Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0H17204g8.256ON1211121160860.0
NDAI0B023808.256ON1219122622770.0
NCAS0B049808.256ON1204123322590.0
TDEL0F038308.256ON1195122222410.0
YLR084C (RAX2)8.256ON1220123322200.0
Suva_10.1688.256ON1220123222000.0
ZYRO0C01804g8.256ON1209123321970.0
Skud_12.1528.256ON1220123721900.0
Smik_12.1438.256ON1220123121800.0
KLTH0G13838g8.256ON1214122321750.0
Kwal_56.235898.256ON1213122221720.0
Kpol_392.108.256ON1226123121640.0
KLLA0F18975g8.256ON1200121621460.0
Ecym_43158.256ON1212122521290.0
TPHA0B032508.256ON1215123121200.0
KAFR0B026908.256ON1210123619520.0
AGR095W8.256ON1201124119490.0
TBLA0E043908.256ON1278127818490.0
KNAG0G020008.256ON1202124217940.0
CAGL0L12144g8.256ON1156113616260.0
NDAI0A060303.73ON929144762.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0H17204g
         (1211 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...  2348   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   881   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   874   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   867   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   859   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   852   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   850   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   848   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   844   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   842   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   841   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   838   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   831   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   824   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   821   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   756   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   755   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   716   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   695   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   630   0.0  
NDAI0A06030 Chr1 complement(1366582..1369371) [2790 bp, 929 aa] ...    34   2.9  

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score = 2348 bits (6086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1169/1211 (96%), Positives = 1169/1211 (96%)

Query: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60
            MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT
Sbjct: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60

Query: 61   FYRYTGQENFTGSITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGT 120
            FYRYTGQENFTGSITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGT
Sbjct: 61   FYRYTGQENFTGSITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGT 120

Query: 121  GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS 180
            GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS
Sbjct: 121  GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS 180

Query: 181  VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS 240
            VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS
Sbjct: 181  VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS 240

Query: 241  KNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRP 300
            KNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRP
Sbjct: 241  KNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRP 300

Query: 301  SKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAE 360
            SKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAE
Sbjct: 301  SKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAE 360

Query: 361  ANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMY 420
            ANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMY
Sbjct: 361  ANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMY 420

Query: 421  QNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFY 480
            QNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFY
Sbjct: 421  QNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFY 480

Query: 481  PNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLL 540
            PNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLL
Sbjct: 481  PNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLL 540

Query: 541  YSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQY 600
            YSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQY
Sbjct: 541  YSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQY 600

Query: 601  QISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDD 660
            QISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDD
Sbjct: 601  QISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDD 660

Query: 661  LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRF 720
            LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRF
Sbjct: 661  LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRF 720

Query: 721  NNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYT 780
            NNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYT
Sbjct: 721  NNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYT 780

Query: 781  ELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRS 840
            ELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRS
Sbjct: 781  ELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRS 840

Query: 841  EDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVN 900
            EDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVN
Sbjct: 841  EDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVN 900

Query: 901  AIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGT 960
            AIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGT
Sbjct: 901  AIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGT 960

Query: 961  QLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEIS 1020
            QLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEIS
Sbjct: 961  QLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEIS 1020

Query: 1021 YYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAML 1080
            YYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAML
Sbjct: 1021 YYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAML 1080

Query: 1081 YDFEDWMPYFIVDGENAGRASNIFMNKDLSSLYTTQTILQGXXXXXXXXXXXXXXXXXDK 1140
            YDFEDWMPYFIVDGENAGRASNIFMNKDLSSLYTTQTILQG                 DK
Sbjct: 1081 YDFEDWMPYFIVDGENAGRASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSNMPSETSDK 1140

Query: 1141 NESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQYEPLKPRVDEGDMID 1200
            NESSSDKIDRGFVVLI                         NKGQYEPLKPRVDEGDMID
Sbjct: 1141 NESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPLKPRVDEGDMID 1200

Query: 1201 TVPPEKLMKFV 1211
            TVPPEKLMKFV
Sbjct: 1201 TVPPEKLMKFV 1211

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1226 (41%), Positives = 762/1226 (62%), Gaps = 46/1226 (3%)

Query: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73
            L  ++  SQLS++K  LN+ +++IP ++L++S +D   LLGD + L+FYRY GQ+NFT  
Sbjct: 12   LIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTG 71

Query: 74   ITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQ 131
            I        LIYYSN T I+L+  S++   A    I PFG DSFILSGTG+L  G++L  
Sbjct: 72   IIPGSNSNGLIYYSNNTLIQLEEPSNDTYIA---KITPFGSDSFILSGTGSL-SGYSLTN 127

Query: 132  QLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEI 191
            QLLYNL++L    IFN SI  V  IL DD +VYFGG F    G S  HS+++W+ST++  
Sbjct: 128  QLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSST 187

Query: 192  QLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQ--IRGSNSSKNATDIEFD 249
            + L F GFG +S++NSI++L++DNI+FAG+F TLD+   L Q      N+  N+T ++  
Sbjct: 188  EFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIG 247

Query: 250  QLIPLKHAGW-SSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNA 308
            QL+PL  + W + + + +  + +CP    + W Q GT TG  T  L  ++ P+K+RIYN+
Sbjct: 248  QLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGT-TGSLTCKLPFEVAPTKIRIYNS 306

Query: 309  FDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSD 368
             + D QVSLFRI+T+ A GIMNLTY+DP + EL +CDA+CPL S  +L QA AN T  SD
Sbjct: 307  PNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSD 366

Query: 369  SVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFA 428
            ++  + +N T+IKWT  +QEFAF+N++SV S+ F+ALDSYG++V L  F++YQN Y  FA
Sbjct: 367  TIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFA 426

Query: 429  NDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGD-LPSVNFYPNITYAG 487
            NDTLN+PNC N    S + + S   W  G    +YI +TY    D +P V+F P I Y G
Sbjct: 427  NDTLNEPNC-NSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPG 485

Query: 488  DYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLES 547
             Y++N+ TPGCT D +CSSR IVNVTVWD    ++L+T+LIYQNN + KYD LYSGYL S
Sbjct: 486  QYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSS 545

Query: 548  APKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET----LNGLFQYQIS 603
            +P++T+++   +   ++ + +VADR++V+IDS++   +     N T    LNGL QYQIS
Sbjct: 546  SPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQIS 605

Query: 604  NFTTISNDS--LKIGNTTINRYSIENVPSNSELFAGYY-NNTLLVDGAFNGIAVLQLNDD 660
            NF+T S+++  +KI NT++N+ S+E    N+ ++A  Y +NTLL+  +  GI V++LN++
Sbjct: 606  NFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNEN 665

Query: 661  LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTN--IT 718
            ++I S       G T G ++YS G+L  G++NLSS+    ++YNGTF+   N   N  IT
Sbjct: 666  MDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSIT 725

Query: 719  RFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQ 778
               N+TI D+ELLV +N+ I+NVSS+  I N+S+  LSLWS+GSN   D +  GA++   
Sbjct: 726  NVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLD 785

Query: 779  YTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGN 838
            YT+LNG++ I +  +++ I         +YT  ++NDS + YA  SK DS   +L + G 
Sbjct: 786  YTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYA--SKTDSYSELLFSNGY 843

Query: 839  RSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSS 898
             +   P S+   +N M+Y+   ++LAV ++  + N + LS+ N++  + I  E L   S 
Sbjct: 844  SA---PWSFFEGINYMVYSSHQTMLAVASSDFNKN-SELSILNLTTFETIANETLNVNSK 899

Query: 899  VNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFN 958
            +N ++ F  NS+L+VGG+FTI +  ++CSGLCLYNY++++W  F N+SI+G I  ++  N
Sbjct: 900  INGLINFEHNSTLIVGGNFTILQ--SNCSGLCLYNYDSNEWLTFANHSINGTIAQMELIN 957

Query: 959  GTQLLISGNLYTENETGINLAKLNMASNEVTILRHG-STMVQSFVTFDHTTDELITQSDN 1017
            GTQLL+SG    +N + +NLA +++++  V+ ++ G + ++QSF T     D++IT +  
Sbjct: 958  GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIG---DKIITWNGI 1014

Query: 1018 EISYYTNGEWKNLTSEDFNDSLYMGA-QLIPLKQTSSKRDVSNRA--LLVNGDLKHSTYG 1074
             +  Y NG W  + S +FN S  + + + I    T  KRD +  A   ++NG++  + YG
Sbjct: 1015 MLESYENGAWSTIQS-NFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTEYG 1073

Query: 1075 SVSAMLYDFEDWMPYFIVDGENAGRASNIFMNKDLSSLYTTQTILQGXXXXXXXXXXXXX 1134
            ++ AM+Y+F++W PY+I+   N+  A  IFMN+D S+LY +Q++LQ              
Sbjct: 1074 TIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTS 1133

Query: 1135 XXXXDKNESSS---------DKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQ 1185
                    SS           KIDRGFVVLI                           G 
Sbjct: 1134 SGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGS 1193

Query: 1186 YEPLKPRVDEGDMIDTVPPEKLMKFV 1211
            ++ L PR +E +M++TVPPEKLMKF+
Sbjct: 1194 HDALNPRTNEDEMLETVPPEKLMKFL 1219

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/1233 (43%), Positives = 779/1233 (63%), Gaps = 55/1233 (4%)

Query: 4    FLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYR 63
             +KIL     L   +  SQLSSL+E LNI  ++IP ++L++  ++   LLG  + L+FYR
Sbjct: 2    LIKILLGALLLIPQIYASQLSSLQENLNITHINIPNLNLTTD-DNSFELLGGIDSLSFYR 60

Query: 64   YTGQENFTGSITETEKD--LIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTG 121
            YTGQ+NFT  I        L YYSN TFI+L    + +  + I  IIPFG DSFILSG G
Sbjct: 61   YTGQQNFTSGILPNSNSNGLTYYSNNTFIQL---YEPSLDSRIERIIPFGSDSFILSGKG 117

Query: 122  TLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSV 181
            +L GG++L  QLL+NLSS     IFNQ++ +VN IL D  +V FGG F  +  +  GHSV
Sbjct: 118  SL-GGYSLSNQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSV 176

