Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17226g8.255ON71971937720.0
Kwal_56.235838.255ON70075319310.0
KLTH0G13860g8.255ON70875218680.0
Suva_2.2688.255ON69574318140.0
YDR108W (TRS85)8.255ON69874418100.0
TDEL0F038208.255ON68773517720.0
Smik_4.3548.255ON69874517660.0
Skud_4.3698.255ON69874417580.0
NCAS0B038808.255ON70674017420.0
ZYRO0C01826g8.255ON69976317040.0
Kpol_392.118.255ON67574716990.0
NDAI0J014108.255ON71675216730.0
CAGL0B01705g8.255ON67274316560.0
KAFR0B055708.255ON66973115370.0
TPHA0B032608.255ON71462714340.0
KNAG0H032708.255ON64874713521e-178
AGR096C8.255ON62371113241e-174
Ecym_43168.255ON62371713161e-173
TBLA0E043808.255ON88967413171e-170
KLLA0F18953g8.255ON64772112311e-160
KAFR0A080901.119ON96462790.81
KAFR0D002201.13ON84167724.9
Skud_13.1315.554ON66444725.5
AFR344C3.83ON293135715.6
NDAI0E009908.713ON50361716.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17226g
         (719 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...  1457   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   748   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   724   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   703   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   701   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   687   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   684   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   681   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   675   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   660   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   659   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   649   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   642   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   596   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   556   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   525   e-178
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   514   e-174
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   511   e-173
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   511   e-170
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   478   e-160
KAFR0A08090 Chr1 complement(1623348..1626242) [2895 bp, 964 aa] ...    35   0.81 
KAFR0D00220 Chr4 (25909..28434) [2526 bp, 841 aa] {ON} Anc_1.13 ...    32   4.9  
Skud_13.131 Chr13 (217482..219476) [1995 bp, 664 aa] {ON} YML020...    32   5.5  
AFR344C Chr6 complement(1063015..1063896) [882 bp, 293 aa] {ON} ...    32   5.6  
NDAI0E00990 Chr5 complement(200132..201643) [1512 bp, 503 aa] {O...    32   6.4  

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score = 1457 bits (3772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/719 (97%), Positives = 704/719 (97%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           MTLSYENYMNLLYHIDHSGESVTVNSEVAKKI               LLDSHLQEAYGLH
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 61  SMYMLLRFFGDCVTDRDQENETETNFKGRPRSNSLFQRESSTFVRFTRPLIDLVDVRVSD 120
           SMYMLLRFFGDCVTDRDQENETETNFKGRPRSNSLFQRESSTFVRFTRPLIDLVDVRVSD
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETNFKGRPRSNSLFQRESSTFVRFTRPLIDLVDVRVSD 120

Query: 121 HGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFN 180
           HGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFN
Sbjct: 121 HGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFN 180

Query: 181 HPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYNDS 240
           HPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYNDS
Sbjct: 181 HPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYNDS 240

Query: 241 SHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLD 300
           SHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLD
Sbjct: 241 SHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLD 300

Query: 301 LEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQ 360
           LEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQ
Sbjct: 301 LEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQ 360

Query: 361 PRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWSFM 420
           PRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWSFM
Sbjct: 361 PRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWSFM 420

Query: 421 LSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKS 480
           LSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKS
Sbjct: 421 LSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKS 480

Query: 481 LQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYL 540
           LQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYL
Sbjct: 481 LQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYL 540

Query: 541 ETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQ 600
           ETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQ
Sbjct: 541 ETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQ 600

Query: 601 HHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRR 660
           HHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRR
Sbjct: 601 HHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRR 660

Query: 661 KAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGEIEANMHA 719
           KAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGEIEANMHA
Sbjct: 661 KAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGEIEANMHA 719

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/753 (54%), Positives = 504/753 (66%), Gaps = 100/753 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M LSYE YMNL+ H+D + E V   SE+++KI                LD H+QE+YGL 
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVP--SEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLD 58

Query: 61  SMYMLLRFFGDCVTDRDQ-ENETETNF-----KGRPRSNSLFQRESSTFVRFTRPLIDLV 114
           S+YMLLR+FGDC++DRDQ ++E E+       + R RS SLFQR++S F+RFTRPL D++
Sbjct: 59  SLYMLLRYFGDCISDRDQADSEQESGVEPNKSRARSRSGSLFQRQASQFLRFTRPLSDII 118

Query: 115 DVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLS 174
             R +   +LFDYHSLE+FL KYL LVD + S +TPH LL+HSIYHKFFT AISSTA+LS
Sbjct: 119 GTRET-RDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQHSIYHKFFTTAISSTAHLS 177

Query: 175 PYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFL 234
           PYE FNHPV SLLALDIS+ + YE+ARDLL+ FKNM++ T     FP+FIN+NDILPVFL
Sbjct: 178 PYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKT---PHFPSFINVNDILPVFL 234

Query: 235 LCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEE-PRRILHPPIMSSLE 293
           LCY + S EQFE CQSLAKM+KKQLFVES+LLP W  S ++ A++ P R+LH PIMSSLE
Sbjct: 235 LCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCW--SVNFTAKDTPTRVLHQPIMSSLE 292

Query: 294 EMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISF 353
           E ++ +      KD           S+F+LPL  +E IYDRL  L+ ELMIPFMKRKISF
Sbjct: 293 ETMFSM-----LKD-----------SAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISF 336

Query: 354 WEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRK 413
           WEE+ILQPR+SIF N+KF R+ +SK AP TP+   N  +  + Q   +F A+SNE LLRK
Sbjct: 337 WEESILQPRRSIFPNSKFFRKLISK-AP-TPSTN-NDSATHSEQGLAYFAATSNELLLRK 393

Query: 414 LADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDI 473
           LADWSFMLSD++TAY+TY+ LSKD E H EYLAPCLEWCA+SVLMGAQSIVTVKMIKNDI
Sbjct: 394 LADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDI 453

Query: 474 DPLISKSLQCYEKCASK--------------------------LTSPHVAEADSPVD--- 504
           DPLI+++L+ YE CASK                          +++ H        D   
Sbjct: 454 DPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEI 513

Query: 505 ----SKPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEK 560
               S+ AQSYETRCMLL+AELFLSLSDTWTATPYAIKYLETIL  C +G  S++++WE+
Sbjct: 514 SSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWER 573

Query: 561 LAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQ 620
           LAYCY LRVDPRV                   KS   A    SE   S +  +   + E 
Sbjct: 574 LAYCYALRVDPRV-------------------KSRLTA----SEIQSSDQNEKLDEESEG 610

Query: 621 SDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWK 680
           SD DS DE+           V  +K+    IA  GLTR+RKA  FRLIA  KW E KQW+
Sbjct: 611 SDNDSGDESQ----------VCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWR 660

Query: 681 QASWLLRDVDTVYSGLVFSYRKGLILERLVGEI 713
           QA W  +D++ +YS LVF+ R+ LIL++L   I
Sbjct: 661 QACWSFQDLEVMYSHLVFANREDLILKKLEKRI 693

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/752 (53%), Positives = 493/752 (65%), Gaps = 100/752 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M LS+  YMNL +H+D + E V   +E+++KI                LD H+QE+YG+ 
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVP--TEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVD 58

Query: 61  SMYMLLRFFGDCVTDRDQ-----ENETETN-FKGRPRSNSLFQRESSTFVRFTRPLIDLV 114
           S+YMLLR+FGDCV+DRDQ     E  TE+   + R RSNSLFQR++S ++RFTRPL DL+
Sbjct: 59  SLYMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLI 118

Query: 115 DVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLS 174
           DVR S   +LFDYHSLE+FL+KYL LV+   +++TPH LL+HSIYHKFFT AISSTA+LS
Sbjct: 119 DVRES-RDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLS 177

Query: 175 PYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFL 234
           PYESFNHPV SLLALDIS+   YE ARDLLI FKNM++ T     FP FIN+NDILPVFL
Sbjct: 178 PYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTT---PHFPAFINVNDILPVFL 234

Query: 235 LCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEE 294
           LCY + S EQFE CQSL+K +KKQLFVES+LLP W  + +  A  P RILH PIMSSLEE
Sbjct: 235 LCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGA-SPSRILHQPIMSSLEE 293

