Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H24838gna 1ON41041021240.0
Kwal_33.13025na 1ON42340611331e-153
KLTH0F00594gna 1ON43340711031e-148
Ecym_1013na 1ON4114069901e-131
AFR741Wna 1ON4074059321e-123
ZYRO0D05434gna 1ON4284328351e-108
TDEL0H03670na 1ON4264287951e-102
KNAG0A033608.604ON75667722.3
KLLA0E23299g8.536ON31543694.5
Kwal_26.78512.494ON44854687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H24838g
         (410 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   822   0.0  
Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   441   e-153
KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   429   e-148
Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   385   e-131
AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   363   e-123
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   326   e-108
TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              310   e-102
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    32   2.3  
KLLA0E23299g Chr5 (2073218..2074165) [948 bp, 315 aa] {ON} simil...    31   4.5  
Kwal_26.7851 s26 (540694..542040) [1347 bp, 448 aa] {ON} YKL090W...    31   7.8  

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/410 (95%), Positives = 391/410 (95%)

Query: 1   MDVREMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYS 60
           MDVREMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYS
Sbjct: 1   MDVREMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYS 60

Query: 61  TKRXXXXXXXXXXXXXXXXXXXPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPS 120
           TKR                   PGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPS
Sbjct: 61  TKRLKAKTQSTLTKLLSDSLTKPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPS 120

Query: 121 EVANKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYT 180
           EVANKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYT
Sbjct: 121 EVANKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYT 180

Query: 181 DEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIG 240
           DEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIG
Sbjct: 181 DEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIG 240

Query: 241 PQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCS 300
           PQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCS
Sbjct: 241 PQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCS 300

Query: 301 RVPKDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKS 360
           RVPKDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKS
Sbjct: 301 RVPKDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKS 360

Query: 361 YTEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQL 410
           YTEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQL
Sbjct: 361 YTEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQL 410

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  441 bits (1133), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 209/406 (51%), Positives = 276/406 (67%), Gaps = 2/406 (0%)

Query: 6   MESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYSTKRXX 65
           M  +T+EK+  L ELFP  D + LL+VL SC GS++++   +  SVSQ        KR  
Sbjct: 1   MAQSTDEKLLHLKELFPKYDTDGLLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKRLK 60

Query: 66  XXXXXXXXXXXXXXXXXPGISRGP--QKTRTPIALHTKDEVESTLAYCTYHKDILPSEVA 123
                            P  ++ P  +    P+ LH K+++E+ + YCTYH D+LPSEVA
Sbjct: 61  TKSQQSLSRYLEVNALHPIPNKVPASKSKPRPLELHGKEQIEANIPYCTYHTDVLPSEVA 120

Query: 124 NKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYTDEM 183
           +K+L+ ++ D++ + N+FYLFGN CTSN  +R++      K   YNG+ + + G YTDEM
Sbjct: 121 DKLLQQLLEDRNHKPNKFYLFGNLCTSNCASRLFVPEAREKPFFYNGKEVKNPGNYTDEM 180

Query: 184 MVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGPQA 243
           M+A ++IE+ VNE +  R  LP+QVK  EW +Q  ++NVYK DSNL WHSDRLTNIGPQA
Sbjct: 181 MLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVYKKDSNLDWHSDRLTNIGPQA 240

Query: 244 IVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSRVP 303
           I+ASLSLGFSREFRVR  YPS+SQV+S+ P+HNSL+IMHAGFQEEYKHCVP + K SR+P
Sbjct: 241 IIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHAGFQEEYKHCVPKLGKGSRIP 300

Query: 304 KDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKSYTE 363
           K++ HPISGTTRVN+TYRN +M +   C  CG PMELRRTFK+P  RG Y++QCS+SYT 
Sbjct: 301 KEDLHPISGTTRVNLTYRNYVMTENVFCKLCGCPMELRRTFKEPRKRGSYIYQCSRSYTA 360

Query: 364 ENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQ 409
            N F   +ECKG  +ANF     +   +S  S WLA+DD +ARE Q
Sbjct: 361 ANGFHENQECKGFAFANFCKTPPLVSVDSEGSHWLAEDDTEARELQ 406

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  429 bits (1103), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/407 (48%), Positives = 276/407 (67%), Gaps = 5/407 (1%)

Query: 4   REMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLI-DASVSQKYDQLYSTK 62
           + M  +TEEKI +L  L+PD   + LL+VL SC GS++++  L+ D +  +   + + ++
Sbjct: 27  QSMARSTEEKIAELQNLYPDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPESSSKRFKSR 86