Query: 182  VLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSK 241
             LWN T N   LLPF GFG +S++NSI +L++DNI+FAGKF TLD++TLL  +   ++ +
Sbjct: 177  ALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVVN--DTMR 234

Query: 242  NATDIEFDQLIPLKHAGWSSQGSL-EHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRP 300
            N +DI   QLIPL  A WSS GS  +  + +CP    + WFQ GT+ G    +L  D+ P
Sbjct: 235  NISDINLGQLIPLSAATWSSTGSFFDEETFVCPDPTIEAWFQNGTS-GTLNCNLPFDVAP 293

Query: 301  SKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAE 360
            +K+RIYN+ D D ++SLFRI + P+  IMNLTY+DP  G+L +CDA+CPL + ++L+ A 
Sbjct: 294  TKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSAS 353

Query: 361  ANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMY 420
             NVT+SS+ +  + +N ++I+W+  +QEFAFVN++S  SL FLAL+SYG++VGL  F++Y
Sbjct: 354  ENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIY 413

Query: 421  QNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY-DGTGDLPSVNF 479
            Q+ Y  FAN++LN+P+C+++ S+S +   S   WT+G  D +Y+ +TY    G LP V F
Sbjct: 414  QDAYAIFANNSLNEPSCNSLESFSSS-DLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTF 472

Query: 480  YPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDL 539
            +P++ Y+G Y++ + TPGC  D +CSSRGIVNVTVW+  N+++LST LIYQNN+  KYD 
Sbjct: 473  HPDLKYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDE 532

Query: 540  LYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSID-QSKIGLKTINETLNGLF 598
            LYSGYL  +PKIT+ ++  I + ++   +V DR++++I+S+D  ++I   T +  LNGLF
Sbjct: 533  LYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLF 592

Query: 599  QYQISNFTTISNDS--LKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQ 656
            QYQ+SNF+T S DS   ++ NT+IN+ ++    SN  L A  YN+TLLV    +G+++ +
Sbjct: 593  QYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYE 652

Query: 657  LNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTN 716
            LN DL I S  + G  G   G+ +YSNG+L  GDFN S +  + LS+NG+F S GN+ + 
Sbjct: 653  LNKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSP 712

Query: 717  ITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQ 776
            IT F NITIDDSELLVF+N  IFNVSS+  I NTSSF+LSLWS+GSNS  D +  GA+SQ
Sbjct: 713  ITNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQ 772

Query: 777  RQYTELNGAVYIND---ANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKND-STHHV 832
             Q+T L+G+V I +   A S+ +IG P       Y A ++NDS T Y    KND ST  +
Sbjct: 773  VQFTNLSGSVSIANNLSATSLRSIGSP-------YAAIFLNDSVTGYVL--KNDSSTSEM 823

Query: 833  LIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEEN 892
            + + G+++   P  W+  V++M+Y  + S+LAVG+++   NG  LS+ N+ + K++  E 
Sbjct: 824  IFSDGSKA---PWRWTGYVDSMLYLTNQSMLAVGSSSS-VNG-ELSILNLDSFKVLANET 878

Query: 893  LGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNIT 952
            L   SSV  +V F +NSS+LVGG+F+I   +T C GLCLYNY  ++W  F N +I+G IT
Sbjct: 879  LNQNSSVKTMVHFERNSSILVGGNFSI--SNTECFGLCLYNYTGNQWYTFLNGTINGTIT 936

Query: 953  DLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHG-STMVQSFVTFDHTTDEL 1011
             LQ FN +QL+I+G   T++++ +NLA +N+  N++ ++R G    V+ F+T D   D +
Sbjct: 937  KLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNI 993

Query: 1012 ITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTS----SKRD---VSNRALLV 1064
               ++  +  YT+  W ++   + N S  + +  I    T+     KRD    SN  L+V
Sbjct: 994  FAWNETSLFEYTSNSWVDIPISNSNSSTTIDS--IGWTTTTDNNLKKRDNSETSNNVLIV 1051

Query: 1065 NGDLKHSTYGSVSAMLYDFEDWMPYFIVDG--ENAGRASNIFMNKDLSSLYTTQTILQGX 1122
             G +  + YG + AM+Y+FE+W+PY  ++    +A + + +F+++D+S L+ +Q  LQ  
Sbjct: 1052 KGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVS 1111

Query: 1123 XXXXXXXX----XXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXX 1178
                                 K   S  KIDRGFVVLI                      
Sbjct: 1112 NTTASITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYA 1171

Query: 1179 XXXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
               + G Y+ + PRV+E +M+ TVPPEKLM+F+
Sbjct: 1172 FRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1222 (41%), Positives = 751/1222 (61%), Gaps = 60/1222 (4%)

Query: 13   ALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTG 72
            ++C L   SQL +LK K  I ++  P++D      + + L G F  LTF +Y GQENFTG
Sbjct: 11   SVC-LSLASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTG 66

Query: 73   SITET--EKDLIYYSNGTFIKLDSLSDENATAD--INHIIPFGDDSFILSGTGTLPGGHN 128
            +I      + ++YYSN TFIKL      N ++D  +  I+PFG +SFIL G+G+L G + 
Sbjct: 67   TINNNTDSRGIVYYSNDTFIKLI-----NGSSDSYVEKIVPFGSESFILGGSGSLLG-YE 120

Query: 129  LEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTT 188
            L +QLLYNLS L    IF  S++ V  IL D  + YFGG F +  G++ GHSV  WNS++
Sbjct: 121  LGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSS 180

Query: 189  NEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATDIEF 248
            N   LLPF GFG +S+VNSI++LD+DNI+F G+F TLDD TLL     ++ + ++  IE 
Sbjct: 181  NTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEI 240

Query: 249  DQLIPLKHAGWSSQGSLEHS--SLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIY 306
            ++L+PL+ A W++         + ICP+   + W    T+ G    SL  +  P K+RIY
Sbjct: 241  NELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTS-GSLEASLPYESYPKKVRIY 299

Query: 307  NAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTIS 366
            N+ +    VSLFRIIT P+NGIMNLTY+DP +GEL  CDA+CPL+  + L+ A AN   S
Sbjct: 300  NSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS 359

Query: 367  SDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPT 426
               V  + NN T+I+W+  YQ+FAFVN+++V  L FLAL SYG +VGL  F++YQ+   T
Sbjct: 360  Q--VVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTT 417

Query: 427  FANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYD-GTGDLPSVNFYPNITY 485
            +AN++LN+  C++ N  +     S  +W QG    SY+++ +  G   LP V FYP I Y
Sbjct: 418  YANNSLNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINY 476

Query: 486  AGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYL 545
            AG YT+N+ TPGC+ D +C+SR IVNVT+W ++  ++LS+ L++QNN   KYD +YSG+L
Sbjct: 477  AGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHL 536

Query: 546  ESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET--LNGLFQYQIS 603
            E+AP +TL++Y  I+ ++ ++++VADR++VI++S+D  K      +ET  LNG+FQYQ+S
Sbjct: 537  ETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILK---NQTDETIPLNGMFQYQLS 593

Query: 604  NFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNI 663
            NFT  ++    I NTT+N Y+++N P N+ LF+  YNNTL V G+ +G+A ++L++DL++
Sbjct: 594  NFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHV 653

Query: 664  ISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFNNI 723
             S  +  TGG  EGI++YS+G++  G FNLSSQ +STL++NG F SFGNL T +  + N+
Sbjct: 654  SSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNV 713

Query: 724  TIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELN 783
            +    ELLVFNN Y+FN+SSN YI N+S+F LSLWSAG N  +D +  GAV++ Q+  L 
Sbjct: 714  SFQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLY 773

Query: 784  GAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDL 843
            G+  I   +S++   L   +G + Y A ++NDS TAYAY  +  S   +    G      
Sbjct: 774  GSASIYSNSSVAHFSLQ--NGAQPYAACHLNDSVTAYAY--RYGSVSQLYFDNGKEG--- 826

Query: 844  PVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIV 903
            P +W   +N+M Y+K+ ++LA+GT+ G T+   LSLFN+++  ++    +    +++++V
Sbjct: 827  PWTWFGTINSMRYSKNSTILAIGTD-GSTDEPILSLFNLTSFDVLANTTISENGTISSMV 885

Query: 904  AFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLL 963
             F++NSSLLVGGD+ I   D  CSGLCLYNY+  +W+ F NNSI+GNIT++Q      LL
Sbjct: 886  FFDRNSSLLVGGDYHI--SDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLL 943

Query: 964  ISGNLYTENETGINLAKLNMASNEVTILRHGST-MVQSFVTFDHTTDELITQSDNEISYY 1022
            ISG +   N+T +NL   NM++ EV  L   S   ++SF+  D   +++IT ++  +S Y
Sbjct: 944  ISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSLSGY 1000

Query: 1023 TNGEWKNLTSEDFNDSLYMGAQLIPLKQTSS--KRDVSNR---ALLVNGDLKHSTYGSVS 1077
            ++G+W+NL  E  N SL     +I +K   +  KR   +    A+LV G   ++ Y   S
Sbjct: 1001 SDGDWQNL--EFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYPQAS 1057

Query: 1078 AMLYDFEDWMPYFI---VDGENAGRASNIFMNKDLSSLYTTQTILQGXXXXXXXXXXXXX 1134
              +Y+F+ W+PY++    D E+  R +  F N+D S LY +Q +L               
Sbjct: 1058 --IYNFQRWLPYYVANKADDEDPSRTT-FFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTT 1114

Query: 1135 XXXXDKNES-----SSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQYEPL 1189
                           S KI+RGFVVLI                         + G YE +
Sbjct: 1115 SSSQTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQV 1173

Query: 1190 KPRVDEGDMIDTVPPEKLMKFV 1211
             PR DE +MIDTVPPEKL+KF+
Sbjct: 1174 DPRADESEMIDTVPPEKLLKFL 1195

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1233 (41%), Positives = 739/1233 (59%), Gaps = 61/1233 (4%)

