Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17248g8.254ON66065030460.0
KLLA0F18931g8.254ON66565021940.0
NDAI0B023708.254ON72265621760.0
Kwal_56.235778.254ON68366621470.0
Suva_10.1678.254ON68467021450.0
KLTH0G13882g8.254ON68767321400.0
YLR083C (EMP70)8.254ON66765121290.0
Smik_12.1428.254ON66364921240.0
NCAS0B049708.254ON66665421190.0
YDR107C (TMN2)8.254ON67265820880.0
Skud_12.1518.254ON66464920840.0
KAFR0B026808.254ON66464820530.0
ZYRO0C01848g8.254ON64765120500.0
Smik_4.3538.254ON69065820160.0
Suva_2.2678.254ON67265920120.0
Skud_4.3688.254ON67265820050.0
Kpol_543.358.254ON65865219930.0
KNAG0G019908.254ON66765019740.0
TBLA0E043708.254ON67666219280.0
CAGL0B01683g8.254ON69167518910.0
NCAS0B038908.254ON66365518760.0
AGR097W8.254ON65365018590.0
TBLA0H014508.254ON67366118410.0
TPHA0A018408.254ON68567618090.0
TDEL0F038108.254ON65665017800.0
NDAI0J014208.254ON61962616730.0
Ecym_43178.254ON60565014380.0
NCAS0A145207.411ON6706813782e-37
NDAI0A015107.411ON6796853561e-34
YER113C (TMN3)7.411ON7067063383e-32
Suva_5.2347.411ON7067163277e-31
KNAG0C034307.411ON6807033204e-30
Skud_5.2667.411ON7077063171e-29
Smik_5.2587.411ON7067163109e-29
TDEL0C027107.411ON6786922992e-27
ZYRO0B03784g7.411ON6586252964e-27
SAKL0F12914g7.411ON7075792724e-24
KLLA0E20835g7.411ON6766892618e-23
CAGL0G03487g7.411ON7047092484e-21
Kwal_27.107467.411ON6902772145e-17
AGL295C7.411ON6575432064e-16
KLTH0C06226g7.411ON6942752012e-15
KAFR0K019507.411ON6642591913e-14
Ecym_71437.411ON6765621815e-13
TBLA0I003307.411ON7134921725e-12
TPHA0K007307.411ON7335021654e-11
Kpol_1045.287.411ON6815651573e-10
CAGL0K01155g3.403ON203114780.40
AEL284C4.192ON479125771.2
NCAS0B075601.303ON49564752.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17248g
         (660 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...  1177   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   849   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   842   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   831   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   830   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   828   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   824   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   822   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   820   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   808   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   807   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   795   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   794   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   781   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   779   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   776   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   772   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   764   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   747   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   733   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    727   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   720   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   713   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   701   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   690   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   649   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   558   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   150   2e-37
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   141   1e-34
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   134   3e-32
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   130   7e-31
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   127   4e-30
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   126   1e-29
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   124   9e-29
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   119   2e-27
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   118   4e-27
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   109   4e-24
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   105   8e-23
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   100   4e-21
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    87   5e-17
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    84   4e-16
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    82   2e-15
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    78   3e-14
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    74   5e-13
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    71   5e-12
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    68   4e-11
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    65   3e-10
CAGL0K01155g Chr11 complement(111197..111808) [612 bp, 203 aa] {...    35   0.40 
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    34   1.2  
NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602) [...    33   2.0  

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/650 (89%), Positives = 579/650 (89%)

Query: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70
           QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY
Sbjct: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70

Query: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130
           DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK
Sbjct: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130

Query: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI 190
           LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI
Sbjct: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI 190

Query: 191 EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSC 250
           EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSC
Sbjct: 191 EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSC 250

Query: 251 DTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXX 310
           DTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWF          
Sbjct: 251 DTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVI 310

Query: 311 XXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSG 370
                     FRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSG
Sbjct: 311 LLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSG 370

Query: 371 AQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKL 430
           AQLFLMAGFTILFA             TTVMFILYALFGSFGSYTSMAVYKFFNGQNWKL
Sbjct: 371 AQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKL 430

Query: 431 NMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIIS 490
           NMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIIS
Sbjct: 431 NMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIIS 490

Query: 491 RKKSQWDRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550
           RKKSQWDRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF
Sbjct: 491 RKKSQWDRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610
           YMFG                         CMENWKWQWRGFWIGGAGCAFYVFVHAILFT
Sbjct: 551 YMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610

Query: 611 KFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           KFK             SVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD
Sbjct: 611 KFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/650 (62%), Positives = 484/650 (74%), Gaps = 4/650 (0%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           +  AFYLPGVAPTTYH+GD++PLLVNHLTPS +++H D + H  +GDKE FLYSYDYYY 
Sbjct: 19  LVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYK 77

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           KFHFC+P  L KQPESLGSIIFGDRIYNSPF+L +L+N  C  LCKS IP  DAKFINKL
Sbjct: 78  KFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKL 137

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191
           I NGFF NW++DGLPAAR+M D +TN  FYGNGFELG VDV+   E PDT+ + +   ++
Sbjct: 138 ILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYE-PDTRSLHDELELQ 196

Query: 192 IADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251
           + +A K +     K+TE+ YF+NH+DI+IEYHDRGE+NYR+VGV+V PASIKRDS DSC+
Sbjct: 197 L-NAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCE 255

Query: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXX 311
           + G+ LVLSE  DN V+FTYSV F+ S T+WATRWDKYLHVYDP+IQWF           
Sbjct: 256 STGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVL 315

Query: 312 XXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371
                    + ALKNDL+RYNELNLD +F+EETGWKL+HGDVFR+P + +LLSVLVGSG 
Sbjct: 316 LSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGG 375

Query: 372 QLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431
           QL LM   TILFA             +TVMF+LYA+FGSFGS+TSMA YKFFNG+ W+LN
Sbjct: 376 QLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLN 435

Query: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491
           ++LTP+L+P  I   +LGLN FL+FVHSSGAIPF TML +V+LWFV SIPLS  GS+I+ 
Sbjct: 436 LVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAW 495

Query: 492 KKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550
           KK  W + PT TNQIARQIPFQPWYLKT+P +L+AG FPFGSI VELYFIYSSLWFNKI+
Sbjct: 496 KKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIY 555

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610
           YMFG                         CMENWKWQWR F IGG GCAFYVF H+ILFT
Sbjct: 556 YMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFT 615

Query: 611 KFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           KF+             S++ISGLCCL+TGA+GFLSSL  VRKIY  +KVD
Sbjct: 616 KFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/656 (62%), Positives = 480/656 (73%), Gaps = 7/656 (1%)

Query: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70
            +  AFYLPGVAPTTYH  DEIPLLVNHLTPS YFQH +++G TM  DKERFLYSYDYYY
Sbjct: 68  SLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYYY 127

Query: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130
           D+FHFC+PE++ KQPESLGSIIFGDRIYNSPF++NML++KTCV LCK+ IP  DAKFINK
Sbjct: 128 DRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFINK 187

Query: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPD-----TKKVS 185
           LI+NGFF NWL+DGLPAAR+++D RT + FYG GFELGFVDVV      D      KK +
Sbjct: 188 LIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNANTVAKKPT 247

Query: 186 ESDYIEIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRD 245
            ++ +E+   D +   +  K  EL YF NHFDI++EYHDRGE+NYRVVGV V P SIKR 
Sbjct: 248 TNEGLELDTRDAK-NVQMLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRS 306

Query: 246 SSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXX 305
           +  +C+T G PL+LSED DN V+FTYSV F+PS+T+WATRWDKYLH+YDP IQWF     
Sbjct: 307 TPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINF 366

Query: 306 XXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSV 365
                           +ALK+D +RYNELNLDD+FQEE GWKL HGDVFR P R++LLSV
Sbjct: 367 SVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSV 426

Query: 366 LVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNG 425
           LVGSG QLFLM   +I FA              TVMFILYALFG  GSYTSM VYKFF G
Sbjct: 427 LVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGG 486

Query: 426 QNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVA 485
             WK+NM+LTPIL+P +IF  ++ LN FL+FVHSSG IP  T+  +++LWFVFSIPL++A
Sbjct: 487 PYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALA 546

Query: 486 GSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSL 544
           GS+I+ KK  WD  PT TNQIARQIPFQPWYLKT PA+LIAG FPFGSI VELYFIYSSL
Sbjct: 547 GSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSL 606

Query: 545 WFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFV 604
           WFNKIFYMFG                         C+ENW WQWRGF IGG GCA YVF+
Sbjct: 607 WFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFI 666

Query: 605 HAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           H+ILFTKFK             S +IS L C++TGA+GFLSS++F+RKIY SIKV+
Sbjct: 667 HSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/666 (63%), Positives = 484/666 (72%), Gaps = 21/666 (3%)

Query: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74
            FYLPGVAPTTYH+GD IPLLVNHLTPS YF+H D +G   +GD+E FLYSYDYYYDKFH
Sbjct: 19  GFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKFH 77

Query: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134
           FC+PE L KQ ESLGSIIFGDRIYNSPF+L ML++K C  LC S+IP +DAKFINKLI N
Sbjct: 78  FCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIAN 137

Query: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDV------VDTIEDPD------TK 182
           GFF NWLVDGLPAAR+  D RT S FY  GFELGF+DV      +D   + D      TK
Sbjct: 138 GFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGATK 197

Query: 183 KVSESDYIEIADADKELKERS-------AKLTELSYFINHFDIKIEYHDRGEDNYRVVGV 235
            V++ DY++     K  K +         K  E +YF NHF+I+++YHDRG  +YRVVGV
Sbjct: 198 PVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVGV 257

Query: 236 SVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDP 295
            V P SIKRDSS+SC   GE L LSE+ + TVHF+YSV F PS T+WATRWDKYLHVYDP
Sbjct: 258 IVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVYDP 317

Query: 296 QIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFR 355
           +IQW+                    +R L++DLSRYN+LNLDD+FQEETGWKLVHGDVFR
Sbjct: 318 KIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVFR 377

Query: 356 TPERTMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYT 415
           TP +++LLSVLVGSG QLF+MA  TI FA             TTVMFILYALFGS GSYT
Sbjct: 378 TPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGSYT 437

Query: 416 SMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLW 475
           SMA YKFF G+ WK+NMILTPIL+P ++F  +LGLN FL+ V S+GAIPFGTM AIV+LW
Sbjct: 438 SMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLLW 497

Query: 476 FVFSIPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIV 534
           FVFSIPLS+AGS+I++KK +W + PT T QI RQIPFQPWYLKT PA+LIAG FPFGSI 
Sbjct: 498 FVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSIA 557

Query: 535 VELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIG 594
           VELYF+YSSLWFNKIFYMFG                         C+ENWKWQWRGFWIG
Sbjct: 558 VELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFWIG 617

Query: 595 GAGCAFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIY 654
           GAGCA YVF+HAILFTKFK             S+VIS L CLITGAVGF+SSLWFVR+IY
Sbjct: 618 GAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRIY 677

Query: 655 GSIKVD 660
            SIKVD
Sbjct: 678 SSIKVD 683

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/670 (60%), Positives = 478/670 (71%), Gaps = 23/670 (3%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
           A AFYLPGVAPTTY + DEIPLLVNHLTPS Y+QH D++G+ +SGDKE FLYSYDYYYDK
Sbjct: 16  ARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDK 75

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
           FHFC+PE++ KQPESLGSIIFGDRIYNSPFELNML+ K CV LCK+ IP DDAKFINKLI
Sbjct: 76  FHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVS----ESD 188
           +NGFF NWL+DGLPAARE+HDGRT + FYG GF LGFV+V   + D +T++V     E++
Sbjct: 136 KNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVV-DSETEQVQVASGETE 194

Query: 189 YIEIADADKELKERSA-----------------KLTELSYFINHFDIKIEYHDRGEDNYR 231
             + AD   E ++  +                 K  E  YF NHFDIKIEYHDRGE NYR
Sbjct: 195 QTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYR 254

Query: 232 VVGVSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLH 291
           VVGV V P SIKR S  +C+T G PLVL E  DN V+FTYSV F  S T WATRWDKYLH
Sbjct: 255 VVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYLH 314

Query: 292 VYDPQIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHG 351
           VYDP IQWF                     RALK+D +RYNELNLDD+FQE++GWKL HG
Sbjct: 315 VYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHG 374

Query: 352 DVFRTPERTMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSF 411
           DVFR P ++++LS+LVGSG Q+FLM   +I FA              TVMFILYALFG  
Sbjct: 375 DVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFV 434

Query: 412 GSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAI 471
           GSYTSM +YKFF+G  WK N+I+TP+LIP  I + ++ LN FL+FVHSSG IP  T+  +
Sbjct: 435 GSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFM 494

Query: 472 VVLWFVFSIPLSVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPF 530
           V LWF+FSIPLS AGS+++RKK  WD  PT TNQIARQIPFQPWYLKT+PA+LIAG FPF
Sbjct: 495 VFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFPF 554

Query: 531 GSIVVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRG 590
           GSI VELYFIY+SLWFNKIFYMFG                         C+ENWKWQWRG
Sbjct: 555 GSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKWQWRG 614

Query: 591 FWIGGAGCAFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFV 650
           F +GG GCA YVF+H+ILFTKFK             S VIS LCCL+TG++GF+SS++F+
Sbjct: 615 FTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFI 674

Query: 651 RKIYGSIKVD 660
           RKIY SIKVD
Sbjct: 675 RKIYSSIKVD 684

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/673 (63%), Positives = 480/673 (71%), Gaps = 26/673 (3%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
            S FYLPGVAPTTYH+GD IPLLVNHLTP+ Y+QHAD++G+ + GDKE  LYSYDYYY K
Sbjct: 16  VSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPK 74

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
           FHFCRPE L KQ ESLGSIIFGDRIYNSPF++ ML+NK C  LC   IP DDAKFINKLI
Sbjct: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFV----------------DVVDTI 176
            NGFF NWLVDGLPAAR+  D RT S FY  GFELG+V                D  D+ 
Sbjct: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDDSG 194

