNEIVFIGL I+K AL K LDSCLL D+E+  F
Sbjct: 421 DVSGLEGIPEDTAEIIRQEFEEPHGDRRNEIVFIGLGIDKEALAKTLDSCLLTDKEYEKF 480

Query: 488 VAATKGKKNILKVEKELATIFEDGFEDWFIFNEEDL 523
           +     +KN+LKVE++LA  F+DGFEDW + +++D+
Sbjct: 481 MKIISQEKNLLKVERKLANTFDDGFEDWILIDDDDV 516

>KLLA0E09901g Chr5 complement(877366..879048) [1683 bp, 560 aa] {ON}
           some similarities with uniprot|P53729 Saccharomyces
           cerevisiae YNR029C Hypothetical ORF
          Length = 560

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/528 (56%), Positives = 369/528 (69%), Gaps = 15/528 (2%)

Query: 6   KARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQNHSVTK 65
           KA   PIP+T+LSGFLGSGKTTLLE+ILT+NHG+KVAVIINDMSELN+DA L+++H V  
Sbjct: 12  KAHSGPIPVTILSGFLGSGKTTLLERILTSNHGMKVAVIINDMSELNVDAALIKDHKVAN 71

Query: 66  KEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSMEFSE 125
           KEEKLIQLQNGCICCTLRGDLLEEL  L +N EF YI+IESTGIAEPMQVAETFS EFS+
Sbjct: 72  KEEKLIQLQNGCICCTLRGDLLEELINLHQNNEFDYILIESTGIAEPMQVAETFSSEFSQ 131

Query: 126 MLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGD 185
            LL+TP  +  D          +GGL K+TKIDT VTVIDA+NFL+NIETT FLA+RWGD
Sbjct: 132 TLLDTPDSVTSDERVLLQKVLDLGGLEKLTKIDTTVTVIDAMNFLANIETTDFLANRWGD 191

Query: 186 NGQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXXGLNPVAKILKTDYCN 245
           +GQGEADRT+TDLM+DQIEFADV+IINK                  LN VAKI+KT YC 
Sbjct: 192 SGQGEADRTVTDLMIDQIEFADVIIINKTDRIKKKRLTKIQKIIKSLNLVAKIIKTSYCK 251

Query: 246 VPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGVNNFVY 305
           VPM EI+NT L++FEKA++SAGWL+SINEMT++ G+ DK KS+L+P PET EYGVN+FVY
Sbjct: 252 VPMSEILNTGLYNFEKAASSAGWLKSINEMTLKEGYGDKTKSVLSPTPETVEYGVNSFVY 311

Query: 306 TARRPFHPERLYSMLKDKFFIIEQTEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 365
            +R+PFHP+RLY  LKDKF+IIEQ  +                                 
Sbjct: 312 KSRKPFHPKRLYDALKDKFYIIEQQALAEQEHVDLYEVDEEEKEEERSLAATPDTSKVHE 371

Query: 366 XXXXXXXAGLTEKQILKNKKISSFGPLLRSK------------GFFWLATRHIMRGEWSS 413
                  A    +    +++  S   L+R+K            GFFWLATR+++RGEWSS
Sbjct: 372 LLQSEDEAESESEGDDDDEEELSERELIRNKKNSPFGPLLRSKGFFWLATRYLLRGEWSS 431

Query: 414 AGPMLTLKGGTPWFAVSGL---ESVPDDTAKLIKQEFEGEFGDRRNEIVFIGLDIEKRAL 470
           AGPMLTLKGG PWF V+GL   E +P +   LIK++F+G FGDRRNE+VFIG  I+   L
Sbjct: 432 AGPMLTLKGGIPWFHVAGLDKQEDIPPEALTLIKRDFQGPFGDRRNELVFIGTGIDSVKL 491

Query: 471 TKDLDSCLLNDEEFATFVAATKGKKNILKVEKELATIFEDGFEDWFIF 518
            + LD CLL ++E+  FV  +  + N+LKVE+ L+ +F+DGFEDW ++
Sbjct: 492 KQILDDCLLTEDEYKQFVDCSLKEHNLLKVERRLSELFQDGFEDWLLY 539

>Kwal_56.22530 s56 (171195..172859) [1665 bp, 554 aa] {ON} YNR029C -
           Hypothetical ORF [contig 185] FULL
          Length = 554

 Score =  504 bits (1298), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 242/322 (75%), Positives = 267/322 (82%)

Query: 9   KTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQNHSVTKKEE 68
           K  IPIT+LSGFLGSGKTTLLEKILTTNHG KVAVIINDMSELNID++L+QNH+V +KEE
Sbjct: 8   KKAIPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNIDSSLIQNHNVCQKEE 67

Query: 69  KLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSMEFSEMLL 128
           KLI+LQNGCICCTLRGDLLEEL G+AE G F YIVIESTGIAEPMQVAETFS+EFS+MLL
Sbjct: 68  KLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQVAETFSVEFSDMLL 127

Query: 129 ETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDNGQ 188
           ETPGGIPED          MGGL  + KIDTCVTV+DALNF +NI TTQFLADRWG+NGQ
Sbjct: 128 ETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANINTTQFLADRWGENGQ 187

Query: 189 GEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXXGLNPVAKILKTDYCNVPM 248
           GE++RTITDLMVDQIEFADVVIINK +                LNPVAK +  DYCNVP+
Sbjct: 188 GESERTITDLMVDQIEFADVVIINKKNTVSKKKMQKIRKMIKALNPVAKTVAADYCNVPL 247

Query: 249 EEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGVNNFVYTAR 308
             I+NT L DFEKASTSAGWLQSINEMTVR GF +K  S+LTPKPETEEYGVNNFVY  R
Sbjct: 248 SLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPETEEYGVNNFVYRRR 307

Query: 309 RPFHPERLYSMLKDKFFIIEQT 330
           RPFHPERLY +++DKFFIIEQ 
Sbjct: 308 RPFHPERLYELIRDKFFIIEQA 329

 Score =  181 bits (460), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%), Gaps = 1/136 (0%)

Query: 383 NKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTLKGGTPWFAVSGLESVPDDTAKL 442
           N+  S FG LLRSKGFFWLATR+++RGEWSSAGPMLTL GG PWFAVSGL++VP++   L
Sbjct: 386 NRSKSPFGQLLRSKGFFWLATRYVVRGEWSSAGPMLTLNGGLPWFAVSGLDNVPEEALPL 445

Query: 443 IKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLNDEEFATFVAATKGKKNILKVEK 502
           IK++F+GEFGDRRNE+VFIGL I ++ L++ LDSCLL D+E A F   T  K N L  ++
Sbjct: 446 IKKDFDGEFGDRRNELVFIGLKINEKLLSEVLDSCLLTDKEMAQFKRITD-KHNELVADE 504

Query: 503 ELATIFEDGFEDWFIF 518
           +LA I++DGFEDW I 
Sbjct: 505 KLAKIWDDGFEDWQIM 520

>KLTH0C10450g Chr3 complement(867872..869572) [1701 bp, 566 aa] {ON}
           conserved hypothetical protein
          Length = 566

 Score =  502 bits (1292), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 242/330 (73%), Positives = 273/330 (82%), Gaps = 1/330 (0%)

Query: 1   MTVAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQN 60
           MT  KK  K  IPIT+LSGFLGSGKTTLLEKILTTNHG K+AVIINDMSELNID++LVQ 
Sbjct: 1   MTSDKKVSKA-IPITLLSGFLGSGKTTLLEKILTTNHGFKIAVIINDMSELNIDSSLVQA 59

Query: 61  HSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFS 120
           H+V +KEEKLI+LQNGCICCTLRGDLLEEL G+ E GEF YIVIESTGIAEPMQVAETFS
Sbjct: 60  HNVCQKEEKLIELQNGCICCTLRGDLLEELVGIGERGEFDYIVIESTGIAEPMQVAETFS 119

Query: 121 MEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLA 180
           +EFS++LLETPGGIPE+          MGGL  I K+DTCVTVIDALNFLSNI+TT+FLA
Sbjct: 120 VEFSDILLETPGGIPENEEKLLRKVSDMGGLQAIAKLDTCVTVIDALNFLSNIQTTEFLA 179

Query: 181 DRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXXGLNPVAKILK 240
           DRWG+NGQGEA+RTITDLMVDQIEF+DV+I+NK S                LNPVAK++ 
Sbjct: 180 DRWGENGQGEAERTITDLMVDQIEFSDVIIVNKKSMVSKKKLKEIKKMVKILNPVAKVIA 239

Query: 241 TDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGV 300
           TDYCNVP+  I++T L DFEKAS SAGWLQSINEMTVR GF +K  S+LTPKPETEEYGV
Sbjct: 240 TDYCNVPLSSILDTKLHDFEKASLSAGWLQSINEMTVRDGFGNKGSSVLTPKPETEEYGV 299

Query: 301 NNFVYTARRPFHPERLYSMLKDKFFIIEQT 330
           NNFVY  RRPFHPERLY +++DKFF+IEQ 
Sbjct: 300 NNFVYRRRRPFHPERLYDLIRDKFFVIEQA 329

 Score =  186 bits (472), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 86/139 (61%), Positives = 110/139 (79%), Gaps = 1/139 (0%)

Query: 380 ILKNKKISSFGPLLRSKGFFWLATRHIMRGEWSSAGPMLTLKGGTPWFAVSGLESVPDDT 439
           I KN+  S FG LLRSKGFFWLATR ++RGEWSSAGPMLTL GG PWFAVSGLE VP++ 
Sbjct: 385 INKNRANSPFGKLLRSKGFFWLATRFVVRGEWSSAGPMLTLNGGLPWFAVSGLEDVPEEA 444

Query: 440 AKLIKQEFEGEFGDRRNEIVFIGLDIEKRALTKDLDSCLLNDEEFATFVAATKGKKNILK 499
            +L+K+++EGEFGDRRNE+VFIGLDI ++ L++ LDSCLL D+E+  F   T  K N L 
Sbjct: 445 LELVKKDYEGEFGDRRNELVFIGLDINEKLLSEALDSCLLTDKEYKRFKNITS-KHNALV 503

Query: 500 VEKELATIFEDGFEDWFIF 518
            +++L+ +++DGFEDW I 
Sbjct: 504 ADEKLSKVWDDGFEDWIIM 522

>Ecym_2495 Chr2 complement(970589..971896) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AAR044W
          Length = 435

 Score =  100 bits (250), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 126/260 (48%), Gaps = 39/260 (15%)

Query: 5   KKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNH 61
           +K  +  IP+T+++G+LGSGK+TLLE+I+     LK+AVI+N   D SE+    T+  N 
Sbjct: 79  EKESRQKIPVTVITGYLGSGKSTLLERIVLKGSELKIAVILNEFGDSSEIEKSMTIRNN- 137

Query: 62  SVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETF 119
              K  E+ + L NGC+CC+L+   ++ +  +     G+  YI++E++GIA+P  +A  F
Sbjct: 138 --GKSYEEWLDLGNGCLCCSLKDVGVKAIEAMVARSPGKIDYILLETSGIADPAPIARMF 195

Query: 120 SMEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFL 179
             +                           GL     ID  VTV+D+ + LS ++     
Sbjct: 196 WQD--------------------------EGLSSNIYIDGIVTVLDSEHILSCLDDVTGD 229

Query: 180 ADRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXX--XXXGLNPVAK 237
           +   G+    +   T+  L   QI  AD +++NK+                  G+N +A 
Sbjct: 230 SHWHGEKVVLDDGITVAHL---QIAMADTILLNKIDKLEKSEMAVAQVEDRVQGINALAP 286