Query: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73
            L ++   SQL ++K  L+I+D  +P +++S + ++ + +LG  + L+FY YTGQ+NFT  
Sbjct: 14   LVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKE 73

Query: 74   I--TETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQ 131
            I    +   L+YYSN T+I+L+  SD+     I+ I PFG DSFILSG+GT+    ++  
Sbjct: 74   IGPETSSHGLVYYSNNTYIQLEDASDD---TRIDKITPFGVDSFILSGSGTI-NNISVGN 129

Query: 132  QLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEI 191
            Q+LYNLS+L  T IFNQS+  V  +LAD+  +YFGG F Y  G+ TG+S ++W+S +N  
Sbjct: 130  QILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTT 189

Query: 192  QLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSN------SSKNATD 245
            QLLPF GFG +S VNSI++L+NDNI+FAG+F TLDD + L  I  SN      SS NAT 
Sbjct: 190  QLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSAL--ISSSNNGTNSTSSLNATT 247

Query: 246  IEFDQLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKL 303
            +E  Q IPL++A W SQGS      SL+CP+ + D W    T+ G    +L  ++ P+K+
Sbjct: 248  LELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTS-GSLVCNLPYEVSPTKI 306

Query: 304  RIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANV 363
            R+YN+  SD ++S+F+I+T P++ IMNLTYLDP +GEL  C  +CPL S   L  A  NV
Sbjct: 307  RLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNV 366

Query: 364  TISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNG 423
            + S D + +I NN T++KWTS +Q+FAFVNE+ V SL F+AL+SYG SVGL G E+YQ+ 
Sbjct: 367  SSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDT 426

Query: 424  YPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY--DGTGDLPSVNFYP 481
            + T+AND+LN+  C  + + S + T S   W  G    SYI + Y  D    +P V FYP
Sbjct: 427  FSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYP 486

Query: 482  NITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLY 541
            NI + G YT+NM TPGC  D +CS+RGIVNVT+W+Q N+T++ T LIYQNN++ KYD +Y
Sbjct: 487  NIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIY 546

Query: 542  SGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET-------- 593
            SGYL+ +P+I L++   I T ++ +++VAD+V+VI  S+D       T++++        
Sbjct: 547  SGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLD----AFNTLSDSSNAKKETL 602

Query: 594  LNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIA 653
            LNG+ QYQ SNFT+   +  K+GNTT+N + ++N P NS L+A  Y+N L++ G  N I+
Sbjct: 603  LNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRIS 662

Query: 654  VLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNL 713
            ++ LNDD  + S +     G   GI   + GLL  GD   S+ Q +   +NG+F +  N 
Sbjct: 663  IVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQ 722

Query: 714  RTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGA 773
               +    NI++ +++ +V +N Y+ N SSN  IRN+SSF+LSLW+AG+N   D +  GA
Sbjct: 723  SRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGA 782

Query: 774  VSQRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVL 833
            VS  QY  LNG+V   + N I  + L    G   Y   Y+N+S+TAYAY  + DS + + 
Sbjct: 783  VSHMQYGNLNGSVRFLNENEIEPLNLEG--GIVPYLGAYLNESATAYAY--EVDSLNKIY 838

Query: 834  IARGNRSEDLPV-SWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEEN 892
             +    +E  P  +WS  +  M+Y  + +LLAV  +AG +    LS+F++ N  MI  E 
Sbjct: 839  FS----NEVYPSWNWSSGITQMLYADNQTLLAV--SAGSSTTAELSIFDLRNLTMIANET 892

Query: 893  LGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNIT 952
            LG+ + +NA+V F KN S+LVGGDF + + +  C+GLCLYNY +  WS F NN+I G IT
Sbjct: 893  LGSNARINALVNFEKNCSMLVGGDFQMTEPN--CTGLCLYNYESKTWSTFLNNTIFGEIT 950

Query: 953  DLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELI 1012
             L F N ++L+ISG   T+    I L   N+ ++ +  L  GS       +F  T D ++
Sbjct: 951  QLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSE--GKLNSFTVTEDSIV 1008

Query: 1013 TQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPL---KQTSSKRDVSN----RALLVN 1065
              +D  +  Y N EW N+TS   N S       I       T +KR ++N      LL+N
Sbjct: 1009 AWNDTSLFIYRNQEW-NITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLN 1067

Query: 1066 GDLKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRASN-IFMNKDLSSLYTTQTILQGXXX 1124
            G+   S YG + ++L+DF+ W PYFI +  N    +  IF+N+D+S+ + +Q+ L     
Sbjct: 1068 GNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNI 1127

Query: 1125 XXX------XXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXX 1178
                                 K++S   KI RGFVVLI                      
Sbjct: 1128 TVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYV 1187

Query: 1179 XXXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
                +G Y+P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1188 FKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1232 (40%), Positives = 737/1232 (59%), Gaps = 50/1232 (4%)

Query: 11   TYALCQLVTGS---QLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQ 67
            T AL  L  GS   QL S+K  L+I+D  +P +++S   ++ + +LG  + L+FY YTGQ
Sbjct: 8    TLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQ 67

Query: 68   ENFTGSI-TET-EKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPG 125
            +NFT  I +ET  + L+YYSN T+I L+  +DE+    I+ I PFG DSFILSG+G++  
Sbjct: 68   QNFTKEIGSETNSRGLVYYSNNTYILLEE-ADEDTR--IDKITPFGADSFILSGSGSI-N 123

Query: 126  GHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWN 185
            G  L  Q+LYNLS+L    IF QS+ +V  +L +D  VYFGG F Y  G+ TGH  ++W+
Sbjct: 124  GVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWD 183

Query: 186  STTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSK---- 241
            ST+N  QLLPF GFG DS VNSI++L++DNI+FAGKF TLDD+++L     + ++     
Sbjct: 184  STSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTL 243

Query: 242  NATDIEFDQLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLR 299
            NAT +E  Q IPL++A W SQGS   E S L+CP    D W   GT+ G    +L  ++ 
Sbjct: 244  NATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTS-GSLVCTLPYEVA 302

Query: 300  PSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQA 359
            P+K+R+YN+ +SD  +SLF+I+T+P+  IMNLTYLDP +GEL  CD +CPL S + L  A
Sbjct: 303  PTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSA 362

Query: 360  EANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEM 419
              NV+ S D +++I NNNT++KW+S +Q+FAF NE+SV SL F AL+SYG+ VGL G E+
Sbjct: 363  SQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLEL 422

Query: 420  YQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY--DGTGDLPSV 477
            YQ+ + T+AN++LN+  C  + + S +   S  +W  G    SYI   Y  + T   P+V
Sbjct: 423  YQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTV 482

Query: 478  NFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKY 537
             FYP+I + G YT+N  TPGC  D +CSSRGIVNVT+W+  N+T++ T LIYQNNN+ KY
Sbjct: 483  TFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKY 542

Query: 538  DLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTI----NET 593
            D +YSGYL+ +P+I +K+   I   ++ +IMVAD+V++I DS+D      +T     +  
Sbjct: 543  DKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTP 602

Query: 594  LNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIA 653
            LNG+ QYQ SNFT  +++  KI NTT+N +S++N P NS +FA  Y+  L++ G  N I+
Sbjct: 603  LNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHIS 662

Query: 654  VLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNL 713
            V+  ND+L + S +     G   G+   + GLL  GD   S  + + L +NG+F S  N 
Sbjct: 663  VIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNY 722

Query: 714  RTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGA 773
               +    NIT+ +++L+VFNN YIFN SSN  I N++SF+LSLWSAG+N  +D +  GA
Sbjct: 723  SKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGA 782

Query: 774  VSQRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVL 833
            VSQ Q+++L+G+    + +++  + L    G   Y   Y+N+S+ AYAY  K +S   + 
Sbjct: 783  VSQMQFSDLSGSARFLNESTVEALNLNK--GIVPYLGAYLNESTIAYAY--KTNSLSKIY 838

Query: 834  IARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENL 893
             +  N S     +WS+ +  M+Y  + +LL +G+ +  T    LS+ N+ N   I  E L
Sbjct: 839  FSN-NVSPSW--NWSNNITKMVYANNQTLLVIGSESSTT--AELSILNLRNFTTIANETL 893

Query: 894  GAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITD 953
            G+ + +NA V F KNSSLLVGGDF + K +  C+GLC+YNY +  WS F+NN+I G IT 
Sbjct: 894  GSNAKINAFVNFEKNSSLLVGGDFQMSKPN--CTGLCVYNYESKSWSTFFNNTIVGEITQ 951

Query: 954  LQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELIT 1013
            L F N ++L+ISG   TE +  I L   N+ ++ +  L  GS       +F  T + ++ 
Sbjct: 952  LAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSG--GKLNSFTVTEESIVA 1009

Query: 1014 QSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLI-------PLKQTSSKRDVSNRALLVNG 1066
             +D  +  Y + +W N TS   N S       I        L++ ++        LL+NG
Sbjct: 1010 WNDTSLLIYKDQKW-NTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNG 1068

Query: 1067 DLKHSTYGSVSAMLYDFEDWMPYFIVDG-ENAGRASNIFMNKDLSSLYTTQTILQGXXXX 1125
            +     YG++  +L+D ++W PYF  +  E +     IF+N+D+S+ + +Q  L      
Sbjct: 1069 NFSIPQYGNLQGLLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMT 1128

Query: 1126 XX-----XXXXXXXXXXXDKNESSSDK-IDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXX 1179
                              + N+ S  K +DRGFVVLI                       
Sbjct: 1129 VTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVF 1188

Query: 1180 XXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
               +G Y P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1189 KDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1233 (40%), Positives = 737/1233 (59%), Gaps = 58/1233 (4%)

Query: 8    LTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQ 67
            L + Y L  +  GSQLS L++ LN  ++ +P++DL+SS N  + LLGDF+DLTFY+YTGQ
Sbjct: 6    LLSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQ 65