Query: 177 EDPDTKKVSESDYIEIADADKELKERS--------AKLTELSYFINHFDIKIEYHDRGED 228
               TK+VSESDY++   A + L +R          K  E  YF NHF+I+++YHDRG  
Sbjct: 195 SHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254

Query: 229 NYRVVGVSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDK 288
           NYRVVGV V P SIKR+S D+CD  GE L LSE     VHF+YSV F PS+T+WATRWDK
Sbjct: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314

Query: 289 YLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKL 348
           YLHVYDP+IQWF                    +  L +DLSRYN++NLDD+FQEETGWKL
Sbjct: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374

Query: 349 VHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALF 408
           +HGDVFRTPER+++LSVLVGSGAQLFLMA  TI FA             TTVMFILYALF
Sbjct: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYALF 434

Query: 409 GSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTM 468
           GSFGSYTSMA YKFF G  WK+NM+LTPIL+P ++F  ML LN FLV V S+GAIPFGTM
Sbjct: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494

Query: 469 LAIVVLWFVFSIPLSVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGT 527
             IV+LWF+FSIPLSVAGS+I+RKK +WD  PT T QI RQIPFQPWYLKTVPASLIAG 
Sbjct: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554

Query: 528 FPFGSIVVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQ 587
           FPFGSI VELYFIYSSLWFNKIFYMFG                         C+ENWKWQ
Sbjct: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWKWQ 614

Query: 588 WRGFWIGGAGCAFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSL 647
           WRGFWIGGAGCA Y+F+HAILFTKF+             S+V+S L CLITG VGFLSSL
Sbjct: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674

Query: 648 WFVRKIYGSIKVD 660
           WFVR+IY S+KVD
Sbjct: 675 WFVRRIYSSVKVD 687

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/651 (62%), Positives = 468/651 (71%), Gaps = 10/651 (1%)

Query: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74
           AFYLPGVAPTTY + D IPLLVNHLTPS  +QH D++G+ +SGDKE FLYSYDYYY++FH
Sbjct: 22  AFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRFH 81

Query: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134
           FC+PE + KQPESLGS+IFGDRIYNSPF+LNML+ K C  LCK+ IP DDAKFINKLI+N
Sbjct: 82  FCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLIKN 141

Query: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIAD 194
           GFF NWL+DGLPAARE++DGRT + FYG GF LGFV V    +   T K +E+      D
Sbjct: 142 GFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKGAET-----TD 196

Query: 195 ADKELKERS----AKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSC 250
            D EL+ R+     K  EL YF NHFDI IEYHDRGE NYRVVGV V P SIKR S  +C
Sbjct: 197 KDVELETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTC 256

Query: 251 DTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXX 310
           +T G PL+L E  DN V+FTYSV F  S T WATRWDKYLHVYDP IQWF          
Sbjct: 257 ETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVV 316

Query: 311 XXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSG 370
                      RALK+D +RYNELNLDD+FQE++GWKL HGDVFR+P +++ LS+LVGSG
Sbjct: 317 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSG 376

Query: 371 AQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKL 430
            QLFLM   +I FA              TVMFILYALFG  GSYTSM +YKFFNG  WK 
Sbjct: 377 VQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKA 436

Query: 431 NMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIIS 490
           N+ILTP+L+P  I + ++ LN FL+FVHSSG IP  T+  +V LWF+FSIPLS AGS+I+
Sbjct: 437 NLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIA 496

Query: 491 RKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKI 549
           RK+  WD  PT TNQIARQIPFQPWYLKT+PA+LIAG FPFGSI VELYFIY+SLWFNKI
Sbjct: 497 RKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI 556

Query: 550 FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILF 609
           FYMFG                         C+ENWKWQWRGF IGGAGCA YVF+H+ILF
Sbjct: 557 FYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILF 616

Query: 610 TKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           TKFK             S VIS LCCL+TG++GF+SS+ FVRKIY SIKVD
Sbjct: 617 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/649 (61%), Positives = 464/649 (71%), Gaps = 2/649 (0%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
           A AFYLPGVAPTTY + DEIPLLVNHLTPS Y+QH D+EG+ +SGDKE FLYSYDYY  +
Sbjct: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
           FHFC+PE + KQPESLGSIIFGDRIYNSPF+L MLE K CV LCK  IP +DAKFINKLI
Sbjct: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEI 192
           +NGFF NWL+DGLPAAR + D RT + FYG GFELGFV+V        T   +E+   + 
Sbjct: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN-QG 194

Query: 193 ADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDT 252
            + D        +  E  YF NH+DI+IEYHDRGE NYRVVGV V P SIKR   ++C+T
Sbjct: 195 VELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCET 254

Query: 253 EGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXXX 312
           +G PL+L E+ DN V+FTYSV FV S+T WATRWDKYLHVYDP IQWF            
Sbjct: 255 DGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVVLL 314

Query: 313 XXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQ 372
                    RALK+D +RYNELNLDD+FQE++GWKL HGDVFR P R++ LS+LVGSG Q
Sbjct: 315 SSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQ 374

Query: 373 LFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNM 432
           LF M   +I FA              TVMF+LYALFG  GSYTSM +YKFF+G  WK N+
Sbjct: 375 LFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANL 434

Query: 433 ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK 492
           ILTP+L+P  I I ++ LN FL+FVHSSG IP  T+  +V LWF+FSIPLS AGS+++RK
Sbjct: 435 ILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK 494

Query: 493 KSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFY 551
           K  WD  PT TNQIARQIPFQPWYLKTVPA+LIAG FPFGSI VELYFIY+SLWFNKIFY
Sbjct: 495 KCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFY 554

Query: 552 MFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFTK 611
           MFG                         C+ENWKWQWRGF +GGAGCA YVF+H+ILFTK
Sbjct: 555 MFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTK 614

Query: 612 FKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           FK             S VIS LCCL+TG++GF+SS++F+RKIY SIKVD
Sbjct: 615 FKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/654 (61%), Positives = 472/654 (72%), Gaps = 6/654 (0%)

Query: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70
            +  AFYLPGVAPTTYH+GDEIPLLVNHLTPS YFQ  D  G   S +KE FLYS+DYY+
Sbjct: 15  SLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYYF 72

Query: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130
           D+ HFC+PE++ KQPESLGSIIFGDRIYNSPFEL MLE KTCV LCKS IP  DAKFINK
Sbjct: 73  DRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINK 132

Query: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI--EDPDTKKVSESD 188
           LI+NGFF NWL+DGLPAA +++D +T S FYG GFELGFV+    I  + P T K  ++ 
Sbjct: 133 LIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTT 192

Query: 189 YIEIADADKELKE-RSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSS 247
              +    +E K  +  K  E++YF+NH+DI++EYHDRGE  YRVVGV V P SIKR + 
Sbjct: 193 NEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTP 252

Query: 248 DSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXX 307
            +C+T G+PLVLSEDADN V+FTYSV FVPS+T+WATRWDKYLH YDP IQWF       
Sbjct: 253 GTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSI 312

Query: 308 XXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLV 367
                         +ALK+D +RYNE NL+D+FQE+ GWKL HGDVFR P ++MLLSVLV
Sbjct: 313 IVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLV 372

Query: 368 GSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQN 427
           GSG QLFLM   +I FA              TVMFILYALFG  GSYTSMAVYKFF G  
Sbjct: 373 GSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPY 432

Query: 428 WKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGS 487
           WK+NM+LTP +IP  IF++++GLN FL+F HSSG +P GT+  +++LWF+FSIPL+ AGS
Sbjct: 433 WKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGS 492

Query: 488 IISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWF 546
           +I+ KK  WD  PT TNQIARQIPFQPWYLKT PA++IAG FPFGSI VELYFIY+SLWF
Sbjct: 493 LIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWF 552

Query: 547 NKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHA 606
           NKIFYMFG                         C+ENW+WQWRGF +GG GCA YVFVH+
Sbjct: 553 NKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHS 612

Query: 607 ILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           ILFTKFK             S +IS L C++TGA+GFLSSL FVRKIY +IKVD
Sbjct: 613 ILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/658 (59%), Positives = 464/658 (70%), Gaps = 9/658 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           +   F LPG++PTTYH GDEIPLLVN LTPS YFQH D+EG+ +SGDKE FLYSYDYY  
Sbjct: 15  LTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNK 74

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           +FHFCRPE++ KQPESLGS+IFGDRIYNSPF+LNMLE K CV LCKS IP  DAKFIN L
Sbjct: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTL 134

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIE--------DPDTKK 183
           I++GFF NWLVDGLPAAR+ +D RT + +YG GFELGF DV  T++        +  T +
Sbjct: 135 IKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSE 194

Query: 184 VSESDYIEIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK 243
            S  D I  A   K +K    K  EL YF+NHFDI++E+HDRG DNYRVVGV V P SI+
Sbjct: 195 ASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIE 254

Query: 244 RDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXX 303
           R S  +C T G+PL+L ED DN V+FTYSV FV S T+WATRWDKYLH+YDPQIQWF   
Sbjct: 255 RSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLI 314

Query: 304 XXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLL 363
                             RALK+DL+RYNELNLD+EF E++GWKL HGDVFRTP ++MLL
Sbjct: 315 NFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLL 374

Query: 364 SVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFF 423
           S+LVGSG QLFLM   +I FA              TVMF+LYALFG  GSY SM VYKFF
Sbjct: 375 SILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFF 434

Query: 424 NGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLS 483
            G  WK NMILTPIL+P  IF+ ++ +N FL+F HSSG IP  ++  I++LWF+ S+PLS
Sbjct: 435 RGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLS 494

Query: 484 VAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYS 542
            AGSI++ K+  WD  PT TNQIARQIP+QPWYL+T  A+LIAG F FGSI VELYFIYS
Sbjct: 495 FAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYS 554

Query: 543 SLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYV 602
           SLWFNKIFYMFG                         C+ENW WQWR F IGG GC+ Y 
Sbjct: 555 SLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYT 614

Query: 603 FVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           F+H+ILFTKFK             S++IS LCC++TGA+GF SS++F+RKIY +IKV+
Sbjct: 615 FIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/649 (60%), Positives = 462/649 (71%), Gaps = 1/649 (0%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
             AFYLPGVAPTTY + DEIPLLVNHLTPS Y+QH D++G+++SGDKE FLYSYDYYYD+
Sbjct: 16  TKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDR 75

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
           FHFCRP+++ KQPESLGS+IFGDRIYNSPFELNML+ K CVPLC + IP +DAKFINKLI
Sbjct: 76  FHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLI 135

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEI 192
           +NGFF NWL+DGLPAARE++DGRT + FYG GFELG V+V          K +E+    +
Sbjct: 136 KNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGL 195

Query: 193 ADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDT 252
               +       +  E  YF NHFDI IEYHDRG  +YRVVGV V P SIKR  + +C+T
Sbjct: 196 ELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCET 255

Query: 253 EGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXXX 312
           +  PL+L E+ DN V FTYSV F  S T WATRWDKYLHVYDP IQWF            
Sbjct: 256 DASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLL 315

Query: 313 XXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQ 372
                    RALK+D +RYNELNL+D+FQE++GWKL HGDVFR P  ++LLS+LVGSG Q
Sbjct: 316 SSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQ 375

Query: 373 LFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNM 432
           LFLM   +I FA              TVMFILYALFG  GSYTSM +YKFFNG  WK N+
Sbjct: 376 LFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANL 435

Query: 433 ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK 492
           +LTP+L+P  I + ++ LN FL+ VHSSG IP  T+  +V LWF+FSIPLS  GS+I+RK
Sbjct: 436 LLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARK 495

Query: 493 KSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFY 551
           K  WD  PT TNQIARQIPFQPWYLKT+PA+LIAG FPFGSI VELYFIY+SLWFNKIFY
Sbjct: 496 KCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFY 555

Query: 552 MFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFTK 611
           MFG                         C+ENWKWQWRGF +GG GCA YVF+H+ILFTK
Sbjct: 556 MFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTK 615

Query: 612 FKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           FK             S VIS LCCL+TG++GF+SS++F+R+IY SIKVD
Sbjct: 616 FKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/648 (60%), Positives = 470/648 (72%), Gaps = 2/648 (0%)

Query: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74
           AFYLPGVAPTTYH+GDEIPLLVNHL+PS Y+QH + EG  +S DK ++LYSYDYYYD+FH
Sbjct: 17  AFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRFH 76

Query: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134
           FC+PE + KQPESLGSI+FGDRIYNSPF+LNMLE K C  LCKS IP +DAKFINKLI+N
Sbjct: 77  FCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKN 136

Query: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTK-KVSESDYIEIA 193
           GFF NWL+DGLPAA E HD RT + FYG+GFELG VDVV  +++ + + KV+ ++     
Sbjct: 137 GFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAEL 196

Query: 194 DADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTE 253
           DA      ++ K  EL YF+NH+DI+IEYHDRG  +YRVVGV V P SI+R S  SC++ 
Sbjct: 197 DARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCEST 256

Query: 254 GEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXXXX 313
           G+PL L ED DN V+FTYSV+FVPS+T WATRWDKYLHVYDP IQWF             
Sbjct: 257 GQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLLLS 316

Query: 314 XXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQL 373
                   +ALKND +RYNE NLDDEFQE+ GWKL HGDVFR P ++MLLSVLVGSG QL
Sbjct: 317 TVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGVQL 376

Query: 374 FLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMI 433
           F+M   TI FA              TVMF+LYALFG  GSYTSM VYKFF G  WK NM+
Sbjct: 377 FIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMV 436

Query: 434 LTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKK 493
           LTPIL+P  IFI+++ +N FL++VHSSG IP  T+  +V+LWFVFSIP + AGS+++ KK
Sbjct: 437 LTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKK 496

Query: 494 SQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYM 552
             W + PT T QIARQIPFQPWYLKT+PA+ IAG FPFGSI VE+YFIY+SLW+NKIFYM
Sbjct: 497 CNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYM 556

Query: 553 FGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKF 612
           FG                         C+ENW WQWR F +GG GCA YVF+H+ILFTKF
Sbjct: 557 FGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKF 616

Query: 613 KXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           K             S +IS LCC++TG++GFLSS++FVRKI+ SIKVD
Sbjct: 617 KLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/651 (60%), Positives = 464/651 (71%), Gaps = 18/651 (2%)