Query: 238 ILKTDYCNVPMEEIINTNLF 257
           I  T Y N+ +++I+N + F
Sbjct: 287 IYHTKYGNISLDKILNLHAF 306

>NDAI0K01550 Chr11 (351617..352912) [1296 bp, 431 aa] {ON} Anc_6.337
          Length = 431

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 123/255 (48%), Gaps = 41/255 (16%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTKKEE 68
           IP+T+++G+LGSGK+TLLEKI+     +K+AVI+N   D SE+    T+    S T   +
Sbjct: 70  IPVTIITGYLGSGKSTLLEKIVLKGSDMKIAVILNEFGDSSEIEKAMTIRNQESST---Q 126

Query: 69  KLIQLQNGCICCTLRG---DLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSMEFSE 125
           + + L NGC+CC+L+      +E++   +  G+  YI++E++GIA+P  +A+ F  +   
Sbjct: 127 EWLDLGNGCLCCSLKNVGVKAIEDMIARSP-GKIDYILLETSGIADPAPIAKMFWQD--- 182

Query: 126 MLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGD 185
                                   GL+    ID  VTV+D+ + L  ++         G+
Sbjct: 183 -----------------------DGLNSNVYIDGIVTVLDSEHILKCLDDISPETHWHGE 219

Query: 186 NGQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXX--GLNPVAKILKTDY 243
           N   + + TI      QI  ADV+I+NK                    +N  AKI  T Y
Sbjct: 220 NVITKENLTIAHF---QIAMADVIILNKFDKIENNEKLINEVNVKIGQINSTAKIHFTKY 276

Query: 244 CNVPMEEIINTNLFD 258
             +P+  II+ + +D
Sbjct: 277 GELPLNYIIDLHSYD 291

>AAR044W Chr1 (420088..421320) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNR029C
          Length = 410

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 122/253 (48%), Gaps = 39/253 (15%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTKKEE 68
           IP+T+++G+LGSGK+TLLE+I      +++AVI+N   D SE+    T+  N    K  E
Sbjct: 64  IPVTVITGYLGSGKSTLLEEITKRGSDMRIAVILNEFGDSSEIEKSLTIKNN---GKAYE 120

Query: 69  KLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSMEFSEM 126
           + + L NGC+CC+L+   ++ +  +     G+  YI++E++GIA+P+ + + F  +    
Sbjct: 121 EWLDLGNGCLCCSLKDVGVKAIEAMVSRSPGKIDYIILETSGIADPVPIVKMFWQD---- 176

Query: 127 LLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDN 186
                                  GL+    ID  VTV+DA + ++ ++         GD 
Sbjct: 177 ----------------------EGLNSCIYIDGIVTVLDAEHVMTWLDEVAPPRQWRGDQ 214

Query: 187 GQGEADRTITDLMVDQIEFADVVIINKVSXXXXX--XXXXXXXXXXGLNPVAKILKTDYC 244
              E   T+  L   Q+  AD V++NK+                   +N VA I +T + 
Sbjct: 215 VLMENQMTVAHL---QLAMADAVVLNKIDRLEGLDDEIAVVEEKVRSINAVAPIYRTKFG 271

Query: 245 NVPMEEIINTNLF 257
           ++ + +++N + F
Sbjct: 272 DLEINKVLNLHAF 284

>YNR029C Chr14 complement(677199..678488) [1290 bp, 429 aa] {ON}
           Putative protein of unknown function, deletion confers
           reduced fitness in saline
          Length = 429

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 125/262 (47%), Gaps = 39/262 (14%)

Query: 9   KTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTK 65
           K  IP+++++G+LGSGK+TLLEKI       K+AVI+N   D SE+   A  ++N S + 
Sbjct: 68  KKRIPVSIITGYLGSGKSTLLEKIALKGADKKIAVILNEFGDSSEIE-KAMTIKNGSNSY 126

Query: 66  KEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSMEF 123
           +E   + L NGC+CC+L+   ++ +  + E   G+  YI++E++GIA+P  +A+ F  + 
Sbjct: 127 QE--WLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQD- 183

Query: 124 SEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRW 183
                                     GL+    ID  +TV+D  + L  ++     A   
Sbjct: 184 -------------------------EGLNSSVYIDGIITVLDCEHILKCLDDISIDAHWH 218

Query: 184 GDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXX--XXXXXXXXXXGLNPVAKILKT 241
           GD    E + TI      Q+  AD +I+NK                    +N +A +  T
Sbjct: 219 GDKVGLEGNLTIAHF---QLAMADRIIMNKYDTIEHSPEMVKQLKERVREINSIAPMFFT 275

Query: 242 DYCNVPMEEIINTNLFDFEKAS 263
            Y + P++ +++ + +D  + S
Sbjct: 276 KYSDTPIQNLLDIHAYDSVRIS 297

>Smik_14.358 Chr14 complement(635188..636588) [1401 bp, 466 aa] {ON}
           YNR029C (REAL)
          Length = 466

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 127/267 (47%), Gaps = 39/267 (14%)

Query: 8   RKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVT 64
           ++  IP+++++G+LGSGK+TLLEKI       K+AVI+N   D SE+   A  ++N S +
Sbjct: 104 KRKRIPVSIITGYLGSGKSTLLEKIALKGADKKIAVILNEFGDSSEIE-KAMTIKNGSSS 162

Query: 65  KKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSME 122
            +E   + L NGC+CC+L+   ++ +  + E   G+  YI++E++GIA+P  +A+ F  +
Sbjct: 163 YQE--WLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQD 220

Query: 123 FSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADR 182
                                      GL+    ID  +TV+D  + L  ++     A  
Sbjct: 221 --------------------------EGLNSSVYIDGIITVLDCEHILKCLDDVSVDAHW 254