Query: 68   ENFTGSITET--EKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPG 125
            ENFT  +  +     LIYYSN TF++L + S++    DI  I+P G+DSFILSG+G +  
Sbjct: 66   ENFTSPLNSSTDSHGLIYYSNDTFLQLANGSND---TDIKQIVPLGEDSFILSGSGHI-D 121

Query: 126  GHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWN 185
            G+NL++QL YNL+ L +  IF + ++ VN IL D  +VYFGG F ++ G+ TGHSVVLWN
Sbjct: 122  GYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWN 181

Query: 186  STTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLK-QIRGSNSSKNA- 243
            S  N   LLPF GFG +S VNSI+RLD DNI+FAG F  LDD  LL+  I GSN+S +  
Sbjct: 182  SEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKS 241

Query: 244  --TDIEFDQLIPLKHAGWSSQGS-LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRP 300
              TD+E    IPL++A W+S  S  +    ICP  + + W Q GT+ G    SL  +  P
Sbjct: 242  NWTDVELGLAIPLQNANWTSSSSQFDADDFICPDPERESWLQSGTS-GSLACSLPQETTP 300

Query: 301  SKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAE 360
             K+RIYN+   D +VSLFRI+  P  GI+NL+Y+DP+ GEL YCDA+CPL + + LE+A 
Sbjct: 301  YKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAS 360

Query: 361  ANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMY 420
            +N +   +   +  NN T+IKW   +QEFAFVN V + S+ F+AL SYGS+VGL  ++ +
Sbjct: 361  SNSSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFF 420

Query: 421  QNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY-DGTGDLPSVNF 479
            Q+    +AN++LNQP C  + SYS+A T S   W QG    +Y+ ++Y +  G++P V F
Sbjct: 421  QSRASIYANNSLNQPACGKMQSYSNA-TISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTF 479

Query: 480  YPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDL 539
            +P I Y G+Y++ + TPGC GDG+C+ R IVNVT+WD  ++  LS+++IY+NNN+ KYD 
Sbjct: 480  HPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDE 539

Query: 540  LYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQ 599
            L+ G+L+S+PK+TL+++  I  ++ TS++VAD + +   S D  +   K I  TLNG+FQ
Sbjct: 540  LWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDI--TLNGIFQ 597

Query: 600  YQISNFTT-ISNDSLKIGNTTINRYSIENVPSNSELFAGYY-NNTLLVDGAFNGIAVLQL 657
            YQISNFT  I+ +S  IGNT+++ + +    +NS LFA  Y N+TLL+  + +  A ++L
Sbjct: 598  YQISNFTKNITKES--IGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKL 655

Query: 658  NDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNI 717
            + + ++ S +         GI +YS+GL+  GD+N S +Q   LS+NG+F+S+  +  ++
Sbjct: 656  DKNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSV 715

Query: 718  TRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQR 777
             RF NI +  +ELLVF+N + +NVSS  Y+ NT+ F+LS+WSAG N+  D I  GAVS  
Sbjct: 716  ERFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDN 775

Query: 778  QYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARG 837
             Y  L G V +    S  +  +   D    Y   Y+ND+ TAYAY   +DS   ++ + G
Sbjct: 776  DYENLQGPVSLFQNGSAVSSNIK--DNINPYMGAYLNDTLTAYAYKDGSDS--RIVFSNG 831

Query: 838  NRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKS 897
            +     P  W++++ TMIY   D+LLA+GT++  +      L N++ S+++  E L   +
Sbjct: 832  DEG---PWRWTNSIETMIYRNRDALLALGTSSSPSLPQLSVL-NLTTSEVLANETLDKGA 887

Query: 898  SVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFF 957
             VN+++ F KNS+LL+GG+F+    D  C+GLCLYNY   +WS F N+SI+G +T +Q  
Sbjct: 888  EVNSMILFGKNSTLLIGGNFSF--SDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLR 945

Query: 958  NGTQLLISGNLYTENETGINLAKLNMASNEV-TILRHGSTMVQSFVTFDHTTDELITQSD 1016
            N ++LLI+G+L     + +NL  +N+    + T+LR     ++SFV    + D L+  +D
Sbjct: 946  NSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV---SEDRLVVWND 1002

Query: 1017 NEISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRA----------LLVNG 1066
              +  Y N  W+++++   N + +   Q I   Q S +  +  RA          LLV G
Sbjct: 1003 TSLMAYDNTSWRHISTS--NSTSFTKLQDI--HQVSLEHSLEKRANSSSNSNLDGLLVYG 1058

Query: 1067 DLKHSTYG-SVSAMLYDFEDWMPYFIVD--GENAGRASNIFMNKDLSSLYTTQTILQGXX 1123
            + K  T G S  A +YD+  W P FI +   EN+    NIFMN+D+S  + ++ +L    
Sbjct: 1059 NDK--TQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPT 1116

Query: 1124 XXXXXXXXXXXXXXX-----DKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXX 1178
                                DK   +S K+DRG+VVLI                      
Sbjct: 1117 NHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYM 1176

Query: 1179 XXXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
               + G YE L P  +     +T PP K  KF+
Sbjct: 1177 FGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1237 (39%), Positives = 736/1237 (59%), Gaps = 69/1237 (5%)

Query: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73
            L Q    SQL ++K  L+I+D  +P +++S   ++ + +LG  + L+ Y YTGQ+NFT  
Sbjct: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKE 73

Query: 74   ITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGT---LPGGHN 128
            I+     + L+YYSN T+I+++  SD+     I+ I PFG DSFILSG+GT   +P G+ 
Sbjct: 74   ISPGTNSRGLVYYSNNTYIQVEDASDD---TRIDKITPFGADSFILSGSGTINNMPIGN- 129

Query: 129  LEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTT 188
               Q+LYNLS+L    IF+Q + +V  +L +   VYFGG F Y  G+ TGHS ++W+S +
Sbjct: 130  ---QILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSIS 186

Query: 189  NEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSK-----NA 243
            N+ QLLPF GFG +S VNSI++L++DNI+FAGKF TLDD++ L     +N++      NA
Sbjct: 187  NKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNSTSLLNA 246

Query: 244  TDIEFDQLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPS 301
            T +E  Q IPL++A W  QGS   E +SL+CP+ + D W    T+ G     L  ++ P+
Sbjct: 247  TKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATS-GTLVCKLPYEVSPT 305

Query: 302  KLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEA 361
            K+R+YN+ DSD ++S+F+I+T+P+N IMNLTYLDP +G+L  CD +CPL S   L  A  
Sbjct: 306  KVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQ 365

Query: 362  NVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQ 421
            NV+   D ++++ NNNT++KW+S +Q+FAF NE+ V  L F A++SYG SVGL G E+YQ
Sbjct: 366  NVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQ 425

Query: 422  NGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGD--LPSVNF 479
            + + T+AN++LN+  C  + + S + T S   W  G    SYI + Y    D   P VNF
Sbjct: 426  DTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPTPRVNF 485

Query: 480  YPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDL 539
            YPNI + G Y +N  TPGC  D +CSSRGIVNVT+W+  N T++ T  IYQNN++ KYD 
Sbjct: 486  YPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQ 545

Query: 540  LYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET------ 593
            +YSGYL+ +P+I L++   I+T ++ +++VAD+V+VI   +D       T++E+      
Sbjct: 546  IYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLD----AFSTLSESANTKEY 601

Query: 594  --LNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNG 651
              LNG+ QYQ SNFT+ +++  KIGNTT+N ++++N P+NS LFA    + L++ G  N 
Sbjct: 602  IPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNH 661

Query: 652  IAVLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFG 711
            I+++ LND+L ++  ++    G   G+   S GLL  GD   S+ Q S L +NG+F +  
Sbjct: 662  ISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVF 721

Query: 712  NLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILV 771
            N    +    NI++ +++L+VF+N YI N SS+  I N++SF+LSLWSAGSN  +D +  
Sbjct: 722  NYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFS 781

Query: 772  GAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRV-YTATYINDSSTAYAYSSKNDSTH 830
            GAVS+ Q+  LNG+      + +  + L   D   V Y A Y+N+S+TAYAY +      
Sbjct: 782  GAVSRMQFGGLNGSARFLSEDKVQALNL---DNAVVPYLAAYLNESTTAYAYETN----- 833

Query: 831  HVLIARGNRSEDLPVS--WSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMI 888
              L+ +   S ++  S  WS ++  M+Y  + SLL VG+ +  T    LS+FN+ N  MI
Sbjct: 834  --LLNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTT--AELSIFNLKNFTMI 889

Query: 889  GEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSIS 948
              E +G+ + +NA+V F KNSSLLVGG+F + K +  CSGLCLYNY +  WS F+NN+  
Sbjct: 890  ANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPN--CSGLCLYNYESKSWSTFFNNTFF 947

Query: 949  GNITDLQFFNGTQLLISGNLYTENETGINLAKLNMA-SNEVTILRHGSTMVQSFVTFDHT 1007
            G IT L F   +QL+ISG   TE    + LA  N+  S  + +L      + SFV    T
Sbjct: 948  GEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVV---T 1004

Query: 1008 TDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLI-------PLKQTSSKRDVSNR 1060
             + ++  +D  +  Y + EW N+TS   NDS       I        L + ++    +  
Sbjct: 1005 EESIVAWNDTSLLIYRDQEW-NITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGT 1063

Query: 1061 ALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGEN-AGRASNIFMNKDLSSLYTTQTIL 1119
             LL++G+     YG++  +L+DFE W PYF+ +  N + R   IF+N+D+S+ + +Q  L
Sbjct: 1064 ILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPL 1123

Query: 1120 QGXXXXXX-----XXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXX 1174
                                    +    S  +IDRGFVVLI                  
Sbjct: 1124 SNLNVTETGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVI 1183

Query: 1175 XXXXXXXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
                    +G Y+P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1184 LAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1231 (40%), Positives = 729/1231 (59%), Gaps = 57/1231 (4%)

Query: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73
            L Q    SQL ++K  L+I+D  +P +++S + ++ + +LG  + ++FY+YTGQ+NFT  
Sbjct: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFTKG 73