Query: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70
            +  AFYLPGVAPTTYH  DEI LLVNHLTPS  FQH D++G+ + GDKE +LYSYDYYY
Sbjct: 14  SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYY 73

Query: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130
            KFHFC+PEN+++QP SLGS+IFGDRI+NSPF+LNMLE K CVPLC S IP +DAKF+NK
Sbjct: 74  SKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNK 133

Query: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI 190
           LI+NGF  NWL+DGLPA RE+HD RTNS FYG GF+LGFVDV +   D +          
Sbjct: 134 LIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSN---------- 183

Query: 191 EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSC 250
              D +K++     K  E+ Y  NH+DI IEYHDRG DNYRVVGV+V P SIKR SSDSC
Sbjct: 184 ---DEEKKI----MKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSC 236

Query: 251 DTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXX 310
                 L LSE  +N VHFTYSV F+ S T+WATRWDKYLHVYDP IQWF          
Sbjct: 237 QYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVV 296

Query: 311 XXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSG 370
                      RALKNDLSRYNE NLD+EF E++GWKL HGDVFR P R++LLS+LVGSG
Sbjct: 297 ALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSG 356

Query: 371 AQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKL 430
            QLFLM   +I+FA              TVMF+LYALFG  GSYTSMA+YKFF G  WK+
Sbjct: 357 VQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKV 416

Query: 431 NMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIIS 490
           N++LTP+L+P  IF++++ LN FLVFV SSGAIP GT+  I++LWFVFSIPLS AGS+I+
Sbjct: 417 NLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIA 476

Query: 491 RKKSQWD-RPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKI 549
            K+ + D  PT TNQIARQIP QPWYLKT+P SLIAG FPF SI VELYFIY+SLWFNKI
Sbjct: 477 HKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKI 536

Query: 550 FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILF 609
           FYMFG                         C+ENWKWQWR F IGG GCA YVF+H+ILF
Sbjct: 537 FYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILF 596

Query: 610 TKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           TKFK             S +IS LCC++TG++GF+SS++F+RKIY S+KVD
Sbjct: 597 TKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/658 (57%), Positives = 459/658 (69%), Gaps = 9/658 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           +  AF LPG++PTTYHK DEIPLLVN LTPS YFQH D+ G  +S DKE +LYSYDYY +
Sbjct: 33  LTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNE 92

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           +FHFCRPE++ +QPESLGSIIFGDRIYNSPF+L MLE K CV LC++ IP  DAKFINKL
Sbjct: 93  RFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKL 152

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIED---PDTKKVSESD 188
           I++GFF NWLVDGLPAAR++ D RT + +YG GFELG   V +TI+    P T +  +S+
Sbjct: 153 IKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELDSE 212

Query: 189 YIEIADA-----DKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK 243
                 A      K +K    K  EL YF+NHFDI++E+HDRG+DNYRVVGV+V P SI+
Sbjct: 213 TSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIE 272

Query: 244 RDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXX 303
           R S DSC    +PL+L E+ DN ++FTYSV FV S T+WATRWDKYLH+YDPQIQWF   
Sbjct: 273 RSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLI 332

Query: 304 XXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLL 363
                             RAL +DLSRYNELNLD+EF E++GWKL HGDVFRTP ++MLL
Sbjct: 333 NFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLL 392

Query: 364 SVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFF 423
           SVLVGSG QLFLM   +I  A              TVMF+ YALFG  GSYTSM VYKFF
Sbjct: 393 SVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFF 452

Query: 424 NGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLS 483
           +G  WK N+ILTPIL+P  IF+ ++ +N FL+F HSSG IP  T+  I+ LWF  SIPLS
Sbjct: 453 HGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLS 512

Query: 484 VAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYS 542
            AGS+I+ K   WD  PT TNQIARQ+P+QPWYL+T+ A+LIAG F FGSI VELYFIYS
Sbjct: 513 FAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYS 572

Query: 543 SLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYV 602
           SLWFNKIFYMFG                         C+ENW+WQWR F IGG GC+ Y+
Sbjct: 573 SLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYM 632

Query: 603 FVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           F+H+ILFTKFK             S +IS LCC++TGA+GF S + F+RKIY ++K++
Sbjct: 633 FIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/659 (57%), Positives = 456/659 (69%), Gaps = 11/659 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           +A AF LPGV+PTTY   DEIPLLVN LTPS YFQH D+ G  +S DKE FLYSYDYY D
Sbjct: 15  LAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYND 74

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           KFHFC+PE++ KQPESLGS+IFGDRIYNSPF+L MLE+K CV LCKS IP  DAKFIN L
Sbjct: 75  KFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTL 134

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI---------EDPDTK 182
           I+NGFF NWLVDGLPAAR ++D RT + +YG GFELGF DV  T+         E+ D++
Sbjct: 135 IKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSE 194

Query: 183 KVSESDYIEIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASI 242
                  ++  D  K +K    +  EL++F+NHF+I++EYHDRG  NYRVVGV+V P SI
Sbjct: 195 DSKTGATLDARDP-KNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSI 253

Query: 243 KRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXX 302
           +R S  +C T GEPL L ED DN V+FTYSV F+ S T+WATRWDKYLHVYDPQIQWF  
Sbjct: 254 ERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFSL 313

Query: 303 XXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTML 362
                              RA+++D +RYNELNLD+EF E+ GWKL HGDVFR P ++M+
Sbjct: 314 INFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMV 373

Query: 363 LSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKF 422
           LSVLVGSG QLFLM   +I FA              TVMF+LYALFG  GSYTSM VYKF
Sbjct: 374 LSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKF 433

Query: 423 FNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPL 482
           F+G  WK N+I+TPIL+P  IF+ ++ +N FL+F HSSG IP  T+  I+ LWF  SIPL
Sbjct: 434 FHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPL 493

Query: 483 SVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIY 541
           S AGS I+ K+ +WD  PT TNQIARQ P QPWYL+T+ A+LIAG F FGSI VELYFIY
Sbjct: 494 SFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIY 553

Query: 542 SSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFY 601
           SSLWFNKIFYMFG                         C+ENW WQWR F IGG GC+ Y
Sbjct: 554 SSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSVY 613

Query: 602 VFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           +F+HAILFTKFK             S +IS LCC++TGA+GF SS+ F+RKIY  IKV+
Sbjct: 614 MFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/658 (56%), Positives = 455/658 (69%), Gaps = 9/658 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           +A AF LPG++PTTYH  DEIPLLVN LTPS YFQH D+ G+ +S DKE FLYSYDYY +
Sbjct: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           +FHFCRPE++ KQPESLGS+IFGDRIYNSPF+L MLE K CV LCK  IP  DA+FIN+L
Sbjct: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191
           I +GFF NWLVDGLPAAR ++D RT + +YG GFELGF DV+ T+ D       E   ++
Sbjct: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194

Query: 192 IADADKELKERS--------AKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK 243
            ++A   L  RS         K  EL YF+NHF+I +E+H+RG D+YR+VGV+V P SI+
Sbjct: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254

Query: 244 RDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXX 303
           R S  SC    +PL L ED DN V+FTYSV FV S T+WATRWDKYLH+YDPQIQWF   
Sbjct: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314

Query: 304 XXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLL 363
                             RALK+DL+RYNELNL++EF E+ GWKL HGDVFRTP ++MLL
Sbjct: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374

Query: 364 SVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFF 423
           SVLVGSG QLFLM   +I FA              TVMF+LYALFG  GSYTSM VYKFF
Sbjct: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434

Query: 424 NGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLS 483
           +G  WK N+I+TPIL+P  I + ++ +N FL+F HSSG IP  ++  I+ LWFV SIPLS
Sbjct: 435 HGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494

Query: 484 VAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYS 542
             GS+++ K+  W + PT TNQIARQIP QPWYL+T  A+++AG F FGSI VELYFIYS
Sbjct: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554

Query: 543 SLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYV 602
           SLWFNKIFYMFG                         C+ENW WQWR F IGG GC+ Y+
Sbjct: 555 SLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYM 614

Query: 603 FVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           F+H+ILFTKFK             S ++S LCC++TGA+GF SS+ F+RKIY ++KV+
Sbjct: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/652 (57%), Positives = 455/652 (69%), Gaps = 12/652 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           + SAFYLPGVAPTTY KGDEIPLLVNHLTPS  FQH D +G+ + G+KE FLYS+DYY+ 
Sbjct: 16  LTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFP 75

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           K HFC+PE++ KQPESLGSI+FGDRIYNSPF + MLEN+ C  LCK  IP DDAKFINKL
Sbjct: 76  KLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKL 135

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191
           I+NGFF NWL+DGLPAAR++HD +T S FYG GF LG V V   +    + K      + 
Sbjct: 136 IKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSK------LN 189

Query: 192 IADADKELKERSAKL--TELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDS 249
           + +  +E K  +  +   E+ +  NH+DI +EYHDRGE NYRVVGV+V P   K  + D 
Sbjct: 190 LENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDI 246

Query: 250 CDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXX 309
           C  +   L+L E  DN V F+YSV F+PS+T+WATRWDKYLHVYDP IQWF         
Sbjct: 247 CTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVV 306

Query: 310 XXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGS 369
                       RALK+D +RY E NLDD FQ+++GWKL HGDVFR P+++MLLS+LVGS
Sbjct: 307 ILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGS 366

Query: 370 GAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWK 429
           G QLFLM   +I FA              + MFILYALFG  GSY SM VYKFFNG  WK
Sbjct: 367 GTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWK 426

Query: 430 LNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSII 489
            NMILTPIL+P ++FIS++GLN FL+F  SSG IP   ++ ++VLWF+ SIPLS+AGS+I
Sbjct: 427 ANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLI 486

Query: 490 SRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNK 548
           + KK  W + PT TN+IARQIPFQPWYLKTVPA+LIAG FPFGSI VELYFIYSSLWFNK
Sbjct: 487 ANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNK 546

Query: 549 IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAIL 608
           IFYMFG                          +ENW+WQWR F +GG GCAFY+FVH+I+
Sbjct: 547 IFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSII 606

Query: 609 FTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           FTKFK             S++IS LC ++TGA+GF+SS+ FV+KIY S+KVD
Sbjct: 607 FTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/650 (58%), Positives = 460/650 (70%), Gaps = 3/650 (0%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
            +AFYLPGVAPTTY   DEIPLLVNHL+PS Y+QH  ++G  M GDK R+LYSYDYYYD+
Sbjct: 19  VNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDR 78

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
           FHFC+PE ++K+PESLGSIIFGDRIYNSP+++ MLE KTCVPLC + IP  DA+FINKLI
Sbjct: 79  FHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTK-KVSESDYIE 191
           +NGFF NWL+DGLPAAR +HD  TNS FYGNGFELG V+VV  +    T  K  +S   +
Sbjct: 139 KNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAK 198

Query: 192 IADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251
           ++  D +   +  K  EL YF NH DI +EYHDRGE N RVVGV+V P SIKR S  +C 
Sbjct: 199 LSTRDAK-NVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQ 257

Query: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXX 311
           T G+PL+L E  DN V+FTYSV FV S T+WATRWDKYLH YDP IQWF           
Sbjct: 258 TSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVVL 317

Query: 312 XXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371
                     +AL++D +RYNELNLD+EFQE++GWKL HGDVFR P ++MLLS+LVGSG 
Sbjct: 318 LSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGI 377

Query: 372 QLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431
           QLFLM   +I FA              TVMF+LYALFG  GSYTSM VYKFF G  WK N
Sbjct: 378 QLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 437

Query: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491
           MILTP+L+P  + +S++GLN FL+  HSSG IP  T+  IV+LWFV S+P ++AGS+I+ 
Sbjct: 438 MILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAH 497

Query: 492 KKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550
           KK  WD  PT TNQ+ARQ+PFQPWYLKTV A+ IAG FPFGSI VELYFIY+SLW+NKIF
Sbjct: 498 KKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIF 557

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610
           YMFG                          +ENW+WQWR F +GG GCA Y+FVH+ILFT
Sbjct: 558 YMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFT 617

Query: 611 KFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           K K             S VIS LCCL+TG++GFLSS++FVR+IY SIKV+
Sbjct: 618 KLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/662 (54%), Positives = 453/662 (68%), Gaps = 13/662 (1%)

Query: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70
            + + FYLPGVAPTTYH+ D IPLLVNHLTPS +F+H D +G+ +S DKE FLYSYDYYY
Sbjct: 16  SVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYY 75

Query: 71  DKFHFCRP--ENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFI 128
            K HFC+P    + KQPESLGSI+FGDRIYNSPFEL ML ++ C  LC + IP DDAKFI
Sbjct: 76  SKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFI 135

Query: 129 NKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESD 188
           N LI++GF  NWL+DGLPAAR+++D  T S FYG+GFELG V+++  +++  +    +  
Sbjct: 136 NDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQP 195

Query: 189 YIEIA-----DADKELKERSAKL----TELSYFINHFDIKIEYHDRGEDNYRVVGVSVIP 239
            +E       D ++  ++R+ ++     E +YF NHFDI IEYHDRG + YR+VGV+V P
Sbjct: 196 IVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNP 255

Query: 240 ASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQW 299
            S+KRDS+  CDT    L LSE +D  V FTYSV+F  S T+WATRWDKYLH+YDP IQW
Sbjct: 256 ISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQW 314

Query: 300 FXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPER 359
           F                     +ALKND  RYNE NL+D F E++GWKL HGDVFR P +
Sbjct: 315 FSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTK 374

Query: 360 TMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAV 419
           +MLLS+ VGSG QLF M    ++ A              T+MFILYA+FG  GSYTSM V
Sbjct: 375 SMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGV 434

Query: 420 YKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFS 479
           Y+FFNG  WK NMILTP+++P  IF+ ++ +N FLVFVHSS  +P GT+  +V+LW V S
Sbjct: 435 YRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLS 494

Query: 480 IPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELY 538
           +PLS AGS+IS K+  W D PT TN++ RQIPFQPWYLKTVPA+LI G FPFGSI VELY
Sbjct: 495 LPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELY 554

Query: 539 FIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGC 598
           FIYSSLWFNKIFYMFG                         C+ENW+WQWR F IGG GC
Sbjct: 555 FIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGC 614