Query: 63  RXXXXXXXXXXXXXXXXXXXPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPSEV 122
           +                     I     K   PI LH+K++VESTL YCTYH ++LP E+
Sbjct: 87  QQQTLNRFLDVRLLPKA----AIKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLEL 142

Query: 123 ANKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKALTYNGRVIDDVGEYTDE 182
           ANK+LE +  D S + NEFYLFGNKC SN K+RI+      +   YNG+ ++    Y+DE
Sbjct: 143 ANKLLEALSKDTSFKPNEFYLFGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDE 202

Query: 183 MMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGPQ 242
           +M+A +L+E+ VN+VL  R  LP+QV+ G+W  Q  ++N Y  DSNL WHSDRLTNIGP 
Sbjct: 203 IMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPH 262

Query: 243 AIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSRV 302
           AI+ASLSLGF+REFRVR ++PS+S  YS++P+HNSL+IMHAGFQEEYKHCVP +PK   +
Sbjct: 263 AIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNI 322

Query: 303 PKDEFHPISGTTRVNMTYRNRIMKKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKSYT 362
           P ++ HPIS   RVN+T+RN  +     C  CG+PM+LRR+FK P  RG+Y++QCSKSYT
Sbjct: 323 PAEDVHPISNDVRVNLTFRNYALTTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYT 382

Query: 363 EENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQAREAQ 409
           EEN FK G+ECKG  +A F      T+ E++ SRW+ADDD++A++AQ
Sbjct: 383 EENSFKEGRECKGFAFACFKKKPPFTEFETDGSRWIADDDLEAKQAQ 429

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  385 bits (990), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 267/406 (65%), Gaps = 9/406 (2%)

Query: 6   MESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYSTKRXX 65
           ++ TT+EK+  L  LFP A+ E LL++L SC+GS+R A  L+D  +S++  QL   +R  
Sbjct: 3   VDDTTDEKLAYLQNLFPSANAEVLLDLLVSCNGSVRDATLLLD--LSEEGTQL-EEQRSP 59

Query: 66  XXXXXXXXXXXXXXXXXPGIS---RGPQKTRTPIALHTKDEVESTLAYCTYHKDILPSEV 122
                            P  S   R  + +  PI L+ K ++E  L YCTYH D+LP E+
Sbjct: 60  PRKVAKVKGQQSLSSFLPLQSLYNRQSRPSGKPIILYGKKDIELELKYCTYHTDVLPEEL 119

Query: 123 ANKILELVMNDKSARSNEFYLFGNKCTSNHKTRIYS-CAEHRKALTYNGRVIDDVGEYTD 181
           AN++L+  MN+++++ NEFYLFGNKC SN ++ IYS  +       YNG  +  V  + D
Sbjct: 120 ANRLLKFTMNEQNSKPNEFYLFGNKCVSNCRSAIYSNLSAEEDDYYYNGMRVQTVNRFND 179

Query: 182 EMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGP 241
           +M++   +IE  VNE LQ R TLP+Q KPG+W S + ++N+Y  DS+LQWHSDR+T IGP
Sbjct: 180 DMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISNIYAKDSDLQWHSDRMTYIGP 239

Query: 242 QAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSR 301
            +++A+LSLGFSR  R R +YPS+SQ+Y++ PEHNS+LIMHAG QEE+KHCVPP+PK  +
Sbjct: 240 HSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIMHAGCQEEFKHCVPPLPKNHQ 299

Query: 302 VPKDEFHPISGTTRVNMTYRN-RIMKKTP-SCIKCGYPMELRRTFKKPDNRGMYMWQCSK 359
           + K   +PIS TTRV++T+R+ ++    P  C KCGYPM+LRR +K P+ RG Y+W C+K
Sbjct: 300 ISKSAINPISQTTRVSLTFRDYKVNTYEPVHCDKCGYPMDLRRIYKTPEKRGHYIWLCTK 359

Query: 360 SYTEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQA 405
           SYT  N     +EC G+++A FN+    T  ES  S W+ADDD +A
Sbjct: 360 SYTAGNGLNNKQECGGLKFARFNHPLPTTTTESEGSFWVADDDFEA 405

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  363 bits (932), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/405 (44%), Positives = 251/405 (61%), Gaps = 9/405 (2%)

Query: 5   EMESTTEEKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLIDASVSQKYDQLYSTKRX 64
           E   TT+EK+ KL  + P AD E LL+VL  C G++ +A +L+   +    ++     + 
Sbjct: 2   EKSETTDEKLAKLKAIIPSADTEALLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLKK 61