Query: 183 WGDNGQGEADRTITDLMVDQIEFADVVIINKVSX--XXXXXXXXXXXXXXGLNPVAKILK 240
            GD    + + TI      Q+  AD +I+NK                    +N +A +  
Sbjct: 255 HGDKVGLKGNLTIAHF---QLAMADRIIMNKYDTIEHSPAMVKHLKERVREVNSIAPMFF 311

Query: 241 TDYCNVPMEEIINTNLFDFEKASTSAG 267
           T Y + P++ +++ + +D  + S   G
Sbjct: 312 TKYSDTPIDNLLDIHAYDSIRISDMLG 338

>CAGL0M10747g Chr13 complement(1072542..1073840) [1299 bp, 432 aa]
           {ON} similar to uniprot|P53729 Saccharomyces cerevisiae
           YNR029c
          Length = 432

 Score = 91.3 bits (225), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 124/260 (47%), Gaps = 39/260 (15%)

Query: 6   KARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHS 62
           +  K  IP+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+   A  +QN  
Sbjct: 65  QTEKKRIPVTIITGYLGSGKSTLLEKIALKGSDRKIAVILNEFGDSSEIE-KAMTIQNGD 123

Query: 63  VTKKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFS 120
              K ++ + L NGC+CC+L+   ++ +  + E   G   YI++E++GIA+P  +A+ F 
Sbjct: 124 --SKYQEWLDLGNGCLCCSLKNIGVKAIEDMIERSPGSIDYILLETSGIADPAPIAKMFW 181

Query: 121 MEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLA 180
            +                           GL+    ID  +TV+DA + +  ++     A
Sbjct: 182 QD--------------------------EGLNSSVYIDGIITVLDAEHIVKCLDDVSPDA 215

Query: 181 DRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXX--XXXXXXXXXXXXXGLNPVAKI 238
             +  +   E + TI      QI  AD +++NKV                   +N VA I
Sbjct: 216 HWYNQSVVKEENLTIAYF---QIAMADRILLNKVDKIEGKRVSISDIEARIKDINGVAPI 272

Query: 239 LKTDYCNVPMEEIINTNLFD 258
             T Y  V ++++++ + ++
Sbjct: 273 YHTQYGEVSLDKLLDLHAYE 292

>KLTH0A06688g Chr1 complement(557036..558268) [1233 bp, 410 aa] {ON}
           similar to uniprot|P53729 Saccharomyces cerevisiae
           YNR029C Hypothetical ORF
          Length = 410

 Score = 90.5 bits (223), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 128/274 (46%), Gaps = 44/274 (16%)

Query: 4   AKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQN 60
           A  +    +P+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+    T+   
Sbjct: 59  AGSSEAPRVPVTIITGYLGSGKSTLLEKIALKGSDKKIAVILNEFGDSSEIEKSMTIRNG 118

Query: 61  HSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAET 118
            +     E+ + L NGC+CC+L+   ++ +  L     G+  YI++E++GIA+P  +A+ 
Sbjct: 119 EN---SYEEWLDLGNGCLCCSLQDVGVKAIESLIARCPGKIDYIILETSGIADPRPIAKM 175

Query: 119 FSMEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQF 178
           F  +                           GL+    +D  VTV+DA N L+ ++    
Sbjct: 176 FWQD--------------------------DGLYSNVYLDGIVTVLDAENILTCLDDVSP 209

Query: 179 LADRWGDNGQGEADRTITDLMVDQIEFADVVIINKV----SXXXXXXXXXXXXXXXGLNP 234
                G+    + + TI  L   Q+  AD ++INK+    +                +N 
Sbjct: 210 ATHWHGEKVVTDDNITIAHL---QVALADCILINKIDRLGAAANQDAVREIENRVRQINA 266

Query: 235 VAKILKTDYCNVPMEEIINTNLFD---FEKASTS 265
            A +  T +  V ++++++ + F+   FE +S S
Sbjct: 267 AASLHHTSFGEVSLDKVLDLHAFESVKFEGSSDS 300

>Skud_14.360 Chr14 complement(645289..646578) [1290 bp, 429 aa] {ON}
           YNR029C (REAL)
          Length = 429

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 124/263 (47%), Gaps = 39/263 (14%)

Query: 8   RKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVT 64
           ++  IP+++++G+LGSGK+TLLEKI       K+AVI+N   D SE+   A  ++N S T
Sbjct: 67  KRKRIPVSIITGYLGSGKSTLLEKIALKGADRKIAVILNEFGDSSEIE-KAMTIKNGSST 125

Query: 65  KKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSME 122
            +E   + L NGC+CC+L+   ++ +  + E   G+  YI++E++GIA+P  +A+ F  +
Sbjct: 126 YQE--WLDLGNGCLCCSLKNVGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQD 183

Query: 123 FSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADR 182
                                      GL+    ID  +TV+D  + L  ++     A  
Sbjct: 184 --------------------------EGLNSSVYIDGIITVLDCEHILKCLDDVSIDAHW 217

Query: 183 WGDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXX--XXXXXXXXXXGLNPVAKILK 240
            GD    + + TI      Q+  AD +I+NK                    +N +A +  
Sbjct: 218 HGDKVGLKGNLTIAHF---QLAMADRIIMNKYDNIENSPEMIKHLKDRVREINSIAPMYF 274

Query: 241 TDYCNVPMEEIINTNLFDFEKAS 263
           T Y    ++ +++ + +D  + S
Sbjct: 275 TKYSETSIDNLLDIHAYDSMRIS 297

>TPHA0H02290 Chr8 complement(545849..547213) [1365 bp, 454 aa] {ON}
           Anc_6.337 YNR029C
          Length = 454