Query: 599 AFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIK 658
           + Y+F+H+ILFT+FK             S +I+ LC ++TGA+GF+S+++FV+KIY SIK
Sbjct: 615 SIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIK 674

Query: 659 VD 660
           V+
Sbjct: 675 VE 676

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/675 (53%), Positives = 443/675 (65%), Gaps = 29/675 (4%)

Query: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74
            FYLPG AP TY +GD IPLLVNHLTPS  FQH D +G+ + GDK R LY YDYY +K H
Sbjct: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76

Query: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134
           FC+PE + KQPESLGS+IFG++IYNSPF + MLE+  CV LC + IP  DAKFINKLI+N
Sbjct: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136

Query: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI------EDPDTKKVSESD 188
           GF  NWL+DGLPAAR++HD RTN+ FYG GFELGFV+V   +      E     ++SE D
Sbjct: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196

Query: 189 YIEIAD-ADKELKE------------RSAK--------LTELSYFINHFDIKIEYHDRGE 227
              I D  D E++             R AK          E+  F NHFDI++EYHDRG 
Sbjct: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256

Query: 228 DNYRVVGVSVIPASIKRDSSDSCDTEGE-PLVLSEDADNTVHFTYSVSFVPSQTLWATRW 286
            ++RVVGV V P S+    S SC    +  L L E+ DN V FTYSV F PS T WATRW
Sbjct: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316

Query: 287 DKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGW 346
           DKYLH+YDP+IQWF                     RALK+D+SRYNE NL DEF+E++GW
Sbjct: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376

Query: 347 KLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYA 406
           KLVHGDVFRTP+ +MLLSVLVGSG QLFLM   +I+ +              T MF+ YA
Sbjct: 377 KLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAMFMFYA 436

Query: 407 LFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFG 466
           +FG  GSYTSM +YKFF G  WK NMILTP+L+P +IF++++ +N  L FV SS  IP  
Sbjct: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496

Query: 467 TMLAIVVLWFVFSIPLSVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIA 525
           T++ +V LW +FSIPL+ AGS+IS KK  WD  PT TN+I RQIPFQPW+LKTVPA+LI 
Sbjct: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556

Query: 526 GTFPFGSIVVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWK 585
           G   FGSI VELYFIYSSLWFNKIFYMFG                         C ENW 
Sbjct: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616

Query: 586 WQWRGFWIGGAGCAFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLS 645
           WQWR F+IGG GC+ Y+F+H+ILFT+FK             S +IS L C++TGA+GF+ 
Sbjct: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676

Query: 646 SLWFVRKIYGSIKVD 660
           S++FVR+I+ SIKVD
Sbjct: 677 SMFFVRRIFASIKVD 691

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/655 (53%), Positives = 443/655 (67%), Gaps = 9/655 (1%)

Query: 11  QIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYY 70
            +  AF LPG+ P TY KGD+IPLLVNHLTPS +F H ++EG  +S  K+  ++SYDYYY
Sbjct: 13  SVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYYY 72

Query: 71  DKFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINK 130
           +KFHFC+P ++ K   S+GSI+FGDRIYNSPF+LNMLENKTCVPLC+S IP  DA+FINK
Sbjct: 73  EKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFINK 132

Query: 131 LIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIED---PDTKKVSES 187
           LI+NG++ NW +DGLPAARE++D RT S FYGNGFELG V++  T  D   PD    S  
Sbjct: 133 LIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPD----SVH 188

Query: 188 DYIEIADAD-KELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDS 246
           D  ++A  D K L +   K  E+ YF+NHFDI IEYH+RG  NYRVVG +V P SI R S
Sbjct: 189 DISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKS 248

Query: 247 SDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXX 306
           +  C   G+ L L+E+ DN VH TYSV+FVPS+T W TRWDKYLHVYDP+IQWF      
Sbjct: 249 AGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFS 308

Query: 307 XXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVL 366
                          +ALK+D +RYN +NLDD+ +EE+GWKLVHG VFR P+  M+LS+L
Sbjct: 309 LIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSIL 368

Query: 367 VGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQ 426
           VGSG QLFL+   T+  A              T M ILY LFG   SY SM VYKFF G 
Sbjct: 369 VGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGP 428

Query: 427 NWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAG 486
            WK+NM+LTPIL+P +I I+ L LN FL+F  SS  +P  T++ +++LWF  SIPLSVAG
Sbjct: 429 YWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAG 488

Query: 487 SIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLW 545
           S++++KK  WD  PT TNQIA+ IP Q WYLKT+PASLI G F FGSI V+LYFIY+SLW
Sbjct: 489 SLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLW 548

Query: 546 FNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVH 605
           FN IFYM+G                         C ENWKWQWRGF+IGG GC+ YV +H
Sbjct: 549 FNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLH 608

Query: 606 AILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           ++ F + K             S V++ L  L+TG+VGFLSS++F+++I+ S+KVD
Sbjct: 609 SLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/650 (55%), Positives = 445/650 (68%), Gaps = 10/650 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           +A  FYLPG APTTY +GD IPLLVNH+TP+ +    D+ G     DKER+LY+YDYYY 
Sbjct: 13  LAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYYP 70

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           + H CRP+ + K  ESLGSIIFGDR++NSPFEL MLE K+CV LC+  +P +DAKFIN+L
Sbjct: 71  RLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQL 130

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191
           IR+GFFHNWLVDGLPA REMHD RTN+ FYG GFELG   V+   ED + ++       E
Sbjct: 131 IRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPG-----E 183

Query: 192 IADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251
           I    + + +    +  + YFINHF+I ++YH R ED  RVVGVSV+P S++    D C 
Sbjct: 184 IELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCA 243

Query: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXX 311
             G  LVLSE AD  V FTYSV F  S   WATRW KYLHVYDP++QW+           
Sbjct: 244 NSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLL 303

Query: 312 XXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371
                    FRALK DL RYN+ NLD+EFQE+ GWKL+H DVFR+P +T+LLSV VGSG 
Sbjct: 304 LSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGG 363

Query: 372 QLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431
           QLFLM+  T+  A              T+MF+LYA+FG FGSY SM+ YK F G+ WK+N
Sbjct: 364 QLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVN 423

Query: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491
           M+LTP+L+P +IF +ML +N FLV V SSGA+PFGTMLAIVVLWFV SIP+S+ GS+ +R
Sbjct: 424 MVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFAR 483

Query: 492 KKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550
           KK+ WD+ PT T+QIA+QIP QPWYL+T PA+ IAG FPFG+I VELYFIY+S+WFN +F
Sbjct: 484 KKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMF 543

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610
           YMFG                         CMENW WQWR F IGG GC+ YVF+++ILFT
Sbjct: 544 YMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFT 603

Query: 611 KFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           KF+             S++IS L CL+TG +GF+SSLWFVRKIY SIKVD
Sbjct: 604 KFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/661 (52%), Positives = 438/661 (66%), Gaps = 21/661 (3%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
           ++AFY+PG++  TYH GD I L VN LTPS YF+H D+ G +++ DKE FLYSYDYYYDK
Sbjct: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
           FHFCRPE + ++ ESLGS++FGDRIYNSPFEL MLE K CVPLCK+ IP DDAKFINKLI
Sbjct: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVV-----DTIEDPDTKKVSES 187
           +NGFF+NWL+DGLP+AR+++D +T S FY +GF LG V V        +  P   K+   
Sbjct: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKL--- 195

Query: 188 DYIEIADADKELKERSAK--------LTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIP 239
               + +A K  K+R AK          E+ YF NHF+I IEYHDRG +NYRVVGV+V P
Sbjct: 196 ----VNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDP 251

Query: 240 ASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQW 299
            SIKRD  +SC   G  L L+E+A+N V FTYSV F+ S+T WATRWDKYLH YDP IQW
Sbjct: 252 ISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQW 311

Query: 300 FXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPER 359
           F                     RALK D+SRY +LNLD+ F E++GWKL HGDVFR P +
Sbjct: 312 FSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRK 371

Query: 360 TMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAV 419
            M+LS+ VGSG QLFLM    +  A              T MF+LYA+FG  GSYTSM V
Sbjct: 372 AMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGV 431

Query: 420 YKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFS 479
           YKFF+G  WK NMILTP+L+P  + + ++ LN FL+ VHSSG IP  T++ ++ LW + S
Sbjct: 432 YKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVS 491

Query: 480 IPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELY 538
           +PLS  GS ++ KK  W D PT  N+I R+IP QPWY++++P  L++G  PFG+I VELY
Sbjct: 492 VPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELY 551

Query: 539 FIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGC 598
           FIYSSLW+NKIFYMFG                         C+ENW+WQWR F  GG GC
Sbjct: 552 FIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGC 611

Query: 599 AFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIK 658
           AFY+F+++I FT+FK             S +I  + CLITGAV F+ +++FV++I+ SIK
Sbjct: 612 AFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIK 671

Query: 659 V 659
           V
Sbjct: 672 V 672

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/676 (51%), Positives = 444/676 (65%), Gaps = 33/676 (4%)

Query: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72
            +AFYLPGVAP+TY++GDE+PLLVNHLTPS  +Q  D  G  +   +E+ LYS+DYY+ K
Sbjct: 15  CNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKMLYSFDYYFPK 73

Query: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132
            HFC+PE ++KQP+SLGSI+FGDRIYNSPF + ML+ +  V LC   IP  DAKFINKLI
Sbjct: 74  LHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLI 133

Query: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDV---VDTIEDPDTKKVSESDY 189
           +NGFF NWL+DGLPAAR+++D  T++ FY  GF LGFV++   V  +  P   K  +S  
Sbjct: 134 KNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGK 193

Query: 190 IEIA-----------------DADKELKERSAKLTEL------SYFINHFDIKIEYHDRG 226
                                D++K+ K    ++++L       Y  NH+ I +E HDRG
Sbjct: 194 KNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVEVHDRG 253

Query: 227 EDNYRVVGVSVIPASIKRDSSDSCDTE-GEPLVLSEDADNTVHFTYSVSFVPSQTLWATR 285
           E NYRVVGV+V P S    ++DS + E G  L L E  DN V F+YSV+F+ S+T+WATR
Sbjct: 254 EGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATR 309

Query: 286 WDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETG 345
           WDKYLH Y+P IQWF                     +ALK+D +RY E NLD+ F E++G
Sbjct: 310 WDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNEDSG 369

Query: 346 WKLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILY 405
           WKL HGDVFR P ++MLLS+LVGSGAQLFLM   +I  A              + MF  Y
Sbjct: 370 WKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFY 429

Query: 406 ALFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPF 465
           ALFG +GSY SM+VYKFF G  WK NMILTP+L+P  I +S+LGLN FL+FVHSSG IP 
Sbjct: 430 ALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPM 489

Query: 466 GTMLAIVVLWFVFSIPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLI 524
             +L IVV+WFV S+PLS  GS+++ K+S W + PT TNQIARQIPFQ WYLKT+PA LI
Sbjct: 490 TALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILI 549

Query: 525 AGTFPFGSIVVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENW 584
           AG FPFG+I VELYFIY+SLWFNKIFYMFG                         CMENW
Sbjct: 550 AGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCMENW 609

Query: 585 KWQWRGFWIGGAGCAFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFL 644
            WQWR F IGG GC+ Y+F+H+ILFTKFK             ++++S L C++TGAVGF+
Sbjct: 610 NWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFI 669

Query: 645 SSLWFVRKIYGSIKVD 660
           SS+ FVRKIY +++VD
Sbjct: 670 SSMIFVRKIYSNVRVD 685

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/650 (51%), Positives = 428/650 (65%), Gaps = 8/650 (1%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           ++ A +LPG++PT Y    EI L VNHLTPS +FQH D++G+ +  DKE +LYSYDYY  
Sbjct: 14  VSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNS 73

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
           K HFC+PEN+I+Q ESLGS++FGDR+YNSPF+LNMLE+K+CV LCKS IP +DA FINKL
Sbjct: 74  KLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKL 133

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191
           I+NGF HNWLVDGLPA   +++ R +S    NGF LG V+++  + +       E   I 
Sbjct: 134 IKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGIS 193

Query: 192 IADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251
              ++  +        EL +  NH+DI I+YH+     YR+VGV V P SIK+ +S+SC+
Sbjct: 194 AHGSNVVVN------LELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSCE 246

Query: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXX 311
             GE + LSED DN V +TYSV +V     WATRWD Y   YD  +QWF           
Sbjct: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIG 306

Query: 312 XXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371
                     RALK+D +RYNELNLDDEF EE+GWKL HGDVFR P +++LLSVLVGSG 
Sbjct: 307 LSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGV 366

Query: 372 QLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431
           QL L+A   I+ A              T+ F+LYALFG  GSY SM VY+FF G   K+N
Sbjct: 367 QLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426

Query: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491
           MILTP LIP +I ++++ LN FL+  HSS AIPF  + A+V+LW + S+PLS+AGS+ + 
Sbjct: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486

Query: 492 KKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550
           K   WD+ PT TNQIARQIPFQPWYLKT+PA+L+AG FPF SI VELYFIY+SLWF++ F
Sbjct: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610
           YMFG                         C+ENW+WQWR F +GG G A Y+F+H+I FT
Sbjct: 547 YMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606

Query: 611 KFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           +FK             S++IS LCCL TGAVGF SS++ VRKI+ S+KVD
Sbjct: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/626 (51%), Positives = 406/626 (64%), Gaps = 17/626 (2%)

Query: 44  YFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPENLIKQPESLGSIIFGDRIYNSPFE 103
           ++ H +QEG  +S D +R +YSYDYYY+K HFC+PE++ K   S+GS++FGDR+YNSPF+
Sbjct: 2   HYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQ 61

Query: 104 LNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGN 163
           LNML+NKTC  LC S I   DAKFINKLI+NG++ NWL+DGLPAARE++D RT S FYGN
Sbjct: 62  LNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGN 121

Query: 164 GFELGFVDVVDTIEDPDTKKVSESDYIEIADADKELKERSAKL--------TELSYFINH 215
           GFELG V++  T  +   K +  S     AD  ++L +R AK          E+ YF+NH
Sbjct: 122 GFELGLVEIRQTTGE---KLLPNS-----ADTFRDLHKRDAKNIVQNLMQDIEVPYFVNH 173