Query: 74   ITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQ 131
            I+       L+YYSN T+I+L+  SD+     I+ I PFGDDSFILSG+GT+    ++  
Sbjct: 74   ISPGTNSHGLVYYSNNTYIQLEDASDD---TRIDKITPFGDDSFILSGSGTI-NNISVGN 129

Query: 132  QLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEI 191
            Q+LYNLS+L    IFNQS+  V  +L +D  VYFGG F Y  G+  GHS ++W++ ++  
Sbjct: 130  QILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDTA 189

Query: 192  QLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLL--KQIRGSNS--SKNATDIE 247
            QLLPF GFG +S VNSIL+L++DNIVFAGKF TLDD+++L      G+NS  S NAT +E
Sbjct: 190  QLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTFSLNATKLE 249

Query: 248  FDQLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRI 305
              Q I L++A W SQGS  L  +SL+CP+D+ + W    T+ G    +L  ++ P+K+R+
Sbjct: 250  LGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATS-GSLVCNLPYEVSPTKIRL 308

Query: 306  YNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTI 365
            YN+ D+  +++LF+I+T+P++ IMNLTYLDP +GEL  CD +CPL S   L  A  N + 
Sbjct: 309  YNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASS 368

Query: 366  SSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYP 425
            S D + +I  NNT++KW+S +Q+FAF NE+ V SL  +AL+SYG S+GL G E+YQN + 
Sbjct: 369  SMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFS 428

Query: 426  TFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY--DGTGDLPSVNFYPNI 483
            T+AN++LN+  C  + + S +   S   W  G    SYI + Y  D    +P V FYPNI
Sbjct: 429  TYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPNI 488

Query: 484  TYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSG 543
             ++G YT+N  TPGC  D +CSSRGIVNVTVW+  N+T++ T  IYQNN++ KYD ++SG
Sbjct: 489  IHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSG 548

Query: 544  YLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQ----SKIGLKTINETLNGLFQ 599
            YL+ +P+I L++   I + ++ +++VADRV+VI  S+D     S+I        LNG+FQ
Sbjct: 549  YLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQ 608

Query: 600  YQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLND 659
            YQ SNFT  +++  K+GNTT+N + + N P N+ L    YN+ L+V G  N I+ + LN+
Sbjct: 609  YQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLNE 668

Query: 660  DLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITR 719
            +  I S +     G   GI     GLL  GD   S  Q + L +N +F    N    +  
Sbjct: 669  NFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVNS 728

Query: 720  FNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQY 779
              NI+I D+EL VF+N YI N SSN  I N++SF+LSLW+AG+N   D +  G VS  ++
Sbjct: 729  ATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFSGTVSHMEF 788

Query: 780  TELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIA-RGN 838
            + LNG+    + + +  + +    G   Y   Y+N+S +AYAY +  D+ + +  + + N
Sbjct: 789  SNLNGSASFKNEDQVQALNIGR--GIVPYFGAYLNESVSAYAYET--DALNKIYFSNKVN 844

Query: 839  RSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSS 898
             S +    WS+ +  M+Y  + ++L V + +  T    L++FN+ N   I  E LG+ + 
Sbjct: 845  PSWN----WSNTITRMLYANNQTMLVVSSESSST--ADLTIFNLRNMTTIANETLGSNAK 898

Query: 899  VNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFN 958
            V+A+V F KNSS+LVGGDF I K +  CSGLCLYNY    WS F+NN+I G +T L   N
Sbjct: 899  VSALVNFEKNSSILVGGDFQITKPN--CSGLCLYNYETKSWSTFFNNTIFGEVTQLSLAN 956

Query: 959  GTQLLISGNLYTENETGINLAKLNMASNEVTILRHGST-MVQSFVTFDHTTDELITQSDN 1017
             ++L+ISG   T     I L   N+ +  +  L  GS   + SFV  D++   L+  +D 
Sbjct: 957  SSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNS---LVAWNDT 1013

Query: 1018 EISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRA----------LLVNGD 1067
             +  Y N +W N+TS   +DSL      I    T++K D  N+           LL+NG+
Sbjct: 1014 SLFIYGNQKW-NITSLPSDDSLIGSVSTI---STNTKSDTLNKRATNNAHDGSILLLNGN 1069

Query: 1068 LKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRAS-NIFMNKDLSSLYTTQTILQGXXXXX 1126
                 YG++ ++L+DF+ W PYFI +  N+   +   F+N+D+S+ + +Q  L       
Sbjct: 1070 FTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITV 1129

Query: 1127 X------XXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXX 1180
                               K++S   KIDRGFVVLI                        
Sbjct: 1130 TNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFK 1189

Query: 1181 XNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
              +G Y+P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1190 DPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1223 (38%), Positives = 732/1223 (59%), Gaps = 21/1223 (1%)

Query: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60
            M A   + T+  AL +  +GS L +L+ KL ++   IP +DLS S N+E+ LLG+F+D+ 
Sbjct: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60

Query: 61   FYRYTGQENFTGSIT-ETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSG 119
              +Y+GQ+NFTG ++   E  LIYYSN TF+++ S SD +    ++HI+PF DD+FILSG
Sbjct: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSG 120

Query: 120  TGTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGH 179
             G++  GH L +QLL+NLSSLE+  IF Q ++ VN I A+ + V+FGG F+Y + N T H
Sbjct: 121  AGSI-SGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIH 179

Query: 180  SVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNS 239
            S+++W+S  + +++LPF GFG +S VNSIL LDN NI+FAG F+ +D+   L  I  SN+
Sbjct: 180  SLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNT 239

Query: 240  SKNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLR 299
            S N +  E    I L+ A W S G+L+ S++ CPS +S GW + G+  G F + +  + R
Sbjct: 240  S-NTSVPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETR 298

Query: 300  PSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQA 359
            PSKLR++NA DSD QVSLFRI+T+P+NGIMNLTYLDP TGEL+ CDAWCPLLS++ L   
Sbjct: 299  PSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI 358

Query: 360  EANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEM 419
             +  +   D V Y   N T ++W+ ++Q+FAFVN V V  LTF+ALDSYGSSVGL G E+
Sbjct: 359  SSK-SYPGDQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIEL 416

Query: 420  YQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNF 479
            Y++ Y  +AN+TLN PNC   ++ S+A+ S+   W  GS + +Y+ ++   +   P V F
Sbjct: 417  YESAYSVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSETNPFVIF 476

Query: 480  YPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDL 539
            YP+I Y G YT++++TPGC  D SC +RGI+N T+ D  N+T+L +  IYQNN+ EK+D 
Sbjct: 477  YPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDT 536

Query: 540  LYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQ 599
            LYSG+L+S  K+TL+F  +IN+ +   +MVA ++ V I+  DQS     T +  +NGL  
Sbjct: 537  LYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNT-SGFINGLLH 595

Query: 600  YQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLND 659
            Y  SN ++  ++      T +  YS+  +P +S +FA  + + L++      +A L+L +
Sbjct: 596  YSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLAN 655

Query: 660  DLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITR 719
            +L+I        G     I+ YS GL+ +G FN SS+  +   +NGTF +     + +  
Sbjct: 656  NLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEP-AARGFNGTFFNLTEFNSTVRT 714

Query: 720  FNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQY 779
            F+N+T+  +E+L+F+   I N ++ E I +TS   L + SAG N   D +  G V Q  Y
Sbjct: 715  FSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDY 774

Query: 780  TELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNR 839
            T LNG+ +I+  +   +    +  GK  Y A ++++S+TAYAY + +++++   ++  N 
Sbjct: 775  TNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMND 834

Query: 840  SEDLP--VSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKS 897
            S       +WS  V  M  +K+DSLLA+G     T+ + L + N S+ + +      ++ 
Sbjct: 835  SGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTD-SQLLVTNSSSGESLASYKWDSEI 893

Query: 898  SVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFF 957
            S+N+I+ F +N+S+LVGG F +  ++T CSGLCL+NY   KWS F NNSI G I  ++ F
Sbjct: 894  SLNSIIFFARNNSVLVGGSFRV--NNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIF 951

Query: 958  NGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDN 1017
            N + LLI+G+       G++LA + +  +   IL  G+  +  FV+ D +++ ++  SD 
Sbjct: 952  NNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDT 1011

Query: 1018 EISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTS--SKRDVSNRALLVNGDLKHSTYGS 1075
             +    +G+W+ +++    +S + G  + PLK T+   KRD S++ LL+ G L+H+ +GS
Sbjct: 1012 SLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGS 1071

Query: 1076 VSAMLYDFEDWMPYFIVDGENAG---RASNIFMNKDLSSLYTTQTILQGXXXXXXXXXXX 1132
            ++A  YD  +W P+   +   +      S++F+N+DLS     +  LQG           
Sbjct: 1072 INAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTS 1131

Query: 1133 XXXXXXDKN----ESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQYEP 1188
                    +    +    KIDRGF+VLI                         +   Y+ 
Sbjct: 1132 GTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQL 1191

Query: 1189 LKPRVDEGDMIDTVPPEKLMKFV 1211
             KPR DE +MIDTVPPEKLM+F+
Sbjct: 1192 SKPRTDENEMIDTVPPEKLMRFI 1214

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1222 (38%), Positives = 730/1222 (59%), Gaps = 32/1222 (2%)

Query: 7    ILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTG 66
            + T+   + +L +G+ L++++  L +++  +P +DLS S N+E+ LLG+F++L +YRYTG
Sbjct: 7    LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTG 66

Query: 67   QENFTGSITETEKD-LIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPG 125
            Q+NFTG   E  ++ LIY+SNGT ++L S    N +  ++H+IP  DDSFILSGTG + G
Sbjct: 67   QDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISG 126

Query: 126  GHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWN 185
               L+ Q+++NLS L YTAIFNQS+S VN I  +    YFGG F++   +   H +++W+
Sbjct: 127  AV-LDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWD 185

Query: 186  STTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATD 245
               NE++ LPF G G DS VNSIL LD++NI+FAG F+T+D+ + L    G NS+ ++  
Sbjct: 186  FVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAP 245