Query: 295 MLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFW 354
            +Y +  E                S+  LPL+L+  IYDRL  LI ELMIPFMKRKISFW
Sbjct: 294 TMYSMMKE----------------STITLPLSLINYIYDRLTNLIDELMIPFMKRKISFW 337

Query: 355 EETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKL 414
           +E+ILQPRKSIF N+KF R+ +SK+ PA P  P +  +  + Q   +F A+SNEF+LRKL
Sbjct: 338 DESILQPRKSIFPNSKFFRKLISKT-PAPP--PASDSATHSQQGVAYFAATSNEFILRKL 394

Query: 415 ADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDID 474
           ADWSFMLSD++ AY+TY+ LSKD E   EYLA CLEWCA+SVLMGAQSIVTVKMIKNDID
Sbjct: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454

Query: 475 PLISKSLQCYEKCASKLTSPHV----------AEADSPVDSKPA---------------- 508
           PLI+++L+ YE  A K    +           AE DS   + P+                
Sbjct: 455 PLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVS 514

Query: 509 -------QSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKL 561
                  QSYETRCMLL+AELFLSLSDTWTATPYAIKYLETIL  C LG  S+++LWE+L
Sbjct: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574

Query: 562 AYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQS 621
           AYCY LRVDPRV                       + P    +S     +N+   +E + 
Sbjct: 575 AYCYALRVDPRVKG---------------------KLPSLDGQSG----QNEKRGEESEG 609

Query: 622 DTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQ 681
             +S DE    ++ +H       K+    +A LGL RRRK+  FRLIA  KW E KQW+Q
Sbjct: 610 SDESDDE---TQKYDH-------KISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQ 659

Query: 682 ASWLLRDVDTVYSGLVFSYRKGLILERLVGEI 713
           A W L+D++ VYS L F+ R  LILE+L  +I
Sbjct: 660 AYWGLKDIEVVYSELDFANRDDLILEKLRKKI 691

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/743 (51%), Positives = 482/743 (64%), Gaps = 99/743 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL+H+DHS E  TV  E+AK+I               L D H+QEAY + 
Sbjct: 1   MVFSYEHYMNLLFHLDHSRE--TVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVD 58

Query: 61  SMYMLLRFFGDCVTDRDQENE-------------TETNFKG-------------RPRSNS 94
           S+YMLLRFFG CV+DRDQ NE              E++ K              R RSNS
Sbjct: 59  SLYMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNS 118

Query: 95  LFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHR 152
           LFQR+S  S +VRFTRPL DL++ R ++  MLF+YHSLE+FLD YL+LV        PH 
Sbjct: 119 LFQRDSTQSQYVRFTRPLGDLIETRDTN-DMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177

Query: 153 LLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNS 212
           LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN+N 
Sbjct: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237

Query: 213 ATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDS 272
            T+S   FP F+N N++LPVFLLCYND S E+FE CQ+LAK LKKQLFVESILLPLW+DS
Sbjct: 238 NTES---FPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDS 294

Query: 273 EDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIY 332
              D E     LH P+MSSLEE+L+FL   AP +  +S              L L+ +IY
Sbjct: 295 F-VDVENSNIQLHQPVMSSLEEILFFL--RAPTQTKLS--------------LPLINSIY 337

Query: 333 DRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKS 392
           D L+ L+ +LMIPFMKRKISFWEETILQPRKS+F  AKF ++F++K AP       NS +
Sbjct: 338 DMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAKFFKKFMNK-APVNGNHQHNSLT 396

Query: 393 DGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWC 452
               Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C+EWC
Sbjct: 397 KDN-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWC 455

Query: 453 AVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYE 512
           AVS+LMGAQSIVTVKMIKNDI+PLI ++L  YE C S++   +  E  S    +P +SYE
Sbjct: 456 AVSLLMGAQSIVTVKMIKNDINPLIERALATYENC-SRMQRRNSKELTSSGVLEPVRSYE 514

Query: 513 TRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPR 572
           TRCM+L++ELFLSLSDTWT+TPYAI+YLETIL  C LGP SQ+++WE+L+ CY LRVDPR
Sbjct: 515 TRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPR 574

Query: 573 VSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSN 632
           V H       +   ++ V +  + R    +   HF+ E                      
Sbjct: 575 VKH------KVGGMKKSVKNTEDLRNDDEYDTDHFTEE---------------------- 606

Query: 633 REKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTV 692
                            DI   GLTRRRKAAFFRL+AA KW EQKQW+Q SW L+D++  
Sbjct: 607 -----------------DILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENT 649

Query: 693 YSGLVFSYRKGLILERLVGEIEA 715
           YS + F +  GLIL  L  ++ +
Sbjct: 650 YSDIDFLHGNGLILSNLKNQLNS 672

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/744 (50%), Positives = 486/744 (65%), Gaps = 102/744 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL+H+D+S E  TV  E+AK+I               L D H+QE Y + 
Sbjct: 1   MVFSYEHYMNLLFHLDNSKE--TVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVD 58

Query: 61  SMYMLLRFFGDCVTDRDQENETETN----------------------------FKG-RPR 91
           S+YMLLRFFG CV+DRDQ NE +                               KG R R
Sbjct: 59  SLYMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSR 118

Query: 92  SNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT 149
           SNSLFQR+S  S ++RFTRPL DL++ R ++  MLF+YHSLE+FLD YL+LV        
Sbjct: 119 SNSLFQRDSTQSQYIRFTRPLGDLIETRDAN-DMLFNYHSLEVFLDNYLKLVAANTDEMV 177

Query: 150 PHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKN 209
           PH LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN
Sbjct: 178 PHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 210 MNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW 269
           +N  T++   FP F+N N++LPVFLLCYND S E+FE CQ+LAK LKKQLFVESILL LW
Sbjct: 238 LNHNTEN---FPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALW 294

Query: 270 RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVE 329
           +DS  YD E     LH P+MSSLEE+L+FL  +AP +  +S              LAL+ 
Sbjct: 295 KDSFIYD-ENSVIQLHQPVMSSLEEILFFL--QAPTQTTLS--------------LALIN 337

Query: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPIN 389
           +IYD L+ L+ +LMIPFMKRK+SFWEETILQPRKS+F  AKF ++F++K+ P       N
Sbjct: 338 SIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN-PVNGNHQHN 396

Query: 390 SKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCL 449
           S +  + Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C+
Sbjct: 397 SLTRDS-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCI 455

Query: 450 EWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQ 509
           EWCAVS+LMGAQSIVTVKMIKNDI+PLI ++L  YE C S++      E++S   ++P +
Sbjct: 456 EWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENC-SRIQRGKGKESNSLDVTEPVR 514

Query: 510 SYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRV 569
           SYETRCM+L++ELFLSLS+TWT+TPYAI+YLETIL  C LGP SQ+++WE+L+ CY LRV
Sbjct: 515 SYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRV 574

Query: 570 DPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEA 629
           DPR+ H     +    + E++      R    +S  HF+ E                   
Sbjct: 575 DPRIKHRVGAMKKDAKDTEDL------RGEHKYSTDHFTDE------------------- 609

Query: 630 LSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDV 689
                               DI   GLTRRRKAAFFRLIAA KW EQKQW+Q SW L+D+
Sbjct: 610 --------------------DILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDI 649

Query: 690 DTVYSGLVFSYRKGLILERLVGEI 713
           ++ YS + F +  GLIL +L  ++
Sbjct: 650 ESTYSEIKFLHGNGLILSKLKNQL 673

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/735 (50%), Positives = 472/735 (64%), Gaps = 105/735 (14%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           + LSYENYMNLL H+DH  + V   +++AK+I                LD H+QE + L 
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVP--ADIAKRIVSNAISPVICVTSTPELDRHIQETHHLD 59

Query: 61  SMYMLLRFFGDCVTDRDQENETET---------------------NFKGRPRSNSLFQRE 99
           S+YMLLRFFGDCV DRDQ +E  +                     +   R RSNSLFQR+
Sbjct: 60  SLYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRD 119