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 84/325 (25%), Positives = 139/325 (42%), Gaps = 62/325 (19%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTKKEE 68
           IP+++++G+LGSGK+TLLE+I       K+AVI+N   D SE+   A  ++N S   +E 
Sbjct: 86  IPVSVITGYLGSGKSTLLEQIALKGSDKKIAVILNEFGDSSEIE-KAMKIRNGSSAYEE- 143

Query: 69  KLIQLQNGCICCTLRG---DLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSMEFSE 125
             + L NGC+CC+L+      +E++  L   G+  YI++E++GIA+P  +A+ F  +   
Sbjct: 144 -WLDLGNGCLCCSLKNVGVKAIEDMV-LRSPGKIDYILLETSGIADPAPIAKMFWQD--- 198

Query: 126 MLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGD 185
                                   GL+    +D  +TV+DA N L  ++         G+
Sbjct: 199 -----------------------EGLNSCVYLDGIITVLDAENILKCLDDVSPDTHWHGE 235

Query: 186 NGQGEADRTITDLMVDQIEFADVVIINKV-----SXXXXXXXXXXXXXXXGLNPVAKILK 240
               E + TI      QI  AD +++NK+     S                +N VA I  
Sbjct: 236 KVLMENNLTIAHF---QIAMADRILLNKMDRVEGSPDSSETVKVLEDRIRQINAVAPIYH 292

Query: 241 TDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETEEYGV 300
           T Y +  +E +++ + +D             INE  +       + ++  P+        
Sbjct: 293 TKYGDTALEYLLDIHAYDN----------SVINETNIYEELKMSRPTLHDPRM------- 335

Query: 301 NNFVYTARRPFHPERLYSMLKDKFF 325
            N V    RP   E  YS     F 
Sbjct: 336 -NTVALTFRPLKNEEEYSHFLKNFL 359

>Suva_14.383 Chr14 complement(658484..659785) [1302 bp, 433 aa] {ON}
           YNR029C (REAL)
          Length = 433

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 125/263 (47%), Gaps = 39/263 (14%)

Query: 8   RKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVT 64
           ++  IP+++++G+LGSGK+TLLEKI       K+AVI+N   D SE+   A  ++N S +
Sbjct: 67  KRKRIPVSIITGYLGSGKSTLLEKIALKGADKKIAVILNEFGDSSEIE-KAMTIKNGSSS 125

Query: 65  KKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSME 122
            +E   + L NGC+CC+L+   ++ +  + E   G+  YI++E++GIA+P  +A+ F  +
Sbjct: 126 YQE--WLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQD 183

Query: 123 FSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADR 182
                                      GL+    ID  +TV+D  + L  ++     A  
Sbjct: 184 --------------------------EGLNSSVYIDGIITVLDCEHILKCLDDVSVDAHW 217

Query: 183 WGDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXX--XXXXXXXXXXGLNPVAKILK 240
            GD    E + TI      Q+  AD +I+NK                    +N +A +  
Sbjct: 218 HGDKVGLEGNLTIAHF---QLAMADRIIMNKYDKIEHSPNTIKQLQKRIREINCIAPMYF 274

Query: 241 TDYCNVPMEEIINTNLFDFEKAS 263
           T Y    ++++++ + +D  + S
Sbjct: 275 TKYSETSIDKLLDIHAYDSIRVS 297

>SAKL0A01342g Chr1 (129065..130291) [1227 bp, 408 aa] {ON} similar
           to uniprot|P53729 Saccharomyces cerevisiae YNR029C
           Hypothetical ORF
          Length = 408

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 128/275 (46%), Gaps = 35/275 (12%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELN-IDATLVQNHSVTKKEEKL 70
           IP+T+++G+LGSGK+TLLE+I       K+AVI+N+  + + I+ +L   +  +  EE L
Sbjct: 68  IPVTIITGYLGSGKSTLLEQIALKGSDRKIAVILNEFGDSSEIEKSLTIRNGSSSYEEWL 127

Query: 71  IQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSMEFSEMLL 128
             L NGC+CC+L+   +  +  +     G+  YI++E++GIA+P  +A+ F M+      
Sbjct: 128 -DLGNGCLCCSLKDVGVRAIENMVSRCPGKIDYILLETSGIADPGPIAKMFWMD------ 180

Query: 129 ETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDNGQ 188
                                GL+    ID  +TV+D+ + LS ++     +   G+   
Sbjct: 181 --------------------EGLNSNVYIDGIITVLDSEHILSCLDDFSPESHWHGEKVL 220

Query: 189 GEADRTITDLMVDQIEFADVVIINKVSXXX--XXXXXXXXXXXXGLNPVAKILKTDYCNV 246
            +   TI  L   QI  AD +++NK+                   +N  A I  T Y ++
Sbjct: 221 LQDKTTIAHL---QIAMADRILLNKIDRLEGDVERVREVEGKVKSINSAAVIYHTKYGDL 277

Query: 247 PMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGF 281
            +++I++ + F+    +   G        T+   F
Sbjct: 278 NLDKILDLHAFESSSIANYEGTFHDPRISTITLSF 312

>KAFR0C04570 Chr3 complement(914620..915909) [1290 bp, 429 aa] {ON}
           Anc_6.337 YNR029C
          Length = 429

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 122/261 (46%), Gaps = 39/261 (14%)

Query: 7   ARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSV 63
           + K  IP+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+    T+    + 
Sbjct: 68  SHKKRIPVTIITGYLGSGKSTLLEKIALQGSDKKIAVILNEFGDSSEIEKAMTIRNGDAA 127

Query: 64  TKKEEKLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSM 121
               E+ + L NGC+CC+L+   ++ +  + +   G+  YI++E++GIA+P  +A+ F  
Sbjct: 128 Y---EEWLDLGNGCLCCSLKNVGVKAIEDMVDRSPGKIDYILLETSGIADPAPIAKMFWQ 184