Query: 246  IEFDQLIPLKHAGWSSQGSLEHSSLICPSDDS-DGWFQEGTATGDFTVSLLTDLRPSKLR 304
             E    IPLK A W+S GSL+   L+CPS+ +   W   GT TG F +S+   +RPSKLR
Sbjct: 246  -ELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGT-TGQFELSIAHTIRPSKLR 303

Query: 305  IYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVT 364
            ++NA   D +VSLFR+IT+P+NGIMNLTYLDP +GEL  CDAWCPLLST+ L  A++   
Sbjct: 304  LHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAA 363

Query: 365  ISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGY 424
             S+D V ++ NN T ++W+ +YQ+FAFVN V V S+TF+ALDSYGSSVG++GFE+Y++ +
Sbjct: 364  -STDQVEFL-NNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDF 421

Query: 425  PTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFYPNIT 484
              +AND+ N P+C + ++YS A  S+  QW QGS D  Y+ +  + + + PSV FYP I 
Sbjct: 422  SVYANDSFNVPDCSSTSNYSKASLSA-SQWDQGSSDEDYVYTLVENSQEAPSVTFYPQIV 480

Query: 485  YAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGY 544
            Y+G YT+N++TPGC  DGSC SR +VN ++WD  N T+LS+  IYQNN+ EKYD LYSGY
Sbjct: 481  YSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGY 540

Query: 545  LESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQYQISN 604
            LE+  K+ L++  +I     + +MVA ++ V  D  D S    K     LNGL  Y +SN
Sbjct: 541  LENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHYSLSN 600

Query: 605  FTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNII 664
             ++   +     +T + +YS+ N   NS  F   + N +++  +   ++ L+++   ++ 
Sbjct: 601  SSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVR 660

Query: 665  SEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFNNIT 724
            +      G    G+  +S GL  +G F+ S++      YNG+F       +N+T F N T
Sbjct: 661  TVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAKF--YNGSFFDIPLSHSNVTTFTNFT 718

Query: 725  IDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNG 784
            +D +EL+   N Y  N +++   RN+S   L+  SAG N+  + +  G++++ +YT+LNG
Sbjct: 719  LDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNG 778

Query: 785  AVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAY---SSKNDSTHHVLIARGNRSE 841
            +     +NS S+  L    G+  Y ATYI++S+T YA+   SS N S    +     +  
Sbjct: 779  SF-FISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKER 837

Query: 842  DLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNA 901
            DL   W++ V +M+Y+K+ SLLA+G    +T    L L N++  +           S+N+
Sbjct: 838  DLSYRWTNMVGSMLYSKNSSLLALGMK-NETRSPQLLLTNLTTGEDTATFEWKTNVSINS 896

Query: 902  IVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQ 961
            ++ F++N+S+LVGGDF  ++ +++CSGLCL++Y    WS F++N I+G+I  ++ FN + 
Sbjct: 897  LIFFDQNTSVLVGGDF--NESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSS 954

Query: 962  LLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEISY 1021
            L++ G     +   +NLA +++      IL  G+  +  F+  D   D L+  S N++  
Sbjct: 955  LVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFR 1014

Query: 1022 YTNGEWKNLTSEDFNDSLYMGAQLIPLKQ--TSSKRDVSNRALLVNGDLKHSTYGSVSAM 1079
             TN  W++++++  + S++ G    P++Q   + KR+    +LL+ GDL H TYG +SA 
Sbjct: 1015 LTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAA 1074

Query: 1080 LYDFEDWMPYF------IVDGENAGRASNIFMNKDLSSLYTTQTILQ----GXXXXXXXX 1129
            LYDF DW+PYF        DG    R   I+ NKD+SS +  Q +LQ    G        
Sbjct: 1075 LYDFNDWIPYFSTTPATSTDGLGQSR---IYSNKDISSAFNYQGVLQSSRGGNSSSVPSG 1131

Query: 1130 XXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQYEPL 1189
                      +  +  +KI RGFVVLI                         +  +Y+ L
Sbjct: 1132 TSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSL 1191

Query: 1190 KPRVDEGDMIDTVPPEKLMKFV 1211
            +PR DE +MIDTVPPEKLM+F+
Sbjct: 1192 EPRADESEMIDTVPPEKLMRFI 1213

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1231 (41%), Positives = 744/1231 (60%), Gaps = 62/1231 (5%)

Query: 20   GSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSI--TET 77
             SQL+++K+ L I  ++IPQI+  ++ N+E+ +L + E LTFY+Y GQ+NFTGSI     
Sbjct: 19   ASQLTNVKDSLGINTVNIPQINFGNT-NNEIQILSNIEGLTFYQYQGQQNFTGSIDTNSN 77

Query: 78   EKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNL 137
               LIYYSN T IKL   SD      I+ I+P  +D+FILSG+GTL GG  LE QLLYNL
Sbjct: 78   THGLIYYSNDTLIKLLEGSDN---TKIDQIVPLDEDAFILSGSGTL-GGFQLENQLLYNL 133

Query: 138  SSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFK 197
            S L    +FN  +  +  IL D +IVYFGG F YT  N T +S++ WN  T  + +LPF 
Sbjct: 134  SDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFI 193

Query: 198  GFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLL-------KQIRGSNSSKNATDIEFDQ 250
            GFG +S VNSIL+LD DN++F G F+TLDD +LL        Q   ++SS   T++E +Q
Sbjct: 194  GFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQ 253

Query: 251  LIPLKHAGWSSQGSLEHSS-LICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAF 309
             I LK+A W+S G L+ S+  ICP+  ++ W   GT TG+ T +L  +   SK+RI+N+ 
Sbjct: 254  QISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGT-TGEITCNLAFEASLSKIRIFNSP 312

Query: 310  DSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDS 369
                Q++ FRI+T+P+NGIMNLTYLDP T E+ YCDA+CPL S+  L+ +  N T S+ +
Sbjct: 313  YEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSAST 372

Query: 370  VAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFAN 429
             A+I  N TNI W++ YQEFAFVN+V V +L  +AL SYG +VGL GF++YQN Y  FAN
Sbjct: 373  SAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFAN 432

Query: 430  DTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPS--VNFYPNITYAG 487
            ++LN+P CD+ N+   +   S   W QG    SYI + Y   GD PS  VNFYP+I   G
Sbjct: 433  NSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYT-PGDDPSPLVNFYPSINRIG 491

Query: 488  DYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLES 547
            +YT+N+ TPGCTGDG+CS RGIVNVT+WD   + ++ST LIYQNNN+ KYD L+ G+L+ 
Sbjct: 492  NYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDY 551

Query: 548  APKITLKFYESINTDSSTSIMVADRVDVIIDSID-QSKIG-----LKTINETLNGLFQYQ 601
            APK+TL++Y  IN ++S  ++VAD VD++  +I+    IG      + +   LNG+FQYQ
Sbjct: 552  APKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQ 611

Query: 602  I-SNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDD 660
            + +  ++ +N +LK+ NT++N + +    S+  L+   YN TLL+ G+  G+  L L++ 
Sbjct: 612  LSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNY 671

Query: 661  LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRF 720
             NI S + + TGG   G   Y+ G++  G+FN+S++ +S+LSYNGTF SFGN+ +NI  F
Sbjct: 672  TNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNVNSNIATF 731

Query: 721  NNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYT 780
            +N+T  +SE+L FNN Y FN S++ YI NTS+ +LS+WSAGSN   D +  G +++ ++ 
Sbjct: 732  SNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFP 791

Query: 781  ELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRS 840
             LN +  +    +  ++ L   +G + Y   Y+NDS TAY Y S ++S  ++L + G + 
Sbjct: 792  NLNNSAVLTGNGTAQSLQLR--NGIQPYLGVYLNDSLTAYLYDSSSNS--NILFSNGLQG 847

Query: 841  E-DLPVSWSHAVNTMIYNKDDSLLAVGTNA--GDTNGTSLSLFNISNSKMIGEENLGAKS 897
              +LP S S A     Y  D+  + VG++   GD+ G  L + N +   ++  E     S
Sbjct: 848  NWNLPRSVSSA-----YYSDNETMFVGSSLSNGDS-GAELFVLNFTTMDLLYNETFDVNS 901

Query: 898  SVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFF 957
            S+N+IV+F +NSSLLVGGDFT    +T+CS LCL N   ++WS+F +N   G IT L+F 
Sbjct: 902  SINSIVSFGRNSSLLVGGDFT--APNTNCSNLCLLNLGNNQWSSF-SNKFDGTITGLEFA 958

Query: 958  NGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDN 1017
            N ++LLISG+   EN++GI+L  +++ + E   L   S  V S   F++    ++    +
Sbjct: 959  NDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNS---FNYNNGTIVAWDSS 1015

Query: 1018 EISYYTNGEWKNLTSEDFNDSLYMGAQLIPLK------QTSSKRDVSNRALLVNGDLKHS 1071
             I  Y    W N    + N S  +    I  K        ++  ++++  +LV G+L   
Sbjct: 1016 TIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSE 1075

Query: 1072 TYGSVSAMLYDFEDWMPYFIVDGENAGRAS--NIFMNKDLSSLYTTQTILQGXXXXXXXX 1129
             YG V AM YDF++W+PY+I    ++   S  ++FMNKD+S LY +Q +LQ         
Sbjct: 1076 DYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISIS 1135

Query: 1130 XXXXXXXXXD---------KNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXX 1180
                               KN +   KI RG+VVLI                        
Sbjct: 1136 STSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFS 1195

Query: 1181 XNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
             +KG+Y  +KPR+DE +M+DTVPPEKLMKF+
Sbjct: 1196 DDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1216 (40%), Positives = 722/1216 (59%), Gaps = 45/1216 (3%)

Query: 13   ALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTG 72
             L  +V GSQLS++++ LNI     P  D     + ++  + +FE+LT   YTGQ+NFT 
Sbjct: 13   VLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTGQQNFT- 66

Query: 73   SITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQ 132
             +   E  L+YYSN TF+KL   S E     +  I+P  +DSFILSGTG +  G  LEQQ
Sbjct: 67   -VQANESSLLYYSNDTFVKLFETSPETT---VTMIVPLFEDSFILSGTGQI-NGVALEQQ 121