Query: 100 S--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHS 157
           +  S ++RFTRPL DLV+     + MLFDYH+LE FL+  L L++   +  TPH+LLK S
Sbjct: 120 ATQSQYIRFTRPLRDLVE-SADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178

Query: 158 IYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSA 217
           +YH+FF+ AISSTAYLSPYE+FNHPV+SL+ALDI  G  YE ARDLL +FKN+N  TK+ 
Sbjct: 179 LYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKN- 237

Query: 218 ASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDA 277
             FP F+N ND+LPVFLLCYN  S EQ+E CQSL K LKKQLFVE ILLPLW+D  +Y  
Sbjct: 238 --FPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKD--NYKT 293

Query: 278 EEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNL 337
              + ILH PIM+SL+E+LYFL    P              S  EL L L+ +IYD L +
Sbjct: 294 A-TQVILHQPIMTSLDEVLYFL--REP--------------SRIELSLELINSIYDVLEI 336

Query: 338 LITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPAT---PAAPINSKSDG 394
           LI  LMIPFM+RKISFWEETILQPR+S+F  +KFL+RF+SK+   T     A I   ++G
Sbjct: 337 LINGLMIPFMQRKISFWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANG 396

Query: 395 AVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAV 454
                 +F +SS EFL+RKLADWS MLSDY+TAY+TYD+LS DLEH+ +YLA CLEWC+V
Sbjct: 397 ----KEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSV 452

Query: 455 SVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETR 514
           SVLMGAQ+IVT KM+K DIDPLI ++++ YE CA  L    ++ +       P +SYETR
Sbjct: 453 SVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCA--LYDTQLSGSKKSNSMAPVRSYETR 510

Query: 515 CMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVS 574
           CM L++ELFLSLSDTWT+TPYA++ LETIL  C LGP SQ+++WE+L+ CY+ R+D R+ 
Sbjct: 511 CMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIR 570

Query: 575 HIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNRE 634
           H                 K N+ A                 N+E+  + D       + E
Sbjct: 571 H-----------------KVNDGA---------------MSNEEKVENED-------DSE 591

Query: 635 KEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYS 694
           KEH          + DI   GLTR RKAAFF+LIAANKW EQKQW+QASW L+D +  Y+
Sbjct: 592 KEHT---------HADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYA 642

Query: 695 GLVFSYRKGLILERL 709
           G+ F  RK L L +L
Sbjct: 643 GIEFVNRKDLALAKL 657

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/745 (50%), Positives = 484/745 (64%), Gaps = 104/745 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL+H+D+S E  TV  E+AK+I               L D H+QEAY + 
Sbjct: 1   MVFSYEHYMNLLFHLDNSKE--TVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVD 58

Query: 61  SMYMLLRFFGDCVTDRDQENET----------ETNF------------------KG-RPR 91
           S+YMLLRFFG CV+DRDQ NE           +TN                   KG R R
Sbjct: 59  SLYMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSR 118

Query: 92  SNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT 149
           SNSLFQR+S  S ++RFTRPL DL++ R ++  MLF+YHSLE+FLD YL+LV        
Sbjct: 119 SNSLFQRDSTQSQYIRFTRPLDDLIETRDTN-DMLFNYHSLEVFLDNYLKLVADNTDEMV 177

Query: 150 PHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKN 209
           PH LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN
Sbjct: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 210 MNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW 269
           +N  T++   FP F+N N++LPVFLLCYND S E+FE CQ+LAK LKKQLFVES+LL LW
Sbjct: 238 LNHNTEN---FPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLW 294

Query: 270 RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVE 329
           +DS   +A      LH P+MSSLEE+L+FL  +AP + ++S              L L+ 
Sbjct: 295 KDSF-IEANNSAIQLHQPVMSSLEEILFFL--QAPTQTSLS--------------LPLIN 337

Query: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPIN 389
           +IYD L+ L+ +LMIPFMKRK+SFWEETILQPRKS+F  AKF ++F++K+ P+      N
Sbjct: 338 SIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN-PSNGNHHHN 396

Query: 390 S-KSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPC 448
           S  SD   Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C
Sbjct: 397 SLTSDN--QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC 454

Query: 449 LEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPA 508
           +EWCAVS+LMGAQ IVTVKMIKNDI+PLI K+L  YE C SK+      ++ S    +P 
Sbjct: 455 IEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENC-SKIQRSKSEKSSSSNTVEPV 513

Query: 509 QSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELR 568
           +SYETRCM+L++ELFLSLSD WT+TPYAI+YLETIL  C LGP  Q+++WE+L+ CY LR
Sbjct: 514 RSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERLSDCYSLR 573

Query: 569 VDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDE 628
           VDPR+ H     +    + E++      R    +S  HF+ +                  
Sbjct: 574 VDPRIKHRVGAMKKGIRDTEDL------RGGDGNSTDHFTDD------------------ 609

Query: 629 ALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRD 688
                                DI   GLTR+RKAAFFRLIAA KW EQKQW+Q SW L+D
Sbjct: 610 ---------------------DILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKD 648

Query: 689 VDTVYSGLVFSYRKGLILERLVGEI 713
           ++++YS + F    GLIL +L  ++
Sbjct: 649 IESIYSDIKFLNGDGLILSKLHNQL 673

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/744 (49%), Positives = 479/744 (64%), Gaps = 102/744 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL+H+D+S E   V  E+AK+I               L D H+QE Y + 
Sbjct: 1   MVFSYEHYMNLLFHLDNSEE--IVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVD 58

Query: 61  SMYMLLRFFGDCVTDRDQENETETN----------------------------FKG-RPR 91
           S+YMLLRFFG CV+DRDQ NE +                               KG R R
Sbjct: 59  SLYMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSR 118

Query: 92  SNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT 149
           SNSLFQR+S  S ++RFTRPL DL++ R ++  MLF+YHSLE++LD YL+LV    +   
Sbjct: 119 SNSLFQRDSTQSQYIRFTRPLGDLIETRDTN-DMLFNYHSLEVYLDNYLKLVTENTNETA 177

Query: 150 PHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKN 209
           PH LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN
Sbjct: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 210 MNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW 269
           +N  T+   +FP F+N N++LPVFL+CYND S E+FE CQ+LAK LKKQLFVESI LPLW
Sbjct: 238 LNHNTE---NFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLW 294

Query: 270 RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVE 329
           ++S   D E     LH P+MSSLEE+L+F  L+AP +  +S              L L+ 
Sbjct: 295 KESF-IDDENSSIKLHQPVMSSLEEILFF--LQAPTQTTLS--------------LPLIN 337

Query: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPIN 389
           +IYD L+ L+ +LMIPFMKRK+SFWEETILQPRKS+F  AKF ++F++K+ PA  +   N
Sbjct: 338 SIYDILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN-PANGSHQHN 396

Query: 390 SKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCL 449
           S +    Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C+
Sbjct: 397 SLTRDR-QGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCI 455

Query: 450 EWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQ 509
           EWCAVS+LMGAQSIVTVKMIKNDI+PLI ++L  YEKC S++      E  S   ++P +
Sbjct: 456 EWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKC-SQIQRHKGKELSSSSVTEPVR 514

Query: 510 SYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRV 569
           SYETRCM+L++ELFLSLSDTWT+TPYAI+YLETIL  C LGP SQ+++WE+L+ CY LRV
Sbjct: 515 SYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRV 574

Query: 570 DPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEA 629
           DPR+ H     +    E E++      R    H   HF  E                   
Sbjct: 575 DPRIKHRVGVMKKSFKETEDL------RNGDEHYTDHFIEE------------------- 609

Query: 630 LSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDV 689
                               DI   GLTRRRKAAFFRLIAA KW EQK W+Q SW L+D+
Sbjct: 610 --------------------DILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDI 649

Query: 690 DTVYSGLVFSYRKGLILERLVGEI 713
           ++ YS + F +    IL +L  ++
Sbjct: 650 ESTYSEIKFLHCNDSILSKLKSQL 673

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/740 (48%), Positives = 474/740 (64%), Gaps = 84/740 (11%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL+H+D+  E  TV SE+AK+I                LD H+ E Y + 
Sbjct: 1   MNFSYEHYMNLLFHLDYGKE--TVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNID 58