Query: 122 EFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLAD 181
           +                           GL+    ID  +TV+D+ + L  ++       
Sbjct: 185 D--------------------------EGLNSSVYIDGIITVLDSEHILKCLDDVSEETH 218

Query: 182 RWGDNGQGEADRTITDLMVDQIEFADVVIINKVSX--XXXXXXXXXXXXXXGLNPVAKIL 239
             G+N   E + TI      QI  AD +I+NK+                   +N VA   
Sbjct: 219 WHGENVTVENNLTIAHF---QIAMADRIILNKIDKIGDNSEYLRSLDSRIREINSVAPFY 275

Query: 240 KTDYCNVPMEEIINTNLFDFE 260
            T +  + ++++++ + +  E
Sbjct: 276 FTKFAEISLDKLLDIHAYGME 296

>Kwal_23.6316 s23 complement(1527371..1528597) [1227 bp, 408 aa]
           {ON} YNR029C - 1:1 [contig 17] FULL
          Length = 408

 Score = 87.4 bits (215), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 126/266 (47%), Gaps = 44/266 (16%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTKKEE 68
           IP+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+    T+   ++     E
Sbjct: 67  IPVTIITGYLGSGKSTLLEKIALKGSDKKIAVILNEFGDSSEIEKSMTIRDGNN---SYE 123

Query: 69  KLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSMEFSEM 126
           + + L NGC+CC+L+   ++ +  L     G+  YI++E++GIA+P  +A+ F  +    
Sbjct: 124 EWLDLGNGCLCCSLQDVGVKAIENLIARCPGKIDYILLETSGIADPRPIAKMFWQD---- 179

Query: 127 LLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDN 186
                                  GL+    +D  VTV+DA N L+ ++         G++
Sbjct: 180 ----------------------DGLYSNVYLDGIVTVLDAENVLTCLDDVSPATHWHGES 217

Query: 187 GQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXXXXXXXXXXG----LNPVAKILKTD 242
              E + TI  L   QI  AD ++INK+                     +N +A I  + 
Sbjct: 218 VLTEDNITIAHL---QIAMADSILINKLDRIGEDESSAKVRKIEAKVRQINSIASIHCSS 274

Query: 243 YCNVPMEEIINTNLFD---FEKASTS 265
           +  V + ++++ + F+   FE   +S
Sbjct: 275 FGEVSLVKVLDLHAFESVKFENVGSS 300

>KNAG0D00410 Chr4 (60526..61803) [1278 bp, 425 aa] {ON} Anc_6.337
           YNR029C
          Length = 425

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 124/264 (46%), Gaps = 41/264 (15%)

Query: 3   VAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQ 59
           VA    +  IP+T+++G+LGSGK+TLLEKI       K+AVI+N   D SE+   A  ++
Sbjct: 59  VAASVPQKRIPVTIITGYLGSGKSTLLEKIALKGSDRKIAVILNEFGDSSEIE-KAMTIK 117

Query: 60  NHSVTKKEEKLIQLQNGCICCTLRG---DLLEELFGLAENGEFQYIVIESTGIAEPMQVA 116
           N S + +E   + L NGC+CC+L+      +E++   +  G   YI++E++GIA+P  +A
Sbjct: 118 NGSASYQE--WLDLGNGCLCCSLKNVGVKAIEDMIARSP-GAIDYILLETSGIADPAPIA 174

Query: 117 ETFSMEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETT 176
           + F  +                           GL+    ID  +TV+DA + L  ++  
Sbjct: 175 KMFWQD--------------------------EGLNSSVYIDGVITVLDAEHILKCLDDV 208

Query: 177 QFLADRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXX--XXXXXXXXXXXXXGLNP 234
                  G+    E + TI      Q+   D++++NK                    +N 
Sbjct: 209 SPDTHWHGEKVIREDNLTIAHF---QLAMGDIIVLNKFDKVEGNHCAIEELQNRIRQVNE 265

Query: 235 VAKILKTDYCNVPMEEIINTNLFD 258
           VA I    Y +V ++++++ + ++
Sbjct: 266 VAPIYCAKYGDVELDKLMDIHAYE 289

>NCAS0A04520 Chr1 (907999..909327) [1329 bp, 442 aa] {ON} Anc_6.337
          Length = 442

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 105/208 (50%), Gaps = 34/208 (16%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTKKEE 68
           IP+T+++G+LGSGK+TLLE I       K+AVI+N   D SE+   A  ++N S + +E 
Sbjct: 72  IPVTIITGYLGSGKSTLLEMIAKKGSDKKIAVILNEFGDSSEIE-KAMTIRNGSDSYQE- 129

Query: 69  KLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSMEFSEM 126
             + L NGC+CC+L+   ++ +  + E   G+  YI++E++GIA+P  +A+ F  +    
Sbjct: 130 -WLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQD---- 184

Query: 127 LLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDN 186
                                  GL     +D  +TV+D  + L+ ++     A   GD 
Sbjct: 185 ----------------------DGLSSSVFVDGIITVLDCEHILTCLDDRSPDAHWHGDK 222

Query: 187 GQGEADRTITDLMVDQIEFADVVIINKV 214
              + +  I  +   QI  AD +I+NKV
Sbjct: 223 VVSKDEDGILTIAHFQIAMADRIIMNKV 250

>Kpol_325.2 s325 complement(4458..5777) [1320 bp, 439 aa] {ON}
           complement(4458..5777) [1320 nt, 440 aa]
          Length = 439

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 124/263 (47%), Gaps = 41/263 (15%)

Query: 4   AKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQN 60
           + K   + IPI++++G+LGSGK+TLLE I       K+AVI+N   D SE+   A  ++N
Sbjct: 67  SSKTSTSKIPISIITGYLGSGKSTLLEMIAMKGSDKKIAVILNEFGDSSEIE-KAMTIRN 125