Query: 65  XXXXXXXXXXXXXXXXXXPGISRGPQKTRTPIALHTKDEVESTLAYCTYHKDILPSEVAN 124
                             P  + G +    PI LH K ++E  L YCTYH ++LP+ +A 
Sbjct: 62  PRLQTQQSLSRYFGLKKSPVPALGGR----PIVLHGKRDIEGALRYCTYHTNVLPAALAE 117

Query: 125 KILELVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKA--LTYNGRVIDDVGEYTDE 182
           ++LE+VM D+ A+ NEFYLFG++C +N +T +Y   +   A  + YNGR I  +  Y  +
Sbjct: 118 RLLEVVMTDERAKPNEFYLFGSRCVTNCRTLLYGNLDPADAGRVFYNGR-ISTLTSYNAD 176

Query: 183 MMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKLDSNLQWHSDRLTNIGPQ 242
           +  A  ++E  VN  L  R  LP+QV  G W   +AVAN+Y+ DS+LQWHSDRLT IGP 
Sbjct: 177 LCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEKDSDLQWHSDRLTYIGPH 236

Query: 243 AIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGFQEEYKHCVPPVPKCSRV 302
           AIVASL+LGF REFR+R +YP+DSQ+YSI   HNS+LIMHAG QEE+KHCVPP+ K  +V
Sbjct: 237 AIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGCQEEFKHCVPPLGKRKKV 296

Query: 303 PKDEFHPISGTTRVNMTYRNRIM--KKTPSCIKCGYPMELRRTFKKPDNRGMYMWQCSKS 360
              E HPISG+ RV++T+R+  +   +   C +CGYPM+LRRT+K P  RG Y+W CS+ 
Sbjct: 297 SAAELHPISGSVRVSLTFRHYKVDFPRDALCPECGYPMDLRRTYKTPSKRGHYIWICSRG 356

Query: 361 YTEENDFKAGKECKGMRYANFNNDSVVTDDESNCSRWLADDDIQA 405
           Y+  ND      CKG++YA  +    VTD ES  + WLADDD +A
Sbjct: 357 YSSGNDKSVESFCKGIKYACVDASPPVTDIESEGNVWLADDDFEA 401

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  326 bits (835), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/432 (41%), Positives = 257/432 (59%), Gaps = 39/432 (9%)

Query: 7   ESTTEEKIKKLNELFPDA------DDEFLLEVLTSCSGSIRQAVSLIDASV----SQKYD 56
           +  TE+K+++L++L+ D        + F LE+L SC G++  AV LI+ S+    + + D
Sbjct: 4   DGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETD 63

Query: 57  QLYSTKRXXXXXXXXXXXXXXXXXX--------XPGISRGP--QKTRTPIALHTKDEVES 106
            L +  +                             +S G   + +   I L TK+++E+
Sbjct: 64  ILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKEDIET 123

Query: 107 TLAYCTYHKDILPSEVANKILE-LVMNDKSARSNEFYLFGNKCTSNHKTRIYSCAEHRKA 165
            + Y + HK++LP  +AN +L+ L  ++ S   N+FYLFG KCTSNH T+++S +E   A
Sbjct: 124 NIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISA 183

Query: 166 ----LTYNGRVIDDVGEYTDEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVAN 221
               + YN   +  + +Y D++ +A LLIED VN+ +  R  LPYQ++   W   + + N
Sbjct: 184 GNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVN 243

Query: 222 VYKLDSNLQWHSDRLTNIGPQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIM 281
            Y  +SNL WHSD++T+IGPQ I+ASLSLG SREFRVR  YPS+SQ+Y I+P HN+L+IM
Sbjct: 244 RYYKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIM 303

Query: 282 HAGFQEEYKHCVPPVPKCSRVPKDEFHPISGTTRVNMTYR---NRIMKKTPSCIKCGYPM 338
           HAGFQEEY+HCV    K S +     HPISG  R+N+TYR    + + + P C KCG PM
Sbjct: 304 HAGFQEEYRHCVHGHSKNSPLKP---HPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPM 360

Query: 339 ELRRTFKKPDNRGMYMWQCSKSYTEENDFKAGKECKGMRYANFNNDSV-VTDDESNCSRW 397
           +LRR FK P  RG Y+WQCSKSYT       G+EC G+  A F+NDS+ V + +   SRW
Sbjct: 361 DLRRAFKDPKTRGQYIWQCSKSYT-------GQECGGVIRAKFDNDSLTVQNFDEEGSRW 413