Query: 61  SMYMLLRFFGDCVTDRDQENETETNFK-----------------------GRPRSNSLFQ 97
           S+YMLLRFF  CV+DRDQ NE E + K                       GR RSNSLFQ
Sbjct: 59  SLYMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQ 118

Query: 98  RES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLK 155
           R+S  S ++RFT+PL D++  + ++  MLFDYHSLE++L  YL L+      NTP+ LLK
Sbjct: 119 RDSTQSQYIRFTKPLGDVIATKNAN-DMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLK 177

Query: 156 HSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATK 215
            SIYH FF+ AISST  LSPYE FNHPV+SL+A+DIS G  Y++ RDLL+ FKN+NS+T 
Sbjct: 178 KSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH 237

Query: 216 SAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDY 275
           +   FP F+N ND+LPV LLCY+D   EQFE CQ+L K +KKQLFVE I LPLW+DS   
Sbjct: 238 N---FPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPS 294

Query: 276 DAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRL 335
           D   P+  LH P+MSSLEEM+YFL                N      LP  L+++IY+ L
Sbjct: 295 D---PQVHLHQPVMSSLEEMIYFL----------------NQPKEVTLPYELIQSIYNIL 335

Query: 336 NLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGA 395
           + L+  LMIPFMKRKI+FW+ETILQPRKS+F  AKFL++F++K+A       +   + G 
Sbjct: 336 DSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFLKKFMTKTALTHQENLLTKDAQG- 394

Query: 396 VQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVS 455
              + +F ++S+EFL+RKLADWS MLSD++TAYATY++L+ DLE   +Y A CLEWCAVS
Sbjct: 395 ---NEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVS 451

Query: 456 VLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRC 515
           +LMGAQ+IVTVKM+KNDI+PLI K+L  YE CA+ L        D  +   P +SYETRC
Sbjct: 452 LLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTDELI-VVPVRSYETRC 510

Query: 516 MLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSH 575
           M+L++ELFLSLSDTWT+TPYAI YLETIL  C LG  SQ+++WE+L+ CYELRVDPR+ H
Sbjct: 511 MILASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKH 570

Query: 576 IHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREK 635
             A             + +N  +P+  SES      +  G+    S    +D  +SN   
Sbjct: 571 KAAG------------TIANTSSPKKSSES------DMQGHVMTPSPLTKED--VSNDAN 610

Query: 636 EHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSG 695
              D         +DI   G TR+RKAAFFRL+AA KW EQK+W+Q SW L+ +D  YS 
Sbjct: 611 NDTD---------QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSK 661

Query: 696 LVFSYRKGLILERLVGEIEA 715
           +  + R  LIL+++  +++ 
Sbjct: 662 IGLADRDDLILKKIQNKLKT 681

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/763 (48%), Positives = 465/763 (60%), Gaps = 142/763 (18%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M LSYENYMNLL+H+DH  E  TV  ++A++I                LD H+++ Y L 
Sbjct: 1   MKLSYENYMNLLFHLDHGQE--TVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLD 58

Query: 61  SMYMLLRFFGDCVTDRDQENE-----------------------TETNFKG--------- 88
           S+YM LRFFGDCV+DRDQ NE                        E + K          
Sbjct: 59  SLYMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSS 118

Query: 89  ----------------RPRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSL 130
                           R RSNSLFQR+   S +VRFTRP+ DL++   S+  MLFDYHSL
Sbjct: 119 DTKNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSN-DMLFDYHSL 177

Query: 131 ELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALD 190
           E+FL+  LRLV+     NTP  LLK S+YHKFF+ AISST YLSPYE+FNHPV+SL+A+D
Sbjct: 178 EVFLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAID 237

Query: 191 ISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQS 250
           IS G  YE ARDLLI+FKN+N    +  +FP F++  DILPVFLLCYND S ++  ACQ 
Sbjct: 238 ISAGQGYEEARDLLIKFKNLN---HTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQ 294

Query: 251 LAKMLKKQLFVESILLPLWRDS-EDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNI 309
           LA  LKKQLFVES+LLPLW+ S  D+   E    LH PIMSSLEEMLYFL    P +   
Sbjct: 295 LANQLKKQLFVESLLLPLWKRSYSDHGEVE----LHQPIMSSLEEMLYFLQSPTPTR--- 347

Query: 310 SYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNA 369
                        LPL L+   Y+ L  L+ +LM+PFMKRKISFWEETILQPRKS+F  A
Sbjct: 348 -------------LPLQLINVTYNILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGA 394

Query: 370 KFLRRFVSKSAPATPA-APINSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAY 428
            F ++ +SK++  +    PI+   D     + +F ASS EFL+RKLADWS MLSD++TAY
Sbjct: 395 NFFKKLMSKNSNGSNNHQPISLGKDK--NGNEYFVASSTEFLMRKLADWSMMLSDFKTAY 452

Query: 429 ATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCA 488
           +TY++L  DLE+  +YLA C EWCAVSVLMGAQ+IVTVKMIKNDIDPLI ++L+ YE CA
Sbjct: 453 STYESLVHDLENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCA 512

Query: 489 SKLTSPHVAEADSPVDS--KPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQN 546
                   A+ DS  +    P +SYETRCM L++ELFLSLSDTWT+TPYA+  LETIL  
Sbjct: 513 --------ADEDSTGEELYVPVRSYETRCMFLASELFLSLSDTWTSTPYALNSLETILTE 564

Query: 547 CPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESH 606
           C LGP S++++WE+L+ CY  R+DPR+ H                               
Sbjct: 565 CRLGPCSEIMIWERLSDCYYQRIDPRIRH------------------------------- 593

Query: 607 FSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFR 666
                 +T  Q  ++ TD                + P++   ++I   GLTR+RKAAFFR
Sbjct: 594 ------KTSAQGAKAMTDE---------------LAPDEESNEEIVTRGLTRKRKAAFFR 632

Query: 667 LIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERL 709
           LIAANKW EQKQWKQA W L++++  Y+GL F  R+ LIL RL
Sbjct: 633 LIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARL 675

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/747 (47%), Positives = 468/747 (62%), Gaps = 119/747 (15%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           +  SYENYMNL+YH+D   E V    +++K+I                LD H+Q++Y + 
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVP--QDISKRIVSNAIAPVITVMSTSELDQHVQDSYNID 61

Query: 61  SMYMLLRFFGDCVTDRDQENE-------TETNFKG------------------------R 89
           S+Y+L+R+FG C++DRDQ NE         T  +G                        R
Sbjct: 62  SLYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSR 121

Query: 90  PRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSA 147
            RSNSLFQR+S  S ++RFT+P+ DL++ R S H MLFDYHSLE++L+K L L+D   + 
Sbjct: 122 SRSNSLFQRDSTQSHYIRFTKPIEDLINSRDS-HDMLFDYHSLEVYLEKCLSLIDKNTND 180

Query: 148 NTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRF 207
            T H+ LK S++H+FF++AISST YLSPYESFNHP++SL+ALDIS+G  YE+ARDLLI+F
Sbjct: 181 ETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKF 240

Query: 208 KNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLP 267
           KN N+A +    FP F++ NDIL VFLLCY+  S EQ E CQ + K LKKQLF ES++LP
Sbjct: 241 KNQNNAVEE---FPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLP 297

Query: 268 LWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLAL 327
           LW  S   D +     LH P MSSL+EMLYF   E P              S  ELPL L
Sbjct: 298 LWNKSHSEDVQVE---LHQPAMSSLDEMLYFF--ERP--------------SVHELPLNL 338

Query: 328 VETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAP 387
           + TIYD +  L+ +LMIPFM+RKISFWEETILQPRKS+F   K  R+F+++S+  T    
Sbjct: 339 INTIYDLMEKLVVDLMIPFMQRKISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQY 398

Query: 388 INSKSDGAVQRSN-FFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLA 446
            N   D    R N +F +SS EFLLRKLADWS M+SD++TAY+TY+TL  DLE H +YLA
Sbjct: 399 NNIVKDS---RGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLA 455