Query: 61  HSVTKKEEKLIQLQNGCICCTLRG---DLLEELFGLAENGEFQYIVIESTGIAEPMQVAE 117
            S +   E+ + L NGC+CC+L+      +E++   +  G+  YI++E++GIA+P  +A+
Sbjct: 126 GSASY--EEWLDLGNGCLCCSLKNIGVKAIEDMVTRSP-GKIDYILLETSGIADPAPIAK 182

Query: 118 TFSMEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQ 177
            F  +                           GL+    ID  +TV+D+ N L  ++   
Sbjct: 183 MFWQD--------------------------EGLNSCIYIDGIITVLDSENVLKCLDDIS 216

Query: 178 FLADRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXXXXXXX--XXXXXXXXGLNPV 235
                 G+    E + T+      QI  AD +++NK                    +N +
Sbjct: 217 PETHWHGEKVIMENNLTVAHF---QIAMADRILLNKFDKIENDPNFITKIEDRVRQINSM 273

Query: 236 AKILKTDYCNVPMEEIINTNLFD 258
           A +  T Y + P++ +++ + +D
Sbjct: 274 APMYNTKYGDTPIDTLLDLHAYD 296

>KLLA0C08613g Chr3 (754098..755366) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53729 Saccharomyces cerevisiae YNR029C
           Hypothetical ORF
          Length = 422

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 123/262 (46%), Gaps = 39/262 (14%)

Query: 8   RKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVT 64
           R+  IP+T+++G+LG+GK+TLLE+I       ++AVI+N   D SE+    T+     V 
Sbjct: 62  RQQRIPVTIITGYLGAGKSTLLEQIALKGSNKRLAVILNEFGDSSEIEKSITIKNKGEVY 121

Query: 65  KKEEKLIQLQNGCICCTLRG---DLLEELFGLAENGEFQYIVIESTGIAEPMQVAETFSM 121
              E+ + L NGC+CC+L+      +E++   +  G+  YI++E++GIA+P  +A+ F  
Sbjct: 122 ---EEWLDLGNGCLCCSLKDVGVKAIEDMVARSP-GKIDYILLETSGIADPGPIAKMFWQ 177

Query: 122 EFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLAD 181
           +                           GL+    ID  +TV+D+ + ++ ++     A 
Sbjct: 178 D--------------------------KGLNSNVYIDGIITVLDSEHIITCLDDISPTA- 210

Query: 182 RWGDNGQGEADRTITDLMVDQIEFADVVIINKVSXX--XXXXXXXXXXXXXGLNPVAKIL 239
            W        D + T +   QI  AD +++NK                    +N VA I 
Sbjct: 211 HWHGEKVTVDDESKTTIAHLQIAMADAILVNKSDKIEGDESKKYDLENVVRSINTVAPIY 270

Query: 240 KTDYCNVPMEEIINTNLFDFEK 261
            T + ++ ++ +++ N F+  K
Sbjct: 271 YTKFGDINLDLVLDLNAFESTK 292

>TBLA0F04100 Chr6 complement(1016306..1017706) [1401 bp, 466 aa]
           {ON} Anc_6.337 YNR029C
          Length = 466

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 148/326 (45%), Gaps = 55/326 (16%)

Query: 5   KKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNH 61
           KK  +  IP+++++G+LGSGK+TLLE I       K+AVI+N   D SE+    T+   +
Sbjct: 66  KKNIQQKIPVSIITGYLGSGKSTLLEAIAKKGSDRKIAVILNEFGDSSEIEKSMTIRNGN 125

Query: 62  SVTKKEEKLIQLQNGCICCTLRG---DLLEELFGLAENGEFQYIVIESTGIAEPMQVAET 118
           +     ++ + L NGC+CC+L+      +E++   +  G+  YI++E++GIA+P  +A+ 
Sbjct: 126 N---NYQEWLDLGNGCLCCSLKNIGVKAIEDMIDRSP-GKIDYILLETSGIADPAPIAKM 181

Query: 119 FSMEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQF 178
           F  +                           GL+    ID  +TV+D  N L  ++    
Sbjct: 182 FWQD--------------------------EGLNSSIYIDGIITVLDCENILKCLDDKSP 215

Query: 179 LADRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSX--XXXXXXXXXXXXXXGLNPVA 236
            +   G+N   E + TI      QI  AD +I+NK                    +N +A
Sbjct: 216 ESHWHGENVIVENNLTIAHF---QIAMADRIIMNKFDKIETSDEKIKNIKDKIKEINSLA 272

Query: 237 KILKTDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPETE 296
            I  T Y ++ ++++++ + +D +  S        ++++T      D+ K+      E+ 
Sbjct: 273 PIYYTKYGDLGIDKLMDIHAYDGKDISELIDHQDHLHDIT-----SDQHKN------ESS 321

Query: 297 EYGVNNFVYTARR---PFHPERLYSM 319
             G ++  Y  +     FH  R+ ++
Sbjct: 322 HPGSHSISYNHKHLNNTFHDPRMNTI 347

>ZYRO0D08272g Chr4 (716261..717493) [1233 bp, 410 aa] {ON} similar
           to uniprot|P53729 Saccharomyces cerevisiae YNR029C
           Hypothetical ORF
          Length = 410

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 121/263 (46%), Gaps = 39/263 (14%)

Query: 12  IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIIN---DMSELNIDATLVQNHSVTKKEE 68
           IP+++++G+LGSGK+TLLEK+       K+AVI+N   D SE+   A  ++N   + +E 
Sbjct: 69  IPVSIITGYLGSGKSTLLEKLAQKGSDKKIAVILNEFGDSSEIE-KAMTIRNGENSYQE- 126