Query: 133  LLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQ 192
            +L NL+SL  + IF  ++  V DIL  +E V F G F  ++ N TGH  VLW+   N  +
Sbjct: 122  ILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTE 181

Query: 193  LLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQI-RGSNSS-KNATDIEFDQ 250
            L PFKGFG +S+VNS+++L++DNI+FAG F  + + +LL++    +NSS ++ T ++FDQ
Sbjct: 182  LFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFDQ 241

Query: 251  LIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFD 310
             +PLK +  + + +++   L+CPS   +GW             L  ++ PSK+RIYN+ +
Sbjct: 242  SVPLKLSSITGE-NVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVE 300

Query: 311  SDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSV 370
             + ++SLFRIIT P+NGIMNLTYLDP +GEL  CDAWCPLLS E L Q   N T +  SV
Sbjct: 301  ENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSV 360

Query: 371  AYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFAND 430
              I NN+TN+KW+ +YQEFAFVN++ V  L F+AL SYGS+  L   E+++  +  +AN+
Sbjct: 361  G-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANN 419

Query: 431  TLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFYPNITYAGDYT 490
            + N+PNC+++  YS A  SS   +T    D +YI +  D   ++P V F+PNITY G YT
Sbjct: 420  SYNEPNCESVTEYSKAELSSDNWYTTDESD-TYISTNID--DNIPYVTFHPNITYPGRYT 476

Query: 491  LNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPK 550
             N+ TPGC  D SCS RGIVNVT+ D+  + VL++ LIYQ NN++K+D LY+G L SAP+
Sbjct: 477  FNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPE 536

Query: 551  ITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQYQISNFTTISN 610
            I + + ++I    S S+MV DR+ VI + ID   I        LNGLFQY  +N T    
Sbjct: 537  IIVTWDKAIG--ESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTA--- 591

Query: 611  DSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNIISEQRMG 670
             S+   N T N Y++ N P ++ L+A   NN +L+ G FNGIA ++LND+  I S Q++G
Sbjct: 592  -SIFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLG 650

Query: 671  TGGPTEGINTYSNGLLFLGDFNLSS-QQISTLSYNG-TFSSFGNLRTNITRFNNITIDDS 728
            T G T GI  YSNGLL  G + + +  +   LSY+G  F+SFG L   I R  N TID  
Sbjct: 651  TSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGH 710

Query: 729  ELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYI 788
            ELL+F+N YIFNVS+N Y+ N+S+F ++  SAG NS  D +L G+  +R   ELNG   +
Sbjct: 711  ELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASL 770

Query: 789  NDANSISTIGLPSFDGK-RVYTATYINDSSTAYAYS--SKNDSTHHVLIARGNRSED-LP 844
            +    +S+  LP      + Y A YIND+S AYA    S ++  H VLI   N S   L 
Sbjct: 771  SSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQ 830

Query: 845  VSWSHAVNTMIYNKDDSLLAVGTNAGDTNG---TSLSLFNISNSKMIGEENLGAKSSVNA 901
            + WS  +N  +Y+   ++LA+GTN  +++       S+ N++  + +   N      VN+
Sbjct: 831  IQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERVNS 890

Query: 902  IVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFN-GT 960
            +V+F+ N+S+LVGG + ID    +C+ LCLYNY   +W++F N+SI+G+I  +QF + G 
Sbjct: 891  MVSFSSNNSILVGGSYEID----NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946

Query: 961  QLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEIS 1020
             LL+ G + T NE+ I L  + + SN  + ++ G+  + SFV  D +TD +I Q ++EI 
Sbjct: 947  TLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEIL 1006

Query: 1021 YYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAML 1080
               +G W +   +  NDS+  G +++   + S KRD  +  +L+ G L  S +G++++++
Sbjct: 1007 RLESGTWSSFGPQLNNDSIVSGFKVLSGTE-SKKRDEGSHIVLLEGTLNSSEWGNLTSVV 1065

Query: 1081 YD--FEDWMPYFIV---DGENAGRASNIFMNKDLSSLYTTQTILQGXXXXXXXXXXXXXX 1135
            YD   + W PYF++     + +  +S+ F N +   L ++QT+LQ               
Sbjct: 1066 YDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVLQSNNSDTSASSTPTPS 1125

Query: 1136 XXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQYEPLKPRVDE 1195
                 + +   KIDRGF+VLI                         N G YE LKPR+++
Sbjct: 1126 TTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNG-YESLKPRINQ 1184

Query: 1196 GDMIDTVPPEKLMKFV 1211
             +M+DTVPPEKLMKF+
Sbjct: 1185 DEMLDTVPPEKLMKFI 1200

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1225 (40%), Positives = 715/1225 (58%), Gaps = 53/1225 (4%)

Query: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73
            +  L  GSQ++ +    NI   + P +DLS+  N ++ +  DF+   +Y Y GQ+ FTG 
Sbjct: 14   VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGL 73

Query: 74   ITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQL 133
              E +  LIYYSN T+++L  L D    A+I  I+P+GDDSFILSG G   G H LE QL
Sbjct: 74   ADERKNSLIYYSNNTYVQLAELPD---GAEIKKIVPWGDDSFILSGRGVFEG-HRLEHQL 129

Query: 134  LYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQL 193
            +YNLSS E T I  + +  VNDIL D E+VYFGG F Y  GN +GHSVV W++T     L
Sbjct: 130  IYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSL 189

Query: 194  LPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS--KNATDIEFDQL 251
            LPF GFG  SVVN+I++LD+ NI+F GKF+T+D+  LL   R  +SS   N+T+IE + L
Sbjct: 190  LPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPH-RNVSSSFLSNSTNIETNAL 248

Query: 252  IPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDS 311
              L+ +     G+L  S+ +CP   +D W    +  G+ T+ ++  + PSK+RIYN+ DS
Sbjct: 249  ASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDS 308

Query: 312  DYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVA 371
            + QV+LFRI+TSP+  IMN+TY+DP TG L+ CDAWCPL    +L     N T SS   A
Sbjct: 309  NNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENST-SSVMAA 367

Query: 372  YIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDT 431
            +  NNN  +KWT+AYQEFAFVN V ++ LTF+A+DS+G +VGL G E++Q  Y T+ N+T
Sbjct: 368  FPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNT 427

Query: 432  LNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFYPNITYAGDYTL 491
            LNQPNCD+  ++  +V S    W QG  D SY+ +++  T   PSV   P+I Y G YTL
Sbjct: 428  LNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSF--TAGKPSVTLTPSIPYPGIYTL 485

Query: 492  NMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKI 551
            N+VTPGC  D +C+ RGIVNVT+  Q N T L  + IYQNN + KYD L+ GYL+ +P +
Sbjct: 486  NLVTPGCLTDNTCAFRGIVNVTIRAQ-NGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNV 544

Query: 552  TLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINET-LNGLFQYQISNFTTISN 610
             L++   I+  ++ ++MVADRV  IIDSI+  ++   T N   LNGLFQY  SNFT  +N
Sbjct: 545  VLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAASNFTN-TN 603

Query: 611  DSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLV-DGAFNGIA-VLQLNDDLN--IISE 666
             S  +G+T I++Y + N+P +S LF   YN+TL +   + +G+A + +  DD N  I+  
Sbjct: 604  LSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDP 663

Query: 667  QRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITRFN--NIT 724
            Q + T GP  GI  YSNGL      N  +   S+LS+NG+ S+    R+N    +  N+T
Sbjct: 664  QLIDTEGPVTGIFPYSNGLALTVHSN-QTNMASSLSFNGSISTI--FRSNAPSLSILNLT 720

Query: 725  IDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNG 784
            ID SE+LVF+N Y++NVSS   I N+ +  LSL SAG+N ++D IL G V   ++   NG
Sbjct: 721  IDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNG 780

Query: 785  AVYIN-DANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKN-DSTHHVLIARGNRSED 842
            A+ I+ D+N + T GLPS D   +Y   +INDSS+AYAY SK+  S+   ++  G    +
Sbjct: 781  AIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPE 840

Query: 843  LPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAI 902
               +    VN M+Y KD +LLAV T+       SL + ++S      +E       +N +
Sbjct: 841  YLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTM 900

Query: 903  VAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQL 962
            V F +N +LLVGG FT +     C  LCLYNY  + W+ F + +I+G+I  LQF +G  L
Sbjct: 901  VLFGRNYTLLVGGTFTRN----GCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTL 956

Query: 963  LISGNLYTENETGINLAKLNMASNEVTILRHGST--MVQSFVTFDHTTDELITQSDNEIS 1020
            +++G L + +   + L ++++++ E+     G+     Q  +T  +++ ELI    N++ 
Sbjct: 957  MVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVF 1016

Query: 1021 YYTNGEWKNLTSEDFNDSLYMGAQLIPL----KQTSSKRD-VSNRALLVNGDLKHSTYGS 1075
            ++ +G+WKN++ +    +   G  L+      + +  KRD V N  +++NG+     YG 
Sbjct: 1017 HFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGD 1076

Query: 1076 VSAMLYDFEDWMPYFIVDGENAGRASN---------IFMNKDLSSLYTTQTILQGXXXXX 1126
            ++AM YDF  W PY+     +  R SN         +F+NKD+S   ++Q  L       
Sbjct: 1077 INAMYYDFNGWNPYYF----SVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDNDND 1132

Query: 1127 XXXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQY 1186
                          +E  + K+ + FVVL                          +   Y
Sbjct: 1133 DTPAASEPAT----HEKHTKKLAKIFVVL-IALALALATVAVLGVVGVLFAYLFGDHNAY 1187

Query: 1187 EPLKPRVDEGDMIDTVPPEKLMKFV 1211
            EPLKPR++E +M+ TVPPEKLMKF+
Sbjct: 1188 EPLKPRINEAEMLKTVPPEKLMKFI 1212

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1231 (39%), Positives = 727/1231 (59%), Gaps = 52/1231 (4%)

Query: 8    LTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQ 67
            L   ++L    T S LS++ + LNIQ+  +P ++ +++ N  + LLGD E+L FY Y GQ
Sbjct: 10   LVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQ 68