Query: 216 FDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSF 275
           FDI+IEYHDRG DNYRVVGV+V P SI R     C   G+ L LSE   N +HFTYSV F
Sbjct: 174 FDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEF 233

Query: 276 VPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELN 335
           +PS+T W TRWDKYLHVYDP IQW                      +ALK+D SRY ELN
Sbjct: 234 IPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELN 293

Query: 336 LDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXX 395
           LD+  +E+  WKL HGDVFR P+  MLLS+LVGSG QLFLM   TI              
Sbjct: 294 LDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRG 353

Query: 396 XXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLV 455
              TVMF+LY  F    S+ SM VYKFFNGQ W +N ILTP L+P ++ + ++GLN FL+
Sbjct: 354 TLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLI 413

Query: 456 FVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKKSQWD-RPTNTNQIARQIPFQPW 514
           FVHSSG IP  T  ++++LWF   +PLS+ GS+++RK   WD  PT TN +++ IP Q W
Sbjct: 414 FVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKW 473

Query: 515 YLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXX 574
           YL+T+PASLI G F FGS+ VELYF+Y+SLWFNKIFYM+G                    
Sbjct: 474 YLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLF 533

Query: 575 XXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKFKXXXXXXXXXXXXXSVVISGLC 634
                  ENW+WQWR F I G GC+FYVF+H++LFT+ K             S VI+ L 
Sbjct: 534 TYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLA 593

Query: 635 CLITGAVGFLSSLWFVRKIYGSIKVD 660
            ++TGA+GFLSS+ FVR IY ++KVD
Sbjct: 594 FVVTGALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/650 (44%), Positives = 381/650 (58%), Gaps = 58/650 (8%)

Query: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71
           ++  FY PGV+P TYH GDEIPLLVN+L+                     FL++ DYY D
Sbjct: 13  VSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYYSD 53

Query: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
               C+P  + +Q ESLGS+IFGDR+YNSPF+++ML+N  CV LC + I   D    N  
Sbjct: 54  SIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTF 110

Query: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191
               + +NWLVDGLP      DG +++  Y N  EL      D                 
Sbjct: 111 FGYRYSYNWLVDGLPVLGI--DGTSDANGYHNNSELFMGYQAD----------------- 151

Query: 192 IADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD 251
                           E  Y  NHFDI I Y+DRG+  YRVV     P S+ R  S+ C 
Sbjct: 152 ----------------EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCS 195

Query: 252 TEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFXXXXXXXXXXX 311
            + +P+ +       + FTYSV F  S   W+TRWD+YLHVYD  IQ             
Sbjct: 196 KDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLL 255

Query: 312 XXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGA 371
                    FR LK D++ Y+E NLDDEFQ++  WK++HG+VFR+P + +LLSV VGSG+
Sbjct: 256 LSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGS 315

Query: 372 QLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLN 431
           QLF MA  T+L                TVMF+LYALFG  GSYTSM++YKFF GQNWKLN
Sbjct: 316 QLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLN 375

Query: 432 MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISR 491
           +ILTP+LIP  +F++ + LN FL++  SSGA+PFGTM+ I++LWF+ S+P+S+ GS++S 
Sbjct: 376 LILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSW 435

Query: 492 KKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIF 550
           K ++WD  P  TNQIARQ+P QPWY+KT  A+ +AG FPFG++ VELY+IY+S+W   IF
Sbjct: 436 KLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIF 495

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGFWIGGAGCAFYVFVHAILFT 610
           +M+G                         CMENWKWQWR F IGG GC+ YVF+H++ F 
Sbjct: 496 FMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFI 555

Query: 611 KFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           KFK             S ++S +CCL+TG++GFL++LWFVRKIY +IKVD
Sbjct: 556 KFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 179/681 (26%), Positives = 268/681 (39%), Gaps = 109/681 (16%)

Query: 23  PTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPENLI 82
           P  Y KGD + L+VN +                    E  L    Y Y    F  P  + 
Sbjct: 44  PNYYSKGDPVELIVNKV--------------------ESDLTQLPYAYYDLPFTCPPTMH 83

Query: 83  KQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHNW 140
           K+P   SL  II GDR + S + LN  E+  C  LC  +  K+  K   +L++NG+   W
Sbjct: 84  KKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQW 143

Query: 141 LVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADKEL 199
           L+D  LPA         +  +Y +GF LGFV       DP+T K                
Sbjct: 144 LIDDELPAVTTFISTTDHKKYYASGFPLGFV-------DPETGK---------------- 180

Query: 200 KERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGEPL 257
                     +Y   H  I I Y+    + + + G  + P S         S D E   L
Sbjct: 181 ----------TYLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYEL 230

Query: 258 VLSEDADNT--VHFTYSVSFVPSQTL-WATRWDKYLHVYD------PQIQWFXXXXXXXX 308
           V+ E+ D+   + FTYSV +     + W  RWD YL+  +       Q  W         
Sbjct: 231 VVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGI 290

Query: 309 XXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVL-- 366
                       +R  K  +SR +  ++  E +++ G   V    +   E+T L +VL  
Sbjct: 291 VFLISSITAVILYRTFK--ISRRSFSDISKE-EDDKGSIYVVARKWLLNEQTPLANVLII 347

Query: 367 -VGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSF-GSYTSMAVYKFF 423
            V  G Q LF + G  I+               T  M +L  + G+F  S+T   + K  
Sbjct: 348 FVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLT--MGLLCFVTGAFMASFTGAHLLKSR 405

Query: 424 NGQNWKLNM----------ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVV 473
                +  M          +L   L+PS + +  L LN+ +    S+ A+PFGT+L ++ 
Sbjct: 406 EEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLIS 465

Query: 474 LWFVFSIPLSVAGSIISRKKSQWDRPTNTNQIA---------RQIPFQPWYLKTVPASLI 524
           ++FV  IPLS+ G  I+ K +   +P+ +  I          + I   P  L   P S +
Sbjct: 466 VYFVVCIPLSLLGGYIAVKSTN-SKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSL 524

Query: 525 A----GTFPFGSIVVELYFIYSSLWFNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXX 576
           A    G FPF  I VEL ++Y SLW  K     FY F                       
Sbjct: 525 AILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFIL 584

Query: 577 XXXCMENW-KWQWRGFWIGGAGCAFYVFVHAILFTKF--KXXXXXXXXXXXXXSVVISGL 633
                +N   W+W  F I GA CAFY+ V+++ +  F                  + + +
Sbjct: 585 LNSADKNSNNWRWTSFQI-GASCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIM 643

Query: 634 CCLITGAVGFLSSLWFVRKIY 654
           C   TG++  L+S WFV+KIY
Sbjct: 644 CGCATGSIACLTSHWFVQKIY 664

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  141 bits (356), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 157/685 (22%), Positives = 258/685 (37%), Gaps = 106/685 (15%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y +GDE+ L+VN +                    E  L    Y Y    F  P  
Sbjct: 41  LQPNFYFQGDEVELIVNKV--------------------ESDLTQLPYAYYDLPFTCPPT 80

Query: 81  LIKQP--ESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
           + K+P   SL  II GDR + S + L   ++ TC  LC  +  K+  K   KL+ +G+  
Sbjct: 81  MHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVV 140

Query: 139 NWLVD-GLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            WL+D  LPAA           +Y +GF LGFV       DPDT KV             
Sbjct: 141 QWLIDEELPAATTFISTIDQKKYYASGFPLGFV-------DPDTGKV------------- 180

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEP- 256
                        Y   H  + I Y+    + + +VG  V P S+            EP 
Sbjct: 181 -------------YLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPY 227

Query: 257 -LVLSEDADNT--VHFTYSVSFVPSQTL-WATRWDKYLHVYD------PQIQWFXXXXXX 306
            +V+ E+ D+   + FTYSV +     + W  RWD YL+  +       Q  W       
Sbjct: 228 EIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSA 287

Query: 307 XXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVF--RTPERTMLLS 364
                          R+ K+      ++N  +E +    +++    +   RTP   +L+ 
Sbjct: 288 GIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINERTPLANLLI- 346

Query: 365 VLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFN 424
           + V  G Q       ++  +              T+  + + L     SY    + +  N
Sbjct: 347 LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKN 406

Query: 425 GQNWKLN----------MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVL 474
               K             IL    +P ++ I  L LN+ +    S+ A+PF T++  + +
Sbjct: 407 KATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITV 466

Query: 475 WFVFSIPLSVAGSIISRK----------KSQWDRP-----TNTNQIARQIPFQPWYLKTV 519
           +F+  IPLS+ G  ++            K    RP      N  +  + I      LK++
Sbjct: 467 YFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSI 526

Query: 520 PAS---LIAGTFPFGSIVVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXX 574
             +   L++G FPF  I VEL ++Y S+W  K   +Y +G                    
Sbjct: 527 KIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIG 586

Query: 575 XXXXXCM---ENWKWQWRGFWIGGAGCAFYVFVHAILFTKF--KXXXXXXXXXXXXXSVV 629
                 M    N  W+W  F++ G+ CA+Y+ ++++ +  F                  +
Sbjct: 587 TYTMLHMADRNNTDWRWISFFM-GSSCAWYMELYSLYYVFFILNIRGFSSIFISVCYGAL 645

Query: 630 ISGLCCLITGAVGFLSSLWFVRKIY 654
            + LC    G++  L+S +FV K+Y
Sbjct: 646 FNTLCGCAMGSIASLTSHFFVEKLY 670

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  134 bits (338), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 166/706 (23%), Positives = 266/706 (37%), Gaps = 129/706 (18%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y KGD + L+VN +                    E  L    Y Y    F  P  
Sbjct: 52  ITPNFYRKGDPLELIVNKV--------------------ESDLTQLPYAYYDLPFTCPPT 91

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
           + K+P   SL  II GDR + S ++L   E+  C  LC  +  K+  + ++KL+R G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVV 151

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            WL+D  LPAA        +  +Y +GF LGF+       DPDT K              
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFI-------DPDTDK-------------- 190

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                       +Y  NH  + I +H    D   +VG  V P S+        S + E  
Sbjct: 191 ------------TYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQY 238

Query: 256 PLVLSEDADNTVH--FTYSVSFVPS-QTLWATRWDKYLHVYD------PQIQWFXXXXXX 306
            +V+ ED +   +  FTYSV +    +  W  RWD +L+  +       Q  W       
Sbjct: 239 EIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSV 298

Query: 307 XXXXXXXXXXXXXXFRALKNDLS-----RY--------NELNLDDEFQEETGWKLVHGDV 353
                          R +  D S     +Y         E +LDD+   +     V  D 
Sbjct: 299 GIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKDW 358

Query: 354 FRTPERTM----LLSVLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVM--FILYA 406
            +     +    +L +LV  G Q LF + G   +               T  +  F+L A
Sbjct: 359 IQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFFVLGA 418

Query: 407 LFGSF-GSYTSMAVYKFFNGQNW-----------KLNMILTPIL---IPSMIFISMLGLN 451
              SF G+  SM         N+           K + I T +    +P ++ +S   LN
Sbjct: 419 FMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLLN 478

Query: 452 TFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK---KSQW-----DRPTNTN 503
           + +    S+ A+PF T++  + ++F+  IPLS+ G I++        W        +N++
Sbjct: 479 SIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDESNSD 538

Query: 504 QIARQIP-----FQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKI----FYMFG 554
                +P     F P     +    + G FP   I VE+ ++Y SLW  K     FY F 
Sbjct: 539 GNGLFVPKSRAKFNPLVYCGI---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFL 595

Query: 555 XXXXXXXXXXXXXXXXXXXXXXXXXCMENW----KWQWRGFWIGGAGCAFYVFVHAI--L 608
                                    C E+      W+W+ F +G +G   Y+ ++++  +
Sbjct: 596 FLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYI 654

Query: 609 FTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIY 654
           F                 S++ + +C L  GA+ +L++ WF+ KIY
Sbjct: 655 FAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  130 bits (327), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 168/716 (23%), Positives = 269/716 (37%), Gaps = 131/716 (18%)

Query: 14  SAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKF 73
           + +Y   + P  Y KGD + L+VN +                    E  L    Y Y   
Sbjct: 45  NTYYDGWITPNFYKKGDPLELIVNKV--------------------ESDLTQLPYAYYDL 84

Query: 74  HFCRPENLIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
            F  P  + K+P   SL  II GDR + S + L   E+  C  LC  +  K+  + ++KL
Sbjct: 85  PFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKL 144

Query: 132 IRNGFFHNWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI 190
           +R G+   WL+D  LPAA        +  +Y +GF LGFV       DPDT K       
Sbjct: 145 VREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFV-------DPDTGK------- 190

Query: 191 EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSD 248
                              +Y  NH  + I +H    D   +VG  V P S+        
Sbjct: 191 -------------------TYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGA 231

Query: 249 SCDTEGEPLVLSEDADNTVH--FTYSVSFVPS-QTLWATRWDKYLHVYD------PQIQW 299
           S + E   +V+ ED +   +  FTYSV +    +  W  RWD +L+  +       Q  W
Sbjct: 232 SKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHW 291

Query: 300 FXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYN-------------ELNLDDEFQEETGW 346
                                 + +  D    +             E NLDD+   +   
Sbjct: 292 MSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNSV 351

Query: 347 KLVHGDVFRTPERTM----LLSVLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVM 401
            +V  D  +     M    +L VLV  G Q LF + G   +               T  +
Sbjct: 352 YMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAI 411

Query: 402 --FILYALFGSF-GSYTSMAVY------------KFFNGQNWKLNMILTPIL---IPSMI 443
             F+L A   SF G+  S+               K FN  N K + +   I    +P ++
Sbjct: 412 LCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCN-KFSPVFAIICGSSLPGLV 470

Query: 444 FISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK---KSQW---- 496
            +S   LN+ +    S+ A+PF T++  + ++F+  IPLS+ G  ++        W    
Sbjct: 471 MVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGI 530