Query: 69  KLIQLQNGCICCTLRGDLLEELFGLAEN--GEFQYIVIESTGIAEPMQVAETFSMEFSEM 126
             + L NGC+CC+L+   ++ +  + +   G+  YI++E++GIA+P  +A+ F  +    
Sbjct: 127 -WLDLGNGCLCCSLKNVGVKAIEDMIQRSPGKIDYILLETSGIADPAPIAKMFWQD---- 181

Query: 127 LLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQFLADRWGDN 186
                                  GL+    ID  +TV+D  + +  ++         GD 
Sbjct: 182 ----------------------EGLNSNVYIDGIITVLDCEHIVKCLDDVSEQTHWHGDQ 219

Query: 187 GQGEADRTITDLMVDQIEFADVVIINKVSX--XXXXXXXXXXXXXXGLNPVAKILKTDYC 244
              E   TI  L   QI  AD +I+NK+                   +N    +  T + 
Sbjct: 220 VVLEDKLTIAHL---QIAMADRLIMNKLDRIENDENKIMKLEQRIRSINSEVPMFYTKFA 276

Query: 245 NVPMEEIINTNLFDFEKASTSAG 267
           ++ ++++++ + FD        G
Sbjct: 277 DIGIDKLLDLHAFDARNVPQEGG 299

>TDEL0A07520 Chr1 complement(1310807..1312081) [1275 bp, 424 aa]
           {ON} Anc_6.337 YNR029C
          Length = 424

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 123/265 (46%), Gaps = 45/265 (16%)

Query: 4   AKKARKTP-IPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDM---SELNIDATLVQ 59
           A   R  P IP+T+++G+LGSGK+TLLE I       K+AVI+N+    SE+   A  ++
Sbjct: 58  ADNVRGRPKIPVTIITGYLGSGKSTLLEMIALKGSDRKIAVILNEFGQSSEIE-KAMTIR 116

Query: 60  NHSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQY--IVIESTGIAEPMQVAE 117
           N S +   E+ + L NGC+CC+L+   ++ +  + E    +   I++E++GIA+P  +A+
Sbjct: 117 NGSASY--EEWLDLGNGCLCCSLQNVGVKAIENMIERSPVKIDNILLETSGIADPAPIAK 174

Query: 118 TFSMEFSEMLLETPGGIPEDXXXXXXXXXXMGGLHKITKIDTCVTVIDALNFLSNIETTQ 177
            F  + S                          L+    ID  +TV+D+ + L      +
Sbjct: 175 MFWQDDS--------------------------LNSSVYIDGIITVLDSEHIL------K 202

Query: 178 FLADRWGDNGQGEADRTITDLMVD--QIEFADVVIINKVSXX--XXXXXXXXXXXXXGLN 233
            L D+   +  G++     +L +   QI  AD +I+NK                    +N
Sbjct: 203 CLDDKPPTHWHGDSVLVGDNLTIAHFQIAMADRIILNKYDKIEGKSSDIAALEERIRSIN 262

Query: 234 PVAKILKTDYCNVPMEEIINTNLFD 258
             A +  T Y  + + ++++ + FD
Sbjct: 263 AEAPLFYTKYGEIALSKLLDIHAFD 287

>TBLA0C02820 Chr3 complement(674701..676914) [2214 bp, 737 aa] {ON}
           Anc_1.285 YJL082W
          Length = 737

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 16/96 (16%)

Query: 13  PITMLSGF------LGSGKTTLLEKILTTNHGLKVAVIINDMSELNIDATLVQNHSVTKK 66
           P+  LS F      + SG   L + +LT  H   V        +LN+D  L++N  +   
Sbjct: 627 PVHELSYFYNGYNRMDSGNLKLAQNLLTNYHNPAV-------DKLNVDQELIRNFLICLT 679

Query: 67  EEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYI 102
             +L +++ G  C  L   +L   F L ENG+ +Y+
Sbjct: 680 FRRLGEVEKG--CQILDEKVLPAFFSL-ENGQVKYV 712

>TBLA0C02530 Chr3 complement(598108..600564) [2457 bp, 818 aa] {ON}
           Anc_3.396 YBR131W
          Length = 818

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 43  VIINDMSELNIDATLVQNHSVTK---KEEKLIQLQNGCICCTLR 83
           +I+N  +  NID  L + +S+ K   KEE+LI+L NG IC  ++
Sbjct: 770 IIVNYSNNKNIDYNLNK-YSIIKRGIKEERLIKLNNGIICFYVK 812

>KLLA0F02926g Chr6 (273193..274212) [1020 bp, 339 aa] {ON} similar
          to uniprot|P34253 Saccharomyces cerevisiae YKL110C
          KTI12 Protein associated with the RNA polymerase II
          Elongator complex involved in sensitivity to G1 arrest
          induced by Kluyveromyces lactis toxin zymocin
          Length = 339

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%)

Query: 10 TPIPITMLSGFLGSGKTTLLEKILT 34
          T +P+ +L+GF  SGKTT+ +K++T
Sbjct: 26 TAMPLVLLTGFPSSGKTTVAKKLVT 50

>KLTH0F11352g Chr6 complement(962701..964596) [1896 bp, 631 aa] {ON}
           similar to uniprot|P38273 Saccharomyces cerevisiae
           YBR131W CCZ1 Protein involved in vacuolar assembly
          Length = 631

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 8/55 (14%)

Query: 48  MSELNIDAT-LVQNHSVTK-----KEEKLIQLQNGCICCTLRGDLLEELFGLAEN 96
           + +L++D T  V   S +K     KEEKLI+L NG + C +R D  EE+  LAEN
Sbjct: 542 LRDLHLDVTTFVNTLSTSKRADDLKEEKLIKLNNG-VLCFIRED-SEEIVVLAEN 594

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,298,348
Number of extensions: 2117240
Number of successful extensions: 6354
Number of sequences better than 10.0: 40
Number of HSP's gapped: 6475
Number of HSP's successfully gapped: 45
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)