Query: 398 LADDDIQAREAQ 409
           LA DD +A  AQ
Sbjct: 414 LAPDDQEAHSAQ 425

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  310 bits (795), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 238/428 (55%), Gaps = 39/428 (9%)

Query: 10  TEEKIKKLNELFPDA------DDEFLLEVLTSCSGSIRQAVSLIDASVS----------- 52
           TEEKI  L  L+ D        + FLLE+LT+C GS++ A  +++ S+            
Sbjct: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61

Query: 53  QKYDQLYSTKRXXXXXXXXXXXXXXXXXXXPGIS--RGPQKTRTPIALHTKDEVESTLAY 110
           +K D   S  R                     IS  R  + +   I L +K++VEST+ Y
Sbjct: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIGY 121

Query: 111 CTYHKDILPSEVANKILELVMNDKSARSN-EFYLFGNKCTSNHKTRIYS----CAEHRKA 165
            T H+  LP E AN +L  +M+D    +  EF+LFGNKC+SNH ++ YS      + R  
Sbjct: 122 VTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRDK 181

Query: 166 LTYNGRVIDDVGEYTDEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKL 225
           + YN R    V EY D +    LLIED VNE ++    LP+Q+    W   + + N Y  
Sbjct: 182 IYYNNRR-GTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240

Query: 226 DSNLQWHSDRLTNIGPQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGF 285
             +L WHSDRLT+IGPQ IVASLSLG  REFR+R  YPSDSQ+Y ++P HNSL+IMHAGF
Sbjct: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300

Query: 286 QEEYKHCVPPVPKCSRVPKDEFHPISGTTRVNMTYRNRIMK---KTPSCIKCGYPMELRR 342
           QEEY+H    V + +       HPIS   R N+TYR+ + K     P C KC  PM+LRR
Sbjct: 301 QEEYRHS---VHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRR 357

Query: 343 TFKKPDNRGMYMWQCSKSYTEENDFKAGKECKGMRYANFN-NDSVVTDDESNCSRWLADD 401
            FK P+ RG Y+WQCS  Y+       G EC G+R A+FN N  VV  +    SRWLADD
Sbjct: 358 AFKDPERRGQYIWQCSSHYS-------GVECGGVRLADFNCNSLVVEKNAGEGSRWLADD 410

Query: 402 DIQAREAQ 409
           D +A+EAQ
Sbjct: 411 DWEAKEAQ 418

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
           Anc_8.604 YOR195W
          Length = 756

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 40/67 (59%), Gaps = 7/67 (10%)

Query: 1   MDVREMESTTEEKIKKLNELFPDADDEFLL----EVLTSCSGSIRQAVSLIDAS---VSQ 53
           M+V+++ S  +  +K+ N+L  DA+    L    E L +  G ++  +S++D++   + +
Sbjct: 282 MEVKQLISKVDSLVKEKNKLSTDAEGATKLRDENESLKTSIGELKTELSMLDSNQTLLQE 341

Query: 54  KYDQLYS 60
           KYDQ+YS
Sbjct: 342 KYDQIYS 348

>KLLA0E23299g Chr5 (2073218..2074165) [948 bp, 315 aa] {ON} similar
           to uniprot|Q12051 Saccharomyces cerevisiae YPL069C BTS1
           Geranylgeranyl diphosphate synthase increases the
           intracellular pool of geranylgeranyl diphosphate
           suppressor of bet2 mutation that causes defective
           geranylgeranylation of small GTP-binding proteins that
           mediate vesicular traffic
          Length = 315

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%)

Query: 173 IDDVGEYTDEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTS 215
           ID V  + DE+  A LLI+D  +     RG +    K G WT+
Sbjct: 57  IDAVSAFIDELHTASLLIDDIEDNAELRRGHVAAHKKYGIWTT 99

>Kwal_26.7851 s26 (540694..542040) [1347 bp, 448 aa] {ON} YKL090W
          - Hypothetical ORF [contig 55] FULL
          Length = 448

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 12 EKIKKLNELFPDADDEFLLEVLTSCSGSIRQAVSLI---DASVSQKYDQLYSTK 62
          + +  L ELFP  ++E L   LTS  G    A S+I     ++S+  D L S K
Sbjct: 3  QSLTTLVELFPSINEEILQRTLTSAGGDADVACSMILSEQETMSRMQDNLLSNK 56

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,109,597
Number of extensions: 1825119
Number of successful extensions: 4997
Number of sequences better than 10.0: 15
Number of HSP's gapped: 5091
Number of HSP's successfully gapped: 17
Length of query: 410
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 298
Effective length of database: 40,638,807
Effective search space: 12110364486
Effective search space used: 12110364486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)