Query: 497 ---DRPTNTNQI---ARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKI- 549
              +   N++++     +  F P     +    + G FPF  I VEL ++Y S+W  K  
Sbjct: 531 TKDETCGNSSRLFVPRSRTKFNPLVYCGI---YLCGLFPFLVIYVELQYVYKSVWLEKTT 587

Query: 550 ---FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENW----KWQWRGFWIGGAGCAFYV 602
              FY F                          C E+      W+W+ F +G +G   Y+
Sbjct: 588 FYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYM 646

Query: 603 FVHAI--LFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGS 656
            ++++  +F                 S++ + +C L  G + +L++ WF+ KIY S
Sbjct: 647 ELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  127 bits (320), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 165/703 (23%), Positives = 265/703 (37%), Gaps = 126/703 (17%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + PT Y  GD + ++VN +                  D  +  Y Y   YD   F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNKI----------------ESDATQLPYGY---YD-LPFTCPPT 72

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
           + K+P   SL  +I GDR + S +EL   ++  C  LC  +   D  + ++K I+  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            W +D  LPAA           +YG+GF LGFVD        +T KV             
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFVD-------EETGKV------------- 172

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                        Y  NH  + I YH   + N+ +VG  + P S+        S D +  
Sbjct: 173 -------------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQY 219

Query: 256 PLVLSEDA--DNTVHFTYSVSFVPS-QTLWATRWDKYLH------VYDPQIQWFXXXXXX 306
            +V+ E A  D  + FTYSV +       W  R++ +            +  W       
Sbjct: 220 EVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWISLANSA 279

Query: 307 XXXXXXXXXXXXXXFR--ALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLS 364
                          +   + N L    E      F     W   + D    P    L  
Sbjct: 280 SIAFLMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNW--FYDD---RPVMPHLFI 334

Query: 365 VLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVM--FILYALFGSFGSYTSMAVYK 421
            +V  G   LF + G   +               T  +  F+L A   SF   T +    
Sbjct: 335 CIVSMGVHFLFTVIGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGGTLLIENN 394

Query: 422 FFNGQNWKLNMILTPILIPSMIFISMLG---------LNTFLVFVHSSGAIPFGTMLAIV 472
               +   L  + + IL+ S++  S+L          LN  +    S+  +PF T++ ++
Sbjct: 395 KLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLL 454

Query: 473 VLWFVFSIPLSV-AGSIISRKKS-QWDR----------PTNTNQI-----------ARQI 509
            ++F+  IPLSV  GSI + K S ++ R           T  N+I            R++
Sbjct: 455 FIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKL 514

Query: 510 PFQ-PWYLK-------TVPASLIAGTFPFGSIVVELYFIYSSLWFNK--IFYMFGXXXXX 559
            ++  W LK       TV + L +G FPF  I VEL F+Y S+W+ K   +Y +G     
Sbjct: 515 KYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLAN 574

Query: 560 XXXXXXXXXXXXXXXXXXXXCMENW----KWQWRGFWIGGAGCAFYVFVHAI--LFTKFK 613
                                + +      W+W+ F +  + CA+Y+  ++I  +F    
Sbjct: 575 IILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQL-SSSCAWYMEAYSIYYVFKVLN 633

Query: 614 XXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGS 656
                        S++ + LC L  G++G+L+SLWFV+++Y S
Sbjct: 634 MRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  126 bits (317), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 165/706 (23%), Positives = 260/706 (36%), Gaps = 129/706 (18%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y K D + L+VN +                    E  L    Y Y    F  P  
Sbjct: 53  ITPNFYKKNDFLELIVNKV--------------------ESDLTQLPYAYYDLPFTCPPT 92

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
           + K+P   SL  II GDR + S ++L   E+  C  LC  +  K   + ++KL+R G+  
Sbjct: 93  MHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVV 152

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            WL+D  LPAA        +  +Y +GF LGFV       DPDT K              
Sbjct: 153 QWLIDDELPAATTFISTTDHKKYYASGFPLGFV-------DPDTDK-------------- 191

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                       +Y  NH  + I +H  G+D   VVG  V P S+        S + E  
Sbjct: 192 ------------TYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQY 239

Query: 256 PLVLSEDADNTVH--FTYSVSFVPS-QTLWATRWDKYLHVYD------PQIQWFXXXXXX 306
            +V+ ED  +  +  FTYSV +    +  W  RW+ +L+  +       Q  W       
Sbjct: 240 EIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSL 299

Query: 307 XXXXXXXXXXXXXXFRALKNDLSRYN-------------ELNLDDEFQEETGWKLVHGDV 353
                          R ++ D    +             E +LDD+   +    +V  D 
Sbjct: 300 GIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDW 359

Query: 354 FRTPERTM----LLSVLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVM--FILYA 406
            +  +  +    +L VLV  G Q LF + G   +               T  +  F+L A
Sbjct: 360 IQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGA 419

Query: 407 LFGSFGSYTSMAVYKFFN--------GQNWKLNMILTPIL-------IPSMIFISMLGLN 451
              SF       V K  N         +++K     +PI        +P M+ I    LN
Sbjct: 420 FMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLN 479

Query: 452 TFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK------------KSQWD-R 498
           + +    S+ A+PF T++  + ++FV  IPLS+ G I++              K + D  
Sbjct: 480 SVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGN 539

Query: 499 PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYMFGXXXX 558
            +   +   +  F P     V    + G FP   I VE+ ++Y SLW  K  + F     
Sbjct: 540 GSKLFKPKSRTRFNPLVHCGV---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFL 596

Query: 559 XXXXXXXXXXXXXXXXXXXXXCME--------NWKWQWRGFWIGGAGCAFYVFVHAI--L 608
                                 M            W+WR F +G +G   Y+ ++++  +
Sbjct: 597 FLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYI 655

Query: 609 FTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIY 654
           F                 S++ + LC L  GA+  L++ WF+ +IY
Sbjct: 656 FVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  124 bits (310), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 165/716 (23%), Positives = 263/716 (36%), Gaps = 124/716 (17%)

Query: 14  SAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKF 73
           S  Y   + P  Y  GD + L+VN +                    E  L    Y Y   
Sbjct: 45  SNLYDGWITPNFYKNGDPLELIVNKV--------------------ESDLTQLPYAYYDL 84

Query: 74  HFCRPENLIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131
            F  P  + K P   SL  II GDR + S ++L   E+  C  LC  +  K+  + ++KL
Sbjct: 85  PFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKL 144

Query: 132 IRNGFFHNWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYI 190
           IR G+   WL+D  LPAA        +  +Y +GF LGF+       DPDT K       
Sbjct: 145 IREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFM-------DPDTGK------- 190

Query: 191 EIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSD 248
                              +Y  NH  + I +H        +VG  V P S+        
Sbjct: 191 -------------------TYLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGA 231

Query: 249 SCDTEGEPLVLSEDADNTVH--FTYSVSFVPS-QTLWATRWDKYLHVYD------PQIQW 299
           S   E   + + ED +   +  FTYSV +    +  W  RWD +L+  +       Q  W
Sbjct: 232 SKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHW 291

Query: 300 FXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYN-------------ELNLDDEFQEETGW 346
                                   +  D +  +             E  L+++   +   
Sbjct: 292 MSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSV 351

Query: 347 KLVHGDVFRTPERTML----LSVLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVM 401
            +V  D  +  +  +     L VLV  G Q LF + G   +               T  +
Sbjct: 352 YMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAI 411

Query: 402 --FILYALFGSFGSYTSMAVYK--------FFNGQNWKLNMILTPIL-------IPSMIF 444
             F++ A   SF       V K        F + +N+K     +PI        +P MI 
Sbjct: 412 LCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIM 471

Query: 445 ISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK---KSQWDRPTN 501
           IS   LN+ +    S+ A+PF T++  + ++F+  IPLS+ G I++        W     
Sbjct: 472 ISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGIT 531

Query: 502 TNQIARQ-----IPFQPWYLKTVPASLI--AGTFPFGSIVVELYFIYSSLWFNKI----F 550
            ++   +     +P  P     +    I   G FP   I VE+ ++Y SLW  K     F
Sbjct: 532 IDESDSKNNKLFLPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYF 591

Query: 551 YMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENW----KWQWRGFWIGGAGCAFYVFVHA 606
           Y F                          C E+      W+W+ F +G +G   Y+ +++
Sbjct: 592 YGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYS 650

Query: 607 I--LFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
           +  +F                 S++ + +C L  GA+ +L++ WF+ KIY  +KV+
Sbjct: 651 LYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  119 bits (299), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 158/692 (22%), Positives = 265/692 (38%), Gaps = 115/692 (16%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y  GD + LLVN +                  D  +F Y Y   YD    C P  
Sbjct: 41  LQPNVYRWGDHVELLVNKV----------------ESDLTQFPYGY---YDLPFTCPPTE 81

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
             K+P   SL  II GDR + S ++L   ++ +C  LC  +      +   +L+R G+  
Sbjct: 82  -DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            WL+D  LPAA        +  +Y +GF LGFV       DPDT+K              
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFV-------DPDTEK-------------- 179

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                       +Y   H  + I Y+    + + +VG  V P S+        S   E  
Sbjct: 180 ------------TYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQY 227

Query: 256 PLVLSEDADNTVH--FTYSVSFVPS-QTLWATRWDKYLH------VYDPQIQWFXXXXXX 306
            L++ E+ D   +  FTYSV +    +  W+ RW+ +L+          +  W       
Sbjct: 228 ELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSV 287

Query: 307 XXXXXXXXXXXXXXFRALK---NDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTM-- 361
                         +R ++      S   +   D+  + ++ + +    + +T   ++  
Sbjct: 288 GISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISF 347

Query: 362 -LLSVLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVMFIL----YALFGSFGSYT 415
            +L++ V  G Q LF + G                   +   F L    Y      G++ 
Sbjct: 348 KILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWL 407

Query: 416 SMAVYKFFNGQNWKLNM--ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVV 473
            +      +G   +     IL    +P ++ IS   LN  +    SS A+PF T++  V 
Sbjct: 408 HIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVS 467

Query: 474 LWFVFSIPLSVAGSIIS----RKKSQWDRPTNTNQIARQIPFQPWYLKTVPAS------- 522
           ++FV  IPLS+ G  +S    RK++Q + P  ++  AR I  +P    T  A        
Sbjct: 468 IYFVICIPLSLLGEEVSHRVHRKQAQ-NFPILSSLGARSI--KPCRAPTTLAPRKISERL 524

Query: 523 -------LIAGTFPFGSIVVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXX 573
                   I G  PF  I VEL +IY S+W  K   +Y++G                   
Sbjct: 525 TFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFL 584

Query: 574 XXXXXXCMENWK-------WQWRGFWIGGAGCAFYVFVHAI--LFTKFKXXXXXXXXXXX 624
                  M   K       W+W+ F + G  CA+Y+ ++++  +F   K           
Sbjct: 585 GCYVM--MRKHKRVATFDSWRWKCF-MMGTSCAWYMELYSLYYIFHTLKMTGFPSIFISV 641

Query: 625 XXSVVISGLCCLITGAVGFLSSLWFVRKIYGS 656
             S++ + +C    G++G+L+S W V +++ +
Sbjct: 642 SYSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  118 bits (296), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 143/625 (22%), Positives = 239/625 (38%), Gaps = 82/625 (13%)

Query: 69  YYDKFHFCRPENLIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAK 126
           YYD   F  P    K+P   SL  II GDR + S ++L + ++  C  LC  +  ++  +
Sbjct: 70  YYD-LPFTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQ 128

Query: 127 FINKLIRNGFFHNWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVS 185
               LI++G+   W++D  LPAA        N  +Y  GF LG VD       P + +V 
Sbjct: 129 TAKDLIKSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD-------PRSSRV- 180

Query: 186 ESDYIEIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRD 245
                                    +F NH  + I Y+    D   +VG    P S+   
Sbjct: 181 -------------------------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDY 215

Query: 246 SSDSCDTEGEPLVLSEDADNTVHF---TYSVSFVPSQTL-WATRWDKYLH------VYDP 295
                  + +P  +++     + +   TYSV +     + W+ RW  Y++          
Sbjct: 216 HCPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSS 275

Query: 296 QIQWFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFR 355
              W                         +N     NE     E ++ +    V  +  R
Sbjct: 276 TFHWMALANSVGIVLFVTFIVIVNLIMIFRNP----NEQLESKENEDSSDIFNVANNWLR 331

Query: 356 TPERTML--LSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTV---MFILYALFGS 410
             +   L  L V V  G Q+  M    +  +              T+    F+  A   S
Sbjct: 332 ARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMAS 391

Query: 411 F-GSYTSM----AVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPF 465
           F G++  M    + Y F+N     +  +L    +P  I +  L LN  +    S+ A+PF
Sbjct: 392 FVGTWLKMDQNISAYTFYN----PVFAVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPF 447

Query: 466 GTMLAIVVLWFVFSIPLSVAGSIIS---RKKSQWDRPTNTNQIARQIPFQPWY----LKT 518
           GTM+  V  +FV  I +S+ G  ++    +  + D P  T    R++  +       L  
Sbjct: 448 GTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVV 507

Query: 519 VPASLIAGTFPFGSIVVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXX 576
             A LI+G  PF  I VEL ++Y S+W  K  ++Y++                       
Sbjct: 508 FLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCL 567

Query: 577 XXXCME-----NWKWQWRGFWIGGAGCAFYVFVHAILFTKF--KXXXXXXXXXXXXXSVV 629
               +      +  W+WR F I   GC++Y+ ++++ +  F                S +
Sbjct: 568 VLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFI 626

Query: 630 ISGLCCLITGAVGFLSSLWFVRKIY 654
            + LC L TG++G+L+S WFV+KI+
Sbjct: 627 FNVLCGLATGSLGYLTSSWFVKKIH 651

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  109 bits (272), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 130/579 (22%), Positives = 223/579 (38%), Gaps = 116/579 (20%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y + D + ++VN +                  D  +F Y+Y   Y+    C P N
Sbjct: 56  IRPNVYEENDPVEIIVNKI----------------ESDLTQFPYAY---YELPFTCPPTN 96

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
            +K+P   SL  II GDR + S + L+  +++ C+ LC  +   D  +  ++LI+ G+  
Sbjct: 97  -VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVV 155