Query: 447 PCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSK 506
            CLEWCA+S+LMGAQ+IVT KMIKND++PLI +SL  YE+C+  + + +  E D  + S+
Sbjct: 456 SCLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCS--ILAQNSLENDELL-SE 512

Query: 507 PAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYE 566
           P +SYETRCMLL++ELFLSL+DTWT+TPYA+  LETIL  C LG  SQ+++WE+L+ CY 
Sbjct: 513 PVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWERLSDCYN 572

Query: 567 LRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSK 626
           +R DPR+ H           R E ++K                 +N  G Q+ Q+D    
Sbjct: 573 MRTDPRIRH-----------RVETVTKI----------------ENNEGGQQLQTD---- 601

Query: 627 DEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLL 686
                                  DI   GL R+RKAAFFRL+AA KW EQKQW+Q SW L
Sbjct: 602 -----------------------DIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCL 638

Query: 687 RDVDTVYSGLVFSYRKGLILERLVGEI 713
           RDV+ +Y  L FS R  LI ++L  E+
Sbjct: 639 RDVEYIYDDLSFSKRPELIYQKLKDEL 665

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/752 (47%), Positives = 481/752 (63%), Gaps = 90/752 (11%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL+H+DH+ ESV    E+AK+I                LD+H+QE Y + 
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVP--PEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNID 58

Query: 61  SMYMLLRFFGDCVTDRDQENET----------ETN---------------------FKGR 89
           S+YMLLR+FG CV+DRDQ NE            TN                      +GR
Sbjct: 59  SLYMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGR 118

Query: 90  PRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSA 147
            RSNSLFQR+S  S ++RFT+P+ D+V ++ S + MLFDYHSLE++L++YL+L+    + 
Sbjct: 119 SRSNSLFQRDSTQSQYIRFTKPIDDIVAIK-SSNDMLFDYHSLEIYLEQYLQLIATNTNN 177

Query: 148 NTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRF 207
           +TP+ LLK+SIYH FF+ AISST  LSPYE+FNHP++SL+A+DIS G TY++ RDLL+ F
Sbjct: 178 STPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEF 237

Query: 208 KNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLP 267
           KN+N+ T    +FP F+N ND+LP+FLLCY+ +  EQFE CQSL K LKKQLFVES++LP
Sbjct: 238 KNLNTTT---PNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILP 294

Query: 268 LWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLAL 327
           LW +  + D    +  LH PIMSSLEEM+YFL                 P S+ +L ++L
Sbjct: 295 LWNEQYEIDI---KVDLHQPIMSSLEEMIYFL---------------QTPFSA-KLSISL 335

Query: 328 VETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAP 387
           + +IY+ L+ LI +LM+PFMKRK+ FWEETILQPR+S+F  AKFL++F++K+        
Sbjct: 336 INSIYNILDSLIYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFLKKFMTKNNNGPQENI 395

Query: 388 INSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAP 447
           +   S+G    + +F  SS E L+RKLADWS M+SD++TAY+TY++LS+DL+   +YLA 
Sbjct: 396 LTKDSEG----NEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLAS 451

Query: 448 CLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKP 507
           CLEWCA S+LMGAQSIVTVKMIKNDI+PLI ++LQ YE CA  L      +  +    +P
Sbjct: 452 CLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQDTTNKVFAEQSVEP 511

Query: 508 AQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYEL 567
            +SYETRCM+L +ELFLSLSDTWT+TPYAI YLETIL  C LGP SQ+ +WE+L+ CY+L
Sbjct: 512 LRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKL 571

Query: 568 RVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKD 627
           R+DPR+ +                +      P        ST+K +T   E  SD +SK 
Sbjct: 572 RIDPRIRYKINDTATTTTTVTTTTADKVVATP--------STDKPKTIQWE--SDLESKL 621

Query: 628 EALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLR 687
            +                   K+I   G TRRRK+AFFRLIAA KW EQKQW+Q +W L+
Sbjct: 622 GS------------------GKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLK 663

Query: 688 DVDTVYSGLVFSYRKGLILERLVGEIEANMHA 719
           D++++Y       R  LI+ +L   ++ N+  
Sbjct: 664 DMESIYDATDLGKRDDLIVAKLRNLLDENIGG 695

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/743 (46%), Positives = 466/743 (62%), Gaps = 104/743 (13%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNL+YH+D + E  TV S++AK++               LLD H++E YG+ 
Sbjct: 1   MVFSYEHYMNLIYHLDDANE--TVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGID 58

Query: 61  SMYMLLRFFGDCVTDRDQENETETNFKG--------------------------RPRSNS 94
           S+YMLLRFFG CV+DRDQ NE +    G                          R  SNS
Sbjct: 59  SLYMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNS 118

Query: 95  LFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHR 152
           L+QR++  S +VRFT+PL DL++ + ++  MLFDYHSLE++L +YL +VD + S + PH 
Sbjct: 119 LYQRDATQSQYVRFTKPLADLINTQDAN-DMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177

Query: 153 LLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNS 212
           LLK SIYH FF  AISST+ LSP+E FNHP++SLLA+DI+R + YE A + L  FK+MN+
Sbjct: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237

Query: 213 ATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDS 272
              +  SFP+FIN NDILPVFLLCYN  +  +FE CQ+LA  LKKQLFVESI+LPLW  S
Sbjct: 238 ---NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLW--S 292

Query: 273 EDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIY 332
            ++  +     LH P+MSS+EE+++FL                NP+   +LPL LV  IY
Sbjct: 293 TEF-TDNLVVSLHQPVMSSIEEIMFFL---------------QNPVDH-KLPLKLVNCIY 335

Query: 333 DRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKS 392
           D++++++ +LM PFMKRK++FWEETIL PRKS+F  AKF ++F++KS  A        K 
Sbjct: 336 DQIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKE 395

Query: 393 DGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWC 452
           +     SN+  ++S EFL+RKLADWS M+SD++TAY TY++L +D E   +YLA C EWC
Sbjct: 396 NHG---SNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWC 452

Query: 453 AVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYE 512
           AVS+LMGAQ+IVT KM+KN+I+P I ++L  YE CA++ ++ H    DS   S P +SYE
Sbjct: 453 AVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCATE-SNAHRKFGDSDDLSAPVRSYE 511

Query: 513 TRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPR 572
           TRCM L++ELFLSLSDTWT+TP+AI YLETIL  C LGP S++++WE+L+ CY +R+DPR
Sbjct: 512 TRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPR 571

Query: 573 VSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSN 632
           + H                                     + GN           E L  
Sbjct: 572 IKH-------------------------------------RIGNL----------ELLQK 584

Query: 633 REKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTV 692
           +E+   D  N +    +DI   GLTR RKAA F+LIAA KWCEQKQW++ SW L D+++ 
Sbjct: 585 KEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLEST 644

Query: 693 YSGLVFSYRKGLILERLVGEIEA 715
           YS L    ++ L+  RL  E+ A
Sbjct: 645 YSDLKCFNKENLLYTRLRNELIA 667

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/731 (46%), Positives = 462/731 (63%), Gaps = 91/731 (12%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           +  SYE+YMNLL+H++ S E++   SE+A++I                LD H+Q+ Y + 
Sbjct: 2   INFSYEHYMNLLFHLECSDENIP--SEIARRIVSHAIAPVITVTSTPELDKHIQDTYSID 59

Query: 61  SMYMLLRFFGDCVTDRDQENETETN-------------FKGRPRSNSLFQRES--STFVR 105
           S+YMLLRFFG CV+DRDQ +E++ N              + R RSNSLFQR+S  S ++R
Sbjct: 60  SLYMLLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTRARSRSNSLFQRDSTQSQYIR 119

Query: 106 FTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTA 165
           FTRPL DLV+ R   + MLFD+HSLE +L +YL LV+     +T H+LLK S+YH FF+ 
Sbjct: 120 FTRPLPDLVE-RHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSL 178

Query: 166 AISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFIN 225
           AISST  LSP+ESFNHP+MSL+ALDI+   +YE+A+ LLI+FKN+++       FP +IN
Sbjct: 179 AISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDK---FPIYIN 235

Query: 226 INDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILH 285
             D+LPVFLLCYN  S E+ + C+ L+  +KKQLFVESI LPLW++S      EP   LH
Sbjct: 236 TYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQ---TEPFIKLH 292