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            WL+D  LPAA      + +  +Y +GF LGF+       D DT K              
Sbjct: 156 QWLIDDELPAATTFISTKDHKKYYASGFPLGFM-------DKDTGK-------------- 194

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                       +Y  NH  + I YH    + + +VG+ V P S+        S + +  
Sbjct: 195 ------------TYLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASKNFDHY 242

Query: 256 PLVLSEDADNTVHFTYSVSFVPSQTL-WATRWDKYLHVYD------PQIQWFXXXXXXXX 308
            +   E     + FTYS+ +     + W  RW+ +++  +       Q  W         
Sbjct: 243 EVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVI 302

Query: 309 XXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVG 368
                        +++  D     E       Q  + W + H  +         L+V   
Sbjct: 303 VTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLNH------LNVFTA 351

Query: 369 SGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNG-Q 426
            G Q LF + G  I+               T  +    +     G+YTS  V    +   
Sbjct: 352 MGVQFLFTILGSLIISCSMNKLHNIRNSVLTMALMCFIS-----GAYTSSFVGALLSANH 406

Query: 427 NWKLNM-ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVA 485
           N  + + I     +P      +L LN  +    S+ A+PFGT++ ++ ++F+  IPLS+ 
Sbjct: 407 NTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSIL 466

Query: 486 GSI---ISRKKSQW------------------DRPTNTNQI-------ARQIPFQPWYLK 517
           G +    +R+K                     D+P   N++         ++P      +
Sbjct: 467 GGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLM--LRQ 524

Query: 518 TVPASLIAGTFPFGSIVVELYFIYSSLWFNKI--FYMFG 554
            V  ++I+G  PF  I VEL F+Y SLW  K   +Y++G
Sbjct: 525 PVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYG 563

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 585 KWQWRGFWIGGAGCAFYVFVHAILF--TKFKXXXXXXXXXXXXXSVVISGLCCLITGAVG 642
           +W+W+ F IGG+  A+Y+  +++ +  T  K             S + + LC    GA+G
Sbjct: 631 QWRWKSFQIGGS-VAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALG 689

Query: 643 FLSSLWFVRKIYGSIK 658
           +LS  WFV +I+ + K
Sbjct: 690 YLSCCWFVNRIHTNSK 705

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  105 bits (261), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 142/689 (20%), Positives = 247/689 (35%), Gaps = 132/689 (19%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           ++P  Y  GD++ + VN                 +  D   F Y Y   YD    C P  
Sbjct: 57  LSPNFYEYGDKVDITVNK----------------VESDLTHFSYGY---YDLHFTCPPSQ 97

Query: 81  LIKQ-PESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHN 139
            +K  P +   I++G++ + S ++L   +++ CV LC  +   +  K   +LI+  +   
Sbjct: 98  DMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQ 157

Query: 140 WLV-DGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADKE 198
           WL  D LP A    + +    +Y +GF LG         DP+T +               
Sbjct: 158 WLADDDLPGATTYLNTKDKKKYYSSGFPLG-------QYDPETDE--------------- 195

Query: 199 LKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPLV 258
                      +Y  NH  I I YH   +    +VG  V P S+          +  P  
Sbjct: 196 -----------AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTPYK 244

Query: 259 LSEDADNT--VHFTYSVSFVPS-QTLWATRWDKYLH------VYDPQIQWFXXXXXXXXX 309
           +    ++   + FTY+V +    +  W  RW+ +++          Q  W          
Sbjct: 245 IDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWITFANGIIVT 304

Query: 310 XXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGS 369
                       R          E +     Q    W      +F        L++LV  
Sbjct: 305 SCLLLIVIAILKR---------QETDGSITTQLAAEWSKARVPLF------FQLNLLVSM 349

Query: 370 GAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMAVYKFFNGQNW 428
           G   LF   G  I+               T  +F+  +     GS+TS  +     GQ  
Sbjct: 350 GIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSFIGALLEGQMS 404

Query: 429 K---LNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVA 485
           +   +N I+    +P +  + +L LN  L   +++  +P GT+  +   +F+  +P+S+ 
Sbjct: 405 QHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPISII 464

Query: 486 GSIISRKKSQWDRPTNTNQIARQIPF--------QPWYLKT-----------VPASLIAG 526
           G    +   ++ +  +TN +              +P Y+++           +  +L  G
Sbjct: 465 G---GKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAITLTFG 521

Query: 527 TFPFGSIVVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMEN- 583
             PF  I VEL F Y SLW  K  ++Y++G                            N 
Sbjct: 522 LIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGND 581

Query: 584 -----W------------KWQWRGFWIGGAGCAFYVFVHAILFTKF--KXXXXXXXXXXX 624
                W             W+W+ F +GGA  A+Y+  ++IL+  F  +           
Sbjct: 582 SLNFKWDNVIGRVLEACHSWRWKAFHMGGA-VAWYMEAYSILYLIFVARYRDFISSFLFV 640

Query: 625 XXSVVISGLCCLITGAVGFLSSLWFVRKI 653
             S + + LC    G++ +LSSLWF+ K+
Sbjct: 641 CYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 145/709 (20%), Positives = 261/709 (36%), Gaps = 127/709 (17%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           V P  Y  GD + L+VN +                  D  +  Y+Y   YD    C P  
Sbjct: 51  VNPNLYKIGDHVELIVNKV----------------ESDLTQLPYAY---YDLPFICPPTK 91

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
             K+P   SL  I  GDR + S ++L+   +  C  LC  +  K+      +L++ G+  
Sbjct: 92  E-KKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVT 150

Query: 139 NWLVD-GLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            WL+D  LPAA        ++ +Y  GF +G+VD                          
Sbjct: 151 QWLIDESLPAATTFISSTNHNKYYAAGFPVGYVD-------------------------- 184

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKR---DSSDSCDTEG 254
              +R+ K    ++  NH  + I YH   E+ + +VG  V P S+       ++    + 
Sbjct: 185 ---DRTGK----TFLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDKY 237

Query: 255 EPLVLSEDADNT-VHFTYSVSFVPS-QTLWATRWDKYLHVYD------PQIQWFXXXXXX 306
           E +V  +D + T + FTYSV +    +  W  RW+ +L+  +       Q  W       
Sbjct: 238 EIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSV 297

Query: 307 XXXXXXXXXXXXXXFRALK---------NDLSRYNELNLDDEFQEETGWKLVHGDVFRTP 357
                          +            N  +   + N DD   + +G   V+   + T 
Sbjct: 298 GIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKISGSVFVNAKTWITV 357

Query: 358 ERT---MLLSVLVGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSY 414
            +      L  L   G Q       +++ +              T+  I +    +   Y
Sbjct: 358 GKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFICGAAISGY 417

Query: 415 TSMAV---YKFFNG---------QNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGA 462
               +   Y+   G         + +K +++    L P ++ +    LN  ++   S+ A
Sbjct: 418 IGSRLYIEYQILKGYLRNEVNRTKVYKFSVVCGSSL-PGLLMVISFSLNCIILAHDSTNA 476

Query: 463 IPFGTMLAIVVLWFVFSIPLSVAGSII----------------SRKKSQWDRPTNTNQIA 506
           +PF T + +V ++FV  IPLS+ G ++                S +++   R + ++   
Sbjct: 477 LPFKTEVFLVSIYFVTCIPLSLLGGVLALNCKVDSYNTLKRITSLRRNTISRKSRSDFTK 536

Query: 507 RQIPFQPWYLK------TVPASLIAGTFPFGSIVVELYFIYSSLWFNKI--FYMFGXXXX 558
           +   +Q           T   +L  G F F  I VEL ++Y S+W  K   +Y +G    
Sbjct: 537 KVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLA 596

Query: 559 XXXXXXXXXXXXXXXXXXXXXCMENWK-----WQWRGFWIGGAGCAFYVFVHAI--LFTK 611
                                  +N +     W W+ F + G+ CA+Y+ ++++  +F  
Sbjct: 597 NILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSF-LMGSSCAWYMELYSLYYIFFV 655

Query: 612 FKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660
                          S++ +G+C    G++ +L+S   V +IY   KVD
Sbjct: 656 LNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 114/277 (41%), Gaps = 59/277 (21%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y KGD++ +++N +   T                 RF Y Y   YD    C P +
Sbjct: 40  IKPNVYKKGDKVDVIINKVVSET----------------ARFPYGY---YDLQFVCPPSD 80

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
             K+P   SL  II GDR + S + L   E   C+ LC  +   +  K  + LIR G+  
Sbjct: 81  K-KKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVA 139

Query: 139 NWLV-DGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
           +WL+ D LPAA      ++   FY  GF LG VD V                        
Sbjct: 140 HWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAV------------------------ 175

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPL 257
                    T  +   NH  + + Y     + + ++G  V P S+        + + +P 
Sbjct: 176 ---------TGKTRLYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQPY 226

Query: 258 -VLSEDADNT-VHFTYSVSFVPSQTL-WATRWDKYLH 291
            + +E+++ T + FTYS+ +     + W+ RW+ ++H
Sbjct: 227 EINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 23/139 (16%)

Query: 439 IPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKKSQWDR 498
           +P ++  ++L LN  +    SS AIPFGT++  V  +F+ S PLS+ G   +RK     +
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAK 459

Query: 499 PTNTNQIARQ---------------------IPFQPWYLKTVPASLIAGTFPFGSIVVEL 537
               N I++                       PF       +  +++AG  PF  I VEL
Sbjct: 460 LAPANAISKSPFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICVEL 519

Query: 538 YFIYSSLWFN--KIFYMFG 554
           +++Y S+W      +Y++G
Sbjct: 520 FYVYKSMWLQTTNFYYLYG 538

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 124/543 (22%), Positives = 200/543 (36%), Gaps = 111/543 (20%)

Query: 23  PTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPENLI 82
           P+ Y +G+ + LLV+++                  D+E +      YY+    C P    
Sbjct: 39  PSAYTRGERVQLLVDNIWT----------------DREVW-----GYYETLFTCPPPAEA 77

Query: 83  KQP-ESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHNWL 141
           +    SLG +   +  + S + L++     C PLC  E+  D  + + ++IR+G    W 
Sbjct: 78  RAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWT 137

Query: 142 VDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADKELKE 201
           +DGLPAA    D R +SY Y  GF+LG VD             +E+ ++ +         
Sbjct: 138 LDGLPAATTYPD-RQSSYRYEAGFKLGEVD-------------AETGHVRLH-------- 175

Query: 202 RSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPLVLSE 261
                       NH  + + Y    +  Y +VG    P S+  +      TE E   L+ 
Sbjct: 176 ------------NHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNP 223

Query: 262 DADN--TVHFTYSVSF-VPSQTLWATRWDKY--LHVYDPQIQWFXXXXXXXXXXXXXXXX 316
           DA     V FTY+V +   S   W  RW  Y  L      +Q                  
Sbjct: 224 DAQAMIMVPFTYAVYWRYQSAVKWNERWRLYSDLQQLTGIVQSPGSLVLSRGLFAAMVGT 283

Query: 317 XXXXF-RALKNDLSRYNELNLDDEFQEE-TGWKLVHGDVFRTPERTMLLSVLVGSGAQLF 374
                  A  N         L    QE+  G +  HG              LVG+G Q  
Sbjct: 284 LVLGMASAYLNKRCPATMHTLVTLLQEDMVGSEFFHG--------------LVGAGLQTM 329

Query: 375 LMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSM--AVYKFFNGQNWKLNM 432
            +A    L               T V  +L A   + G+Y +    V+ +   Q+  ++ 
Sbjct: 330 SLAAAYALV----ECENDKAHGVTHVTIVLAATICALGAYLAAFYGVWTWATTQSVVVHR 385

Query: 433 -----ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAG- 486
                ++    IP ++F++   ++  ++    +  IPF T LA++ L+   S  LSV G 
Sbjct: 386 YIKRSVICGSAIPILLFVTAAIVHLIVMLSDRTRGIPFATELAVLALYIPASAILSVFGG 445

Query: 487 ----SIISRK---------KSQW------DRPTNTNQIARQIPFQPWYLKTVPASLIAGT 527
               SI+  +         K +W       + TN N   R    +   + +V  SL+AG 
Sbjct: 446 FTAFSILRTREDRVALLDSKGKWASATSEQKTTNENSTGRSRLTR---IASVLYSLLAGV 502

Query: 528 FPF 530
            PF
Sbjct: 503 PPF 505

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 109/275 (39%), Gaps = 59/275 (21%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y +GD++ L VN +                    E  + +  Y Y    F  P +
Sbjct: 44  IKPNVYKRGDKVDLTVNKV--------------------ESEITNLPYGYYDLRFVCPPS 83

Query: 81  LIKQPE--SLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
             K+P   SL  +I GDR + S + L     + C  LC  +   D  +  ++LIR  +  
Sbjct: 84  ETKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMV 143

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
           +WL+DG LPAA      R+   FY  GF LG VD                      + DK
Sbjct: 144 HWLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD---------------------HETDK 182

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPL 257
                       ++  NH  + I Y     + Y +VG  V P S+            EP 
Sbjct: 183 ------------THLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPY 230

Query: 258 VL-SEDADNT-VHFTYSVSFVPSQTL-WATRWDKY 289
           V+ +E+ + T + FTYSV +     + W+ RW+ +
Sbjct: 231 VINTEETEVTYIPFTYSVYWREESNIDWSHRWNLF 265

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 73/166 (43%), Gaps = 33/166 (19%)

Query: 411 FGSYTSMAVYKFFNGQNWKLNM---ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGT 467
            G+YTS  V         K+N+   +L    +P++  + +   N+ +    SS A+PFGT
Sbjct: 374 LGAYTSSLVGSLL-APGPKMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGT 432

Query: 468 MLAIVVLWFVFSIPLSVAGSIISRKKSQWDRPTN-TNQIARQIPFQPWYL---------- 516
           +LA++  +FV  +PLS  G   +RK      P N  N    ++PF   +L          
Sbjct: 433 LLALLTSYFVICLPLSFLGGFSARKLR--SAPANGLNYEQSKVPFS--FLLSIEYHEYNL 488

Query: 517 ------KTVPA--------SLIAGTFPFGSIVVELYFIYSSLWFNK 548
                 K +PA        +++ G  PF     EL F+Y SLW  K
Sbjct: 489 LPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQK 534