Query: 286 PPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIP 345
            P+MSSL+EM+YFL  +                    LP+ L  T YD L  L+  L+IP
Sbjct: 293 QPVMSSLDEMIYFLQSDEQNT----------------LPIELTNTTYDMLEKLVYALLIP 336

Query: 346 FMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAP--INSKSDGAVQRSNFFP 403
           FM+RKI+FWEET+LQP+KSIF  +KFL++ +S+++ ++      +    DG    + +F 
Sbjct: 337 FMQRKIAFWEETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDG----NEYFA 392

Query: 404 ASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSI 463
           +SS E LLRKLADWS MLSD++T YATY+ LS DLE   +YLA CLEW AVS+LMGAQ+I
Sbjct: 393 SSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNI 452

Query: 464 VTVKMIKNDIDPLISKSLQCYEKCASK--LTSPHVAEADSPVDSKPAQSYETRCMLLSAE 521
           VTVKM+KNDI PLI ++L  Y+ CA+   L++  +   +     +P  SYETRC++LS+E
Sbjct: 453 VTVKMMKNDISPLIDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSE 512

Query: 522 LFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQR 581
           LFLSLSDTWT+TPYAI YLE+IL+   LGP S++++WE+L+ CY+LRVDPR+     K +
Sbjct: 513 LFLSLSDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRI-----KSK 567

Query: 582 HLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFV 641
             Q ++++                          N EE +D +       +R     D +
Sbjct: 568 VEQVQKQD--------------------------NLEEPADNE-------HRILNSQDDL 594

Query: 642 NPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYR 701
           NP+     +I   GLTR+RKAAFFRL+AA  W EQ QWKQ  W L ++  +YS +    R
Sbjct: 595 NPS-----NIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGLVNR 649

Query: 702 KGLILERLVGE 712
             LIL RL  E
Sbjct: 650 DDLILTRLREE 660

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/627 (47%), Positives = 394/627 (62%), Gaps = 82/627 (13%)

Query: 87  KGRPRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHR 144
           + R RSNSLFQR+S  S F+RFTRP+ DL+        MLFDYH+LE+FL   L++V+  
Sbjct: 156 RNRSRSNSLFQRDSTQSQFIRFTRPIEDLL-YSGGTGDMLFDYHTLEIFLGSCLKMVEKY 214

Query: 145 VSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLL 204
            + +  H+ L+ S+YH+FF++AISST  LSPYESFNHP++SL+A+DI++G  YE ARDLL
Sbjct: 215 TTDDIDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLL 274

Query: 205 IRFKNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESI 264
           I FKN N+   +  +FP F++ NDILPVF+LCYN SS E+ E    L+K +KKQLF E I
Sbjct: 275 IAFKNQNT---TINNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQLFAECI 331

Query: 265 LLPLW--RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFE 322
            +PLW  R S+D   +     LH P MSSL+EMLY        K                
Sbjct: 332 RMPLWDKRYSDDITVK-----LHQPAMSSLDEMLYVFQTSKTDK---------------- 370

Query: 323 LPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPA 382
           LPL L+  IYD+L +L  +LMIPFM+RKI+FWEETILQP+KS+F   K  R+F+ +  P+
Sbjct: 371 LPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMGR--PS 428

Query: 383 TPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHL 442
                  +      Q + +F ++SN FLLRKLADWS M+SD++TAY T+++L +D+E + 
Sbjct: 429 MTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYP 488

Query: 443 EYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSP 502
           +YLA CLEWCAV +LMGAQ+IVT KMIKND++PLI +SL  Y  CA  L S  +AE++  
Sbjct: 489 KYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNS--IAESEES 546

Query: 503 VDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLA 562
            D++P +SYETRCML+++ELFLSLSDTWT+TPYA+  LETIL  C LG  SQ+++WE+L+
Sbjct: 547 PDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIMIWERLS 606

Query: 563 YCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSD 622
            CY LR DPRV                          +H   S+ ST      ++EE   
Sbjct: 607 DCYNLRTDPRV--------------------------KHKLRSNISTSSVSEVSEEEIKK 640

Query: 623 TDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQA 682
            D                          I L GLTR+RKA+FFRL+AA KW EQ QW+Q 
Sbjct: 641 QD-----------------------VSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQV 677

Query: 683 SWLLRDVDTVYSGLVFSYRKGLILERL 709
           SW L D+  +Y   VF  R+ LI ++L
Sbjct: 678 SWCLNDISEMYQDTVFGKRESLIYQKL 704

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 1  MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
          MT +YENYMNL++H+D   E+V    +++K+I                LDSH+ E YG+ 
Sbjct: 1  MTFTYENYMNLIFHLDKVHENVP--QDISKRIVSNAIAPVITVTATVELDSHISEEYGID 58

Query: 61 SMYMLLRFFGDCVTDRDQENE 81
          S Y LLR+FG C++DRDQ NE
Sbjct: 59 SFYTLLRYFGGCISDRDQSNE 79

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  525 bits (1352), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/747 (40%), Positives = 418/747 (55%), Gaps = 134/747 (17%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           M  SYE+YMNLL H++ + E  TV  ++A++I                LD H+ E+Y + 
Sbjct: 1   MAFSYEHYMNLLSHLECASE--TVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQ 58

Query: 61  SMYMLLRFFGDCVTDRDQE------NETETNFKGRPRSNSLFQRES--STFVRFTRPLID 112
           S Y+L R FG C++DRDQ       +++ T  + R RSNSLFQR++  S F+RF +PL D
Sbjct: 59  SAYLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPD 118

Query: 113 LVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT----------------------P 150
           L+       G LFD  SLE +L  YL  +    + +                       P
Sbjct: 119 LLRSYTEQQG-LFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLP 177

Query: 151 HRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNM 210
           H+LL++++YH FF  A+SST  +SP+E+FN PVM+L+A+D+SRG  YE  RDL+  FKN+
Sbjct: 178 HKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNL 237

Query: 211 NSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWR 270
           N   K    FP FIN+NDILP+ +LCY+ +   Q   C+ L + +KK LFV+SI L LW 
Sbjct: 238 N---KFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALW- 293

Query: 271 DSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEA-PGKDNISYTGSSNPISSFELPLALVE 329
              D D E P   LH PIMSSL+E++ F    +  G D +   G S       LPL ++ 
Sbjct: 294 ---DEDPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRA----ALPLNIIT 346

Query: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAK-FLRRFVSKSAPATPAAPI 388
            +Y  L++L+ E++IPFM RK  +WEE ILQPRKSIF  +  F ++F+ K+   T   P 
Sbjct: 347 HMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTT--TQRDPS 404

Query: 389 NSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPC 448
           +++         FFPASS E LLRKLADWS MLSD++TAY TYD+LS DL++   YLA C
Sbjct: 405 DTQ---------FFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASC 455

Query: 449 LEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPA 508
           LEWCAVS+L+GAQ+IVTVKMIK +I PLI +++  Y +                   +  
Sbjct: 456 LEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ-------------------QGR 496

Query: 509 QSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELR 568
            SYETRCM+LSAELFL+L DTWT+TPYAI+YLETIL++CP           +L  C ++ 
Sbjct: 497 SSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCP-----------QLGACSQVM 545

Query: 569 VDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDE 628
           +  R+S  +              S+++ R       S  ST  +    Q           
Sbjct: 546 IWERLSDCYQ-------------SRTDPRV-----ASALSTNTSPGSAQ----------- 576

Query: 629 ALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRD 688
                             P  +I   G TR+RKAAFFRLIAA KW EQ QW+Q  W L D
Sbjct: 577 ------------------PGNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHD 618

Query: 689 VDTVYSGLVFSYRKGLILERLVGEIEA 715
           +  +Y+      +KGL+++RL  E+++
Sbjct: 619 IKDIYTASALYDKKGLLIDRLNTEVQS 645

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  514 bits (1324), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 307/711 (43%), Positives = 429/711 (60%), Gaps = 110/711 (15%)

Query: 3   LSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLHSM 62
           LSYE YMNL+++ +H  + V    E+++++                L++HL E +   S+
Sbjct: 2   LSYETYMNLVHYPEHWSQPVP--HEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSL 59