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 106/259 (40%), Gaps = 59/259 (22%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y KGD++ L+VN +                  D  +  Y Y   YD    C P N
Sbjct: 37  LTPNIYRKGDDVELIVNKI----------------ESDLTKLPYGY---YDLPFICPPTN 77

Query: 81  LIKQPE-SLGSIIFGDRIYNSPFELNMLENKTCVPLC-KSEIPKDDAKFINKLIRNGFFH 138
             K    SL  I+ GDR + S + L   ++  C  LC +   P+   K IN L++  +  
Sbjct: 78  QRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIV 136

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            W +D  LPA+        N  +Y  GF LGFVD       PDT                
Sbjct: 137 QWSIDNDLPASTTFISTSENRKYYIPGFSLGFVD-------PDT---------------- 173

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                     E +Y  NH  + I YH   ++++ +VG+ V P S+        S + E  
Sbjct: 174 ----------ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQF 223

Query: 256 PLVLSEDADNT-VHFTYSV 273
            LV ++D + T + FTYSV
Sbjct: 224 ELVANDDEEVTYIPFTYSV 242

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 107/245 (43%), Gaps = 37/245 (15%)

Query: 438 LIPSMIFISMLGLNTFLVFVH-SSGAIPFGTMLAIVVLWFVFSIPLSVAG----SIISRK 492
           L+P++I I  + LN  +V+ H SS A+P  T+L ++ ++F+  IPLS+ G    S I +K
Sbjct: 421 LLPAVIMIITIFLNN-IVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQK 479

Query: 493 KS--------QWDRPTNTNQIARQI------PFQPWYLKTVPASLIAGTFPFGSIVVELY 538
           ++        Q       + +AR I      PF       + AS I G FPF  I VEL 
Sbjct: 480 RTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFS-----GLLAS-IGGLFPFFIIYVELQ 533

Query: 539 FIYSSLWFNKI-------FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCMENWKWQWRGF 591
            +Y  +W  K        F                              +EN  W+WR F
Sbjct: 534 HVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSF 592

Query: 592 WIGGAGCAFYVFVHAI--LFTKFKXXXXXXXXXXXXXSVVISGLCCLITGAVGFLSSLWF 649
            I  + CA+Y+ ++++  +F                 S + +GLC    G++G+L++ WF
Sbjct: 593 QISSS-CAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWF 651

Query: 650 VRKIY 654
           V ++Y
Sbjct: 652 VGRVY 656

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 118/562 (20%), Positives = 189/562 (33%), Gaps = 100/562 (17%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           V P  Y  G+E+ +L+N        Q   + G    G           YYD    C P  
Sbjct: 40  VRPRIYQDGEEVEMLLN--------QVVGKPGELSYG-----------YYDLQFTCTPTK 80

Query: 81  LIKQ-PESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHN 139
             +    SL  +  GDR + S ++L       C  LC  +         + LIR  +   
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQ 140

Query: 140 WLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADKE 198
            L+D  +PA++     R N  +Y  GF LGFV       DP+                  
Sbjct: 141 LLIDEIMPASKTYVSMRDNKRYYVPGFPLGFV-------DPE------------------ 175

Query: 199 LKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSS--DSCDTEGEP 256
                   T+++Y  NHF + I Y+    + Y +VG  V P S+  D     S D E   
Sbjct: 176 --------TDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYENYA 227

Query: 257 LVLSEDADNTVHFTYSVSFVPSQTL-WATRWDKYLHVYDPQIQWFXXXXXXXXXXXXXXX 315
           +  SE     +  TYSV +     + W  RW+ YL   D  +                  
Sbjct: 228 VNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN----KSLCFRGIKVTMV 283

Query: 316 XXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQLFL 375
                  +L   +SR   L     F      + V     R     + L+  V  G Q+  
Sbjct: 284 FIILTLMSLAIIVSRLG-LGTGSMFITAVASEWVR----RGAPCLLFLNTFVSMGIQVIF 338

Query: 376 MAGFTILFAXXXXXXXXXXXXXTTVMFILY--ALFGSFGSYTSMAVYKFFNGQNWKLNMI 433
            A  T+L                 +  + Y   +F S      ++     N    +   +
Sbjct: 339 AAPATLLLICSMGKLHNISNFLVCIAALCYMTGIFMSAFGGILLSGNLLDNKAQIRKYSV 398

Query: 434 LTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKK 493
           L    +P++    ++  N+    +     +PF  +  ++ L+F+ S+PLS+ G   +  K
Sbjct: 399 LYGSALPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYK 458

Query: 494 S------------------------------QWDRPTNTNQIARQIPFQPWYLKTVPASL 523
                                          ++D          QIP   W  K    + 
Sbjct: 459 LKDQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITS 516

Query: 524 IAGTFPFGSIVVELYFIYSSLW 545
           I G  PF +I +++ FI+  LW
Sbjct: 517 IIGIIPFLAIYLQMEFIWKPLW 538

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 104/492 (21%), Positives = 173/492 (35%), Gaps = 83/492 (16%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y  GD++ +  N   P        Q                  YYD    C P +
Sbjct: 60  IKPNLYKVGDKVQITTNKALPDD--PAVSQPALC--------------YYDLPFVCPPSD 103

Query: 81  LIKQP--ESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
             K+P   SL  +  GD +  S + L   +++ C  LC  +  K   +    LI+N +  
Sbjct: 104 -TKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            W VD  LP        + N   Y  GF LG+ D                          
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD-------------------------- 196

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPL 257
                    T  +Y   H    + YH    D + +VG+ V P SI   +      +  PL
Sbjct: 197 -------NQTGQAYLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPL 249

Query: 258 VLS--EDADNTVH--FTYSVSFVPSQTL-WATRWDKY------LHVYDPQIQWFXXXXXX 306
            +   E+ D+  +  F+YSV +     L W  RWD +      L   D    W+      
Sbjct: 250 EVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWY------ 303

Query: 307 XXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVL 366
                         F  L   ++R   L   ++  ++    +      R P    + ++ 
Sbjct: 304 SLINSNSITVGVITFLCLVISMNRMRILY--NKSWKKRQLSITTTTTTRYPN---IFTIC 358

Query: 367 VGSGAQLFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYALFGSFGS-YTSMAVYKFFNG 425
           + SG Q F +   ++L               T ++ + +  FG   S +    + + F  
Sbjct: 359 ITSGIQFFFLLISSVLIT--FQISKFHQIKDTIIVALFFIAFGIIVSVFIGTLIQRTFIL 416

Query: 426 QNWKLNMILT-PIL----IPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSI 480
            N+     LT PIL    +P+ I +SM  +N+ +     + A PF   +     +F+ SI
Sbjct: 417 TNFPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSI 476

Query: 481 PLSVAGSIISRK 492
           PLS+   ++S +
Sbjct: 477 PLSIISGVLSTR 488

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 109/502 (21%), Positives = 189/502 (37%), Gaps = 84/502 (16%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           V P TY  GD + ++VN +      Q  D  G +  G   +       Y+D  + C P N
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEGVSYK-------YHDLPYICPPTN 93

Query: 81  LIKQ-PESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHN 139
             K    SL  +  GD    S + L    +  C  LC  +      +   ++I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 140 WLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADKE 198
           W +D  LPAA       T    Y  GF LG+       +DP+T                 
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGW-------KDPETG---------------- 190

Query: 199 LKERSAKLTELSYFI-NHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTEGEPL 257
                      SY+I NH  + I Y+   ++ + +VG  V P SI  D        G   
Sbjct: 191 -----------SYYINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIP-DLQCPGARRGHGH 238

Query: 258 VLSEDADNT-----VHFTYSVSFVPS-QTLWATRWDKY-------LHVYDPQIQ------ 298
              +D +N      + F+YSV +    +  W TRW  +       L   D  +Q      
Sbjct: 239 YELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISN 298

Query: 299 ---WFXXXXXXXXXXXXXXXXXXXXFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFR 355
              W+                       L  D++ +  + + +  +    W      + +
Sbjct: 299 LLHWYSPYTTVIIFTILLFLV-----SLLVLDINSHKLVFMSNP-KTVIAWATTANKLNK 352

Query: 356 TPERTMLLSVLVGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVMFILYA--LFGSF- 411
           T  + +LL++LV  G Q LF+     ++ +               ++  + A  L GSF 
Sbjct: 353 T-WKNILLNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFV 411

Query: 412 GSYTSMAVYKFFNGQNWKLNM-ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLA 470
           G++  M +++     N+   M I+   ++P +    +   NT   F+  + + PF  +  
Sbjct: 412 GTWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSW 471

Query: 471 IVVLWFVFSIPLSVAGSIISRK 492
           ++ ++F+FSIP+S+ G  ++ K
Sbjct: 472 LIFVYFIFSIPMSLIGGSLAVK 493

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 122/565 (21%), Positives = 206/565 (36%), Gaps = 92/565 (16%)

Query: 21  VAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPEN 80
           + P  Y  GD + LLVN            +   T++ D +       Y Y    F  P  
Sbjct: 47  LQPNVYKVGDNVDLLVN------------KAISTLNADLK------PYIYHDLPFVCPPT 88

Query: 81  LIKQPESL--GSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFH 138
            +++P  L   S+  GD +  S ++L   ++  C  LC  +  K+       +I+  +  
Sbjct: 89  SVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQI 148

Query: 139 NWLVDG-LPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIADADK 197
            W +D  LP +       T    Y  GF LG  D        D  KV             
Sbjct: 149 LWSIDDELPISMPYISTITQRKKYIPGFPLGRFD-------KDKNKV------------- 188

Query: 198 ELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK--RDSSDSCDTEGE 255
                        Y  NH  + I Y+   +D + +VG  V   S+        S + E  
Sbjct: 189 -------------YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEY 235

Query: 256 PLVLSEDADNT--VHFTYSVSFVPSQTL-WATRW---DKYLHVYDPQ-IQWFXXXXXXXX 308
            LV+ E+ D+   + FTYSV +     + W +RW   D  +   DP+ I           
Sbjct: 236 ELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINKSMLSNIMQP 295

Query: 309 XXXXXXXXXXXXFRALKNDLSRYNELN-LDDEFQ-EETGWKLVHGDVFRTPERTMLLSVL 366
                       F  +   +    E N    E Q     W   +    ++     +L+++
Sbjct: 296 TRTGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQLASKCWIESNNINLKSSFSASILTLV 355

Query: 367 VGSGAQ-LFLMAGFTILFAXXXXXXXXXXXXXTTVM--FILYALFGSF-GSYTSMAVYKF 422
           +  G Q +F + G  IL                 +   FI   L  SF G++  M +   
Sbjct: 356 ISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGTWLRMNI--- 412

Query: 423 FNGQNWKLN---MILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFS 479
            N ++   N    IL   L+P ++ I +  +++ +  + SS   PF T+  ++  +++  
Sbjct: 413 LNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIIC 472

Query: 480 IPLSVAGSIISRKKSQ----------WDRPTNTNQIARQIPFQ-------PWYLKTVPAS 522
           +P S+ G  +++K  +           D   N N   ++   Q          L T+  S
Sbjct: 473 VPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYS 532

Query: 523 LIAGTFPFGSIVVELYFIYSSLWFN 547
           LI    PF  I  ELY+I+++ W N
Sbjct: 533 LITAIVPFFIIKSELYWIFTNKWLN 557

>CAGL0K01155g Chr11 complement(111197..111808) [612 bp, 203 aa] {ON}
           some similarities with uniprot|P53249 Saccharomyces
           cerevisiae YGR079w
          Length = 203

 Score = 34.7 bits (78), Expect = 0.40,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 16/114 (14%)

Query: 102 FELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFY 161
           F+L ++  +   PLCK+++P         L+         VD LP   E H   T  + Y
Sbjct: 5   FKLGVITAQDISPLCKNKLPHPTVMANESLVSQ-------VDELP--EEFHLDYTPHHEY 55

Query: 162 GNGFELGFVDVVDTIED-------PDTKKVSESDYIEIADADKELKERSAKLTE 208
               +LG + V  +I D          +    S    +AD D EL++ S  L+E
Sbjct: 56  NEYVDLGDLPVDSSISDFWNEVKSTHAEAPVTSSVTSVADTDDELRQLSQSLSE 109

>AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR052W
           (FMP48)
          Length = 479

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 17/125 (13%)

Query: 42  STYFQHADQEGHTMSGDKERFLYSYDYYYDKFHFCRPENLIKQPESLGSIIFGDRIYNSP 101
           S  F+ A  +    S + +RF+     + + ++       +  P SLGS++         
Sbjct: 206 SCPFESASSDAPKRSANFQRFIRDPHRFVESYYLDAMFAELAPPASLGSLV--------- 256

Query: 102 FELNMLENKTCVPLCKSEIPKDDAKFINKLIRNGFFHNWLVDGLPAAREMHD--GRTNSY 159
                L N  C P    E+PKD   F+  +      H  LV+  PAAR+MH    + N+ 
Sbjct: 257 ----GLCNADCAPSYWLELPKDRILFLCAIANLVITH--LVNVDPAARDMHAFWEKVNAL 310

Query: 160 FYGNG 164
           F  NG
Sbjct: 311 FLENG 315

>NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602)
           [1488 bp, 495 aa] {ON} Anc_1.303 YBR283C
          Length = 495

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 487 SIISRKKSQWDRPTNTNQIARQIPFQPWYLKTVPASLIAGTF--PFGSIVVELYFIYSSL 544
           SII +    ++   N N I   +P  P  L T P SLI G F  P   IV  L+ + +S+
Sbjct: 325 SIICKILGHYE---NVNNIL-AVPTFPLSLLTPPRSLIGGLFSQPLTFIVFTLFIVSTSV 380

Query: 545 WFNK 548
           WF K
Sbjct: 381 WFAK 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,496,741
Number of extensions: 2790889
Number of successful extensions: 9433
Number of sequences better than 10.0: 57
Number of HSP's gapped: 9433
Number of HSP's successfully gapped: 94
Length of query: 660
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 544
Effective length of database: 40,180,143
Effective search space: 21857997792
Effective search space used: 21857997792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)