Query: 63  YMLLRFFGDCVTDRDQENETETNFKGRPRSNSLFQRESSTFVRFTRPLIDLVDVRVSDHG 122
           YMLLR+F D V +R +E     +  G+ R  S++QR++S +VRF RPL ++++  V    
Sbjct: 60  YMLLRYFADYVRERGEE---VGSVSGQRRPGSVYQRQTSRYVRFQRPLEEVIET-VEQQA 115

Query: 123 MLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHP 182
           +  D+  LE  L ++LR ++ R +  +P  LLKHSI+HKF T  +SSTA LSPY + NHP
Sbjct: 116 V--DFEDLEEALGQHLRDIEARTTNESPSELLKHSIFHKFITM-LSSTA-LSPYHTVNHP 171

Query: 183 VMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYNDSSH 242
           +M+LLALD+++G+ Y  AR+LL++FKN+ S    ++ FP++IN ND+LPVF+LC+++SS 
Sbjct: 172 IMALLALDVTQGEEYTLARELLVQFKNLPS---KSSKFPSYINTNDVLPVFILCFDESSS 228

Query: 243 EQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLE 302
           EQ+E  Q+L K +KKQLFVES+ LP++ + E     +P  +LHPPI +SL+E +Y     
Sbjct: 229 EQWETVQALQKAIKKQLFVESVPLPIFTNYES----DPV-VLHPPITNSLQEQVY----- 278

Query: 303 APGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETILQPR 362
                     GS  P+    L   LV+ IY+ +N ++ +LMIPFM RKISFW+ETILQPR
Sbjct: 279 ---------DGSHPPL--LRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDETILQPR 327

Query: 363 KSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLS 422
           KSIF   KFL+RF++K+  ++ A  +++ SDG      +F ASSNEFLLRKLADWSFMLS
Sbjct: 328 KSIFHGNKFLKRFMNKTN-SSAAGTLSTSSDG------YFLASSNEFLLRKLADWSFMLS 380

Query: 423 DYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQ 482
           DY+TAY+ Y  L +D E + +YL+ C E+ A+S+LMGA SIVT KMIKNDIDPLI K + 
Sbjct: 381 DYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYM- 439

Query: 483 CYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLET 542
                            DS V S      + RC++  AELFLSLSDTWT+ P+AIKYLE 
Sbjct: 440 -----------------DSTVASLNYLG-KFRCLVYMAELFLSLSDTWTSAPFAIKYLEL 481

Query: 543 ILQN--CPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQ 600
           ILQN    LGP S+ +LWE+++Y Y+LR+DPR   IH    +L                 
Sbjct: 482 ILQNEQLKLGPLSRTMLWERISYAYQLRIDPR---IHTDDEYL----------------- 521

Query: 601 HHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADF-VNPNKLPYKDIALLGLTRR 659
                        + N  E +  D              DF +NPNKL +  I  LGLTR 
Sbjct: 522 -------------SDNFMELTTED--------------DFCMNPNKLHHWRIHSLGLTRH 554

Query: 660 RKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLV 710
           RK A FRL+AA KW E    +Q +W L+  + VY  L F+   G +L RLV
Sbjct: 555 RKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADGTLLSRLV 605

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  511 bits (1316), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 305/717 (42%), Positives = 425/717 (59%), Gaps = 111/717 (15%)

Query: 3   LSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLHSM 62
           LSYE YMNLL++ D   + V    E+++K+                L+ HL+E + + S+
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVP--REISRKVICNALSPCISVQSTDALNQHLEEVFKIGSL 59

Query: 63  YMLLRFFGDCVTDRDQ-ENETETNFKG---RPRSNSLFQRESSTFVRFTRPLIDLVDVRV 118
           Y LLR+FGD + DRDQ +++     +    R R NSLFQR SS ++RF  PL D++ V  
Sbjct: 60  YKLLRYFGDYIQDRDQLDDKISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVG- 118

Query: 119 SDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLSPYES 178
            +H +  +++ LE  L ++L+ ++     ++P  LLKHSI+HKF T   S+T  LSPY S
Sbjct: 119 DNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTT--LSPYHS 174

Query: 179 FNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLLCYN 238
           FNHP+++LLALDI++G+ YE AR+LL+ FKN+     + + FP FIN ND+LPVF+LC++
Sbjct: 175 FNHPILALLALDITQGEEYELARELLMEFKNL---PNTLSKFPAFINTNDVLPVFILCFD 231

Query: 239 DSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYF 298
            SS +Q+E  QSL K++KKQLFVES+ LP++ +  D        +LHPPI +SL+E LY 
Sbjct: 232 QSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFRDRSI-----VLHPPITNSLQEQLY- 285

Query: 299 LDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFWEETI 358
                          SS+P+S  +L   LV+ IYD +N ++ +LMIPFM RKISFW+ETI
Sbjct: 286 --------------DSSHPVS-LKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETI 330

Query: 359 LQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWS 418
           LQPRKSIF + K L+RF+SKS+  +P A + +  DG       F ASSNEFLLRKLADW 
Sbjct: 331 LQPRKSIFHSNKLLKRFISKSS-GSPTASMPTSPDGH------FLASSNEFLLRKLADWC 383

Query: 419 FMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLIS 478
           FMLSDY+TAY+ Y+ L +D E++  Y++ C E+ A+S+LMGA SIVT KMIKNDIDPLI 
Sbjct: 384 FMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIM 443

Query: 479 KSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPYAIK 538
           K L                  D  V++  +   + RCM+   ELFLSLSDTWT+ P+AIK
Sbjct: 444 KYL------------------DYAVNNIISLD-QIRCMIYMTELFLSLSDTWTSAPFAIK 484

Query: 539 YLETILQ--NCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNE 596
           YLE ILQ  N  LGP  + L+WE++++ Y LR+DPR   IHA                  
Sbjct: 485 YLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPR---IHA------------------ 523

Query: 597 RAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGL 656
                                    D DS  +   + E+E   ++NP+KL    I   G 
Sbjct: 524 -------------------------DDDSTSDCDHDLEEEL--YLNPHKLHCGKIQNQGF 556

Query: 657 TRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGEI 713
           TR RK A F+L+AA KW +  Q +Q +W L+  + VY  L F+  +G +L RL   +
Sbjct: 557 TRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLADAV 613

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  511 bits (1317), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 297/674 (44%), Positives = 426/674 (63%), Gaps = 89/674 (13%)

Query: 87  KGRPRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHR 144
           K R RSNSLFQR+S  S ++RFT+P+ DLV+ R      LFD+ SLE  L  YL++++  
Sbjct: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDS-LFDHQSLETLLKGYLKIIETN 241

Query: 145 VSANTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLL 204
            + + PH  LK S+YH+FF+  ++ST  L P+ESF+HP++SLL++D++    Y+ A+++L
Sbjct: 242 TTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEML 301

Query: 205 IRFKNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESI 264
           I+FKN++S T    +FP ++NINDILPVFLLCY+ SS EQ +  + ++  +KKQLF ESI
Sbjct: 302 IKFKNIHSKT---PNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESI 358

Query: 265 LLPLWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELP 324
           LLPLW D + Y+ ++  + LH P+MSS++E LYFL           Y   ++ ++  +LP
Sbjct: 359 LLPLWND-KIYNNDKFVK-LHEPMMSSVDETLYFLQ---------QYLQKNSCVTDNKLP 407

Query: 325 LALVETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATP 384
           L+LV+ IY+ +  L   L+IPFM+RKI FW+ETILQPRKSIF N K  + F+++++  + 
Sbjct: 408 LSLVKYIYEMIANLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSS 466

Query: 385 A-----------------APINSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTA 427
           +                 + +   S+G      +F A S EF LRKLADWS M+SD++TA
Sbjct: 467 STGTSSSEISNSISKHHHSLLTKDSNG----HEYFSALSTEFQLRKLADWSMMVSDFKTA 522

Query: 428 YATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEK- 486
           Y TY++LS+DLE+  +Y+A CLEW AVS+LMGAQ+IVT KM+KND+DPLI  +L+ YEK 
Sbjct: 523 YTTYESLSRDLENTSKYMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKP 582

Query: 487 ----CASKLTSPHV--------------AEADSPVDSKPAQSYETRCMLLSAELFLSLSD 528
                 S+L S ++              AE     ++   +SYE RCMLL +ELFLSLSD
Sbjct: 583 LPPVPNSRLPSNNINSLNSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSD 642

Query: 529 TWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYERE 588
           TWT+TPYA++YLETIL +  LGP SQ +LWE+L++CY+LRVDPR+            +R+
Sbjct: 643 TWTSTPYALRYLETILSDYKLGPCSQTILWERLSFCYDLRVDPRI------------KRK 690

Query: 589 EVISKSNERAPQHHSESHFST-----EKNQTGNQEEQSDTDSKDEAL----SNREKEHAD 639
             I+  N+      SE+  S+     EK +   ++E+   D K+  +    SN E +   
Sbjct: 691 PTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCG- 749

Query: 640 FVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFS 699
                     DI   G TR+RKAAFF+LIAA KW EQKQW+Q  W L+D++ VY  + FS
Sbjct: 750 ---------YDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQLDWCLKDIENVYKEVGFS 800

Query: 700 YRKGLILERLVGEI 713
            RK LIL +L  ++
Sbjct: 801 DRKDLILIKLKDQL 814

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 1  MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
          M  SYENYMNLL+H+D + E +   +++AK+I                LD H+Q++Y + 
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIP--TDIAKRIVQNSIAPLISVTATPELDKHVQDSYNID 58

Query: 61 SMYMLLRFFGDCVTDRDQENE 81
          S+YMLLR+FG C++DRDQ +E
Sbjct: 59 SLYMLLRYFGGCISDRDQYHE 79

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  478 bits (1231), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 285/721 (39%), Positives = 420/721 (58%), Gaps = 85/721 (11%)

Query: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIXXXXXXXXXXXXXXXLLDSHLQEAYGLH 60
           +  SYE YMNL+ + +H    +    E++KK+                LD+HL++ Y + 
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIP--HEISKKVIYNTLSPCICVQSNLELDNHLKDMYNID 60

Query: 61  SMYMLLRFFGDCVTDRDQENETETNFK-------GRPRSNSLFQRESSTFVRFTRPLIDL 113
           S+ ML R+FGD + DRDQ   T T+ K       GR RS+SLFQR++S  VRFTR L DL
Sbjct: 61  SISMLFRYFGDYIQDRDQIPST-TDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDL 119

Query: 114 VDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSAN-TPHRLLKHSIYHKFFTAAISSTAY 172
           + +   DH  +     ++ FL +YL+ ++  ++ N TP +LLKHSIYH+FF     S+  
Sbjct: 120 ISIDSEDH--ILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITL--SSIN 175

Query: 173 LSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPV 232
           LS Y SF+HPV++LL LDI++G  YENAR++LI FKN+N+  ++   FP FININDILPV
Sbjct: 176 LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLEN---FPEFININDILPV 232

Query: 233 FLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSL 292
           F+LCY+++S EQ+E+ Q+L K LKKQLFVES+ + L+   ++    +    LH PI  SL
Sbjct: 233 FVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPHDN----QKSTTLHSPITVSL 288

Query: 293 EEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKIS 352
            E ++          N+S+  S N      +P  L+  IYD ++ ++ E+MIPFM RK+ 
Sbjct: 289 HEQVF----------NMSHPTSIN------IPSRLLTHIYDTISFIVEEMMIPFMHRKLV 332

Query: 353 FWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLR 412
           FW+ET+LQPRKSIF + KF RRF+S  +    A  +N   D A +    FPASS EFLLR
Sbjct: 333 FWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPA-EGDIMFPASSPEFLLR 391

Query: 413 KLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKND 472
           KLADWSFMLSD++ AY+ YD L+KD E + +YLAPCLE+  +S+LMGAQ+I+T K IK +
Sbjct: 392 KLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTE 451

Query: 473 IDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTA 532
           +DPL++++++ Y+K   K    H                   C+L  ++L LSLSDTW +
Sbjct: 452 VDPLMTRAIEQYKKQDEK----HSLRV-------------IHCILTFSDLLLSLSDTWVS 494

Query: 533 TPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVIS 592
           +P A+ YL  I ++  LGP + V++ E++AY YE+ +D RV+             +  + 
Sbjct: 495 SPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVN-------------DHFLP 541

Query: 593 KSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIA 652
           K +E      SE+  +++K + G + +                +  ++ N NKL   ++ 
Sbjct: 542 KPDEENKADESEAAENSKKGENGLEVD----------------DMHEWRNENKLIQNNLR 585

Query: 653 LLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGE 712
             GLTR RK + ++L+AA KW E  +  QA W +      Y  L  S R   +  RL  E
Sbjct: 586 SEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSME 645

Query: 713 I 713
           +
Sbjct: 646 L 646

>KAFR0A08090 Chr1 complement(1623348..1626242) [2895 bp, 964 aa]
           {ON} Anc_1.119 YNL243W
          Length = 964

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 380 APATPAAPINSKSDGAVQRSNFFPASSNEFLLRKLADWS-----FMLSDYRTAYATYDTL 434
            P TPA+ I S  +GA +++  F  S N+ ++    D       F +SD+ TA AT  T 
Sbjct: 591 GPLTPASFIVSLIEGASEKATEFATSFNDLIVDGFVDGDQANLIFNISDFSTAVATLVTS 650

Query: 435 SK 436
           SK
Sbjct: 651 SK 652

>KAFR0D00220 Chr4 (25909..28434) [2526 bp, 841 aa] {ON} Anc_1.13
           YCL054W
          Length = 841

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 573 VSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEE-QSDTDSKDEALS 631
           +S I  K+ H   E EE+IS +   +    SES F    N+ G Q++  SD DS++E   
Sbjct: 589 ISKITRKRTHKAAEDEEIISSAE--SSTDDSESDFEIVPNENGTQDDFDSDYDSEEERKQ 646

Query: 632 NREKEHA 638
             +++HA
Sbjct: 647 TSKEKHA 653

>Skud_13.131 Chr13 (217482..219476) [1995 bp, 664 aa] {ON} YML020W
           (REAL)
          Length = 664

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 599 PQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVN 642
           P H +   +S   N    ++E SD +S +EA  N  +E A+FVN
Sbjct: 36  PNHKATKSWSIWGNNDEGEQEPSDKNSANEARKNGHQEPANFVN 79

>AFR344C Chr6 complement(1063015..1063896) [882 bp, 293 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR498C
           (SEC20)
          Length = 293

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 18/135 (13%)

Query: 553 SQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKN 612
           +Q+LLWE+    Y  R+D  + H H      Q +     +++  RAP    +   +T K 
Sbjct: 82  AQLLLWERFLADYRRRLDAAIVHEHEATAARQLQARPTAARA-PRAPMTAKDRLLATNKA 140

Query: 613 QTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRR---------RKAA 663
            T N   +S+   +   L +        +N ++L  +  +L GL RR         R AA
Sbjct: 141 ITSNL-IRSNHVLQSSVLQSE-------LNMDELAQQTASLAGLGRRFDQLGLVLHRSAA 192

Query: 664 FFRLIAANKWCEQKQ 678
             R I A+   E+++
Sbjct: 193 IVRSIEASSGKEKQR 207

>NDAI0E00990 Chr5 complement(200132..201643) [1512 bp, 503 aa] {ON}
           Anc_8.713 YOR264W
          Length = 503

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%)

Query: 441 HLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEAD 500
           H  Y+ P L               T  + +ND D  I+ SL+C EKC   L+S    E D
Sbjct: 419 HFTYVKPLLFKLEDDTESSLSDEETSLLTRNDNDQKINASLKCLEKCQPCLSSETATERD 478

Query: 501 S 501
           S
Sbjct: 479 S 479

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,252,814
Number of extensions: 3296591
Number of successful extensions: 15569
Number of sequences better than 10.0: 72
Number of HSP's gapped: 15948
Number of HSP's successfully gapped: 87
Length of query: 719
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 602
Effective length of database: 40,065,477
Effective search space: 24119417154
Effective search space used: 24119417154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)