Query: 68   ENFT---GSITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLP 124
            +NFT    S   +  +LIYYS+   I+L+  S++    DI  IIP GDDSF+LSG+G L 
Sbjct: 69   QNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSND---TDIQKIIPVGDDSFVLSGSGHL- 124

Query: 125  GGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLW 184
             G+ L +QLLYNL++L    IF+Q +  +  IL D+EIVYFGGEF Y   +    SV+ W
Sbjct: 125  NGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISW 184

Query: 185  NSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSN------ 238
            N T++E+  LPF+GFG DS VNSIL+L++DNI+F G F+TL +++LL     SN      
Sbjct: 185  NMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTN 244

Query: 239  SSKNATDIEFDQLIPLKHAGW-SSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTD 297
            S++N++ I+ +Q I LK+A W +     + ++ +C +  S+ W  EG + G+  ++    
Sbjct: 245  STENSSTIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRS-GNLQLNFPNT 303

Query: 298  LRPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLE 357
            + PSK+RIYNA  ++  VSLFRI+TSP+NGIMNLTY+DP TG+L YCDA+CPLL++  LE
Sbjct: 304  VSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLE 363

Query: 358  QAEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGF 417
             A +N T  +    +I NN T++ W+ +YQEFAF+N + V +LT +A DSYGS   L G 
Sbjct: 364  TASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGI 423

Query: 418  EMYQNGYPTFANDTLNQPNCDNINS--YSHAVTSSKQQWTQGSMDSSYILSTYDG-TGDL 474
            E++Q+ +  +AN+TLNQP CD  ++  +S +V  S   W +G    SYI + Y   +  L
Sbjct: 424  ELFQDSHTAYANNTLNQPGCDTESTSLFSSSVL-SDNGWYKGLDSDSYIAANYQSDSSPL 482

Query: 475  PSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNND 534
            P+V FYPNI   GD+++ M TPGC  DG+C SR IVNVTV D  + TVLST+LIYQNNN+
Sbjct: 483  PTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNE 542

Query: 535  EKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKI----GLKTI 590
             KYD +++G L  +P+ITL FY +I  D  ++I+VADRVD+    I+   I     LK+ 
Sbjct: 543  MKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKST 602

Query: 591  NETLNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFN 650
            +  LNGLFQYQ+SNFT  S+   K+GN +I++ ++   PS+  L    +NN++ + G+ +
Sbjct: 603  SLKLNGLFQYQLSNFT--SDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTS 660

Query: 651  GIAVLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQ-ISTLSYNGTFSS 709
             I  LQLN DL + +   +  GG T  I  YS GLLF G +N+SS   +  LS+NGTFSS
Sbjct: 661  NIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSS 720

Query: 710  FGNLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGI 769
            F  L  N+T F N T + SELL FNN Y++NVSS  YI N + F  S+ + G+NS  D +
Sbjct: 721  FSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTL 780

Query: 770  LVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDST 829
            L+G + + +Y+  N  + +   +S+ ++   S      Y A ++ND++  YAY    D  
Sbjct: 781  LLGNIVRSEYSNFNEPLKLYGNSSLESLTFSS--SIVPYAAVFLNDTANLYAYK---DGE 835

Query: 830  HHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNG-TSLSLFNISNSKMI 888
            +  +I   N +  L   +S  +N + ++ + SLL    NA   NG +SL + NIS+   +
Sbjct: 836  NSKIIYGNNMTTSL--DFSGTLNKLSFSNNSSLLFA--NAITNNGSSSLVISNISDGMSL 891

Query: 889  GEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSIS 948
              ENL     + +++ FN N+++LV G+FT+  DD  C G+CLYNY   KWS F N++I 
Sbjct: 892  ASENLNNYGYITSMIDFNSNNTILVSGNFTL--DDVDCHGICLYNYFTKKWSAFANSTIK 949

Query: 949  GNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTM-VQSFVTFDHT 1007
            G+I ++Q +N  Q+LISG    +N + I LA L++    +++L   S + + SF+   H 
Sbjct: 950  GSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFI---HD 1006

Query: 1008 TDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGD 1067
               +   S++ I  Y + +W  ++  +         + + +   +S  +VS + L   G+
Sbjct: 1007 GQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVS-KILFAYGE 1065

Query: 1068 LKHSTYGSVSAMLYDFEDWMPYFIVDG--ENAGRASNIFMNKDLSSLYTTQ-----TILQ 1120
               + YG ++AML+   DW PYF ++    N   A  +F N+DLSSL+ ++      I  
Sbjct: 1066 FNSTLYGRLNAMLFRAGDWKPYFSINNFQVNEDPAITLFENRDLSSLFNSKNSLPANITS 1125

Query: 1121 GXXXXXXXXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXX 1180
                              +K E    KIDRGFVVLI                        
Sbjct: 1126 AETSSRSTVSSATATTVVNKIEGKHSKIDRGFVVLI-ALALAVGTVALLGLFGVTIAYIF 1184

Query: 1181 XNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
             ++ +YE +KPR+D  +M+DTVPPEKLMKF+
Sbjct: 1185 RDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1236 (38%), Positives = 724/1236 (58%), Gaps = 51/1236 (4%)

Query: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60
            M    K++ +      L   SQLS L+  L IQ  + P +  SS+ +  + LLG ++ L+
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   FYRYTGQENFTGSITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILS 118
             Y YTGQ+NF+  IT       L+YYSN T I+L+   D+     IN+I+P G DSFILS
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDD---TRINNIVPIGSDSFILS 117

Query: 119  GTGTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTG 178
            G+G+L   ++LE QL YNLSSL    IFN ++  V  IL D+++VYFGG F ++ G   G
Sbjct: 118  GSGSL-NEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDG 176

Query: 179  HSVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSN 238
            HSV +WN T+N   LLPF GFG +S +N+ILRL++DNI+FAG+F TLDD +LL     SN
Sbjct: 177  HSVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTS-NTSN 235

Query: 239  SSKNATDIEFDQLIPLKHAGWSSQGS-LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTD 297
            ++ N  D+E   L+PL  A WSS  S  + SS IC + DSD WF  GT TG    SL  D
Sbjct: 236  ATTNIYDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDAWFVSGT-TGTLACSLPYD 294

Query: 298  LRPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLE 357
               +K+RIYN+ DS  Q+S FR+I+ P+  IMN+TY+DP+TG L +CD++CPLLS + L 
Sbjct: 295  SALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLS 354

Query: 358  QAEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGF 417
             A       S+    + +N T IKW++ YQEF FVN VS   L FLAL+SYGS+V L G+
Sbjct: 355  SASD-AASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGY 413

Query: 418  EMYQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY-DGTGDLPS 476
             +YQ+ Y  FAN++LN  +C + NS   + T S   W  G+   +Y+ + Y +G   +P 
Sbjct: 414  SLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQ 473

Query: 477  VNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEK 536
            V F  N+ Y+GDY +N+ TPGC+ DG+CS+RG+VNVTV+D+ +D++LST  IYQNN   K
Sbjct: 474  VTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALK 533

Query: 537  YDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSID------QSKIGLKTI 590
            YD L+SGYL+++ +I L++   I++DS+ + +VADR ++ + S+D       SK G    
Sbjct: 534  YDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTV- 592

Query: 591  NETLNGLFQYQI-SNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAF 649
               LNGLFQYQ+ +  +T ++ S K+G T +N+Y ++   +NS LFA  Y+N LLV GA 
Sbjct: 593  --ALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAE 650

Query: 650  NGIAVLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSS 709
              +  L+ ++DLN  +    G  G  + +  +S G+   G+FNLS      ++YNG+F+ 
Sbjct: 651  QSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNP 710

Query: 710  FGNL-RTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDG 768
            F     ++I  F N+T  +SE+LVFNN Y++NVSS+  + N+SS +LSLWSAG+N+  D 
Sbjct: 711  FTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDL 770

Query: 769  ILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDS 828
            +  GA SQ  Y+  N ++ I   N +   GL   +    Y   Y+N S  AY Y  ++D 
Sbjct: 771  LFNGASSQMSYSFNNESINIGANNIVQ--GLNFNESIDPYLGLYMNTSHGAYFY--QDDD 826

Query: 829  THHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMI 888
               V    G++       W + V   IY+ + SLL  GT++   + + L++ N +   +I
Sbjct: 827  NTRVYFTNGSQPS---WQWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVI 883

Query: 889  GEE-NLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSI 947
              E     +S ++ IV F  N++ ++GG+F++   + +C GLCL+NY  S WS+F + SI
Sbjct: 884  ANESLSSQQSQISGIVNFASNATAIIGGNFSM--PNVNCFGLCLFNYGNSTWSSFADASI 941

Query: 948  SGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHT 1007
            +G +  +Q FN ++L++SG   T+N + I +A LN+ +N++T L+ G +   +F +F   
Sbjct: 942  NGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGES--NTFKSFTVA 999

Query: 1008 TDELITQSDNEISYYTNGEW-----KNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNR-A 1061
              +++  ++  +S Y +  W      N+ S    D+L      + L    SKRD S+  A
Sbjct: 1000 DQKIVAWNNTALSIYEDNVWTVERISNINSSSVVDNL----NYVTLASALSKRDTSSSDA 1055

Query: 1062 LLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRASNIFMNKDLSSLYTTQTIL-- 1119
            +LV+G L  ++YG + AM+YDF  W+PY +++ E +  + N F+++D+SS   TQ  L  
Sbjct: 1056 ILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSE-SDSSINAFIDRDMSSFTNTQVALLT 1114

Query: 1120 ----QGXXXXXXXXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXX 1175
                                     N++   KIDRGFVVL+                   
Sbjct: 1115 NSGTVSNSSSSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIM 1174

Query: 1176 XXXXXXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
                  + G YEP+ PR+DE +MI+TVPPEKLMK++
Sbjct: 1175 AYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1241 (36%), Positives = 684/1241 (55%), Gaps = 70/1241 (5%)

Query: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60
            M   + ++ A   L  +V GS L S+ +  +I+    P++DLS++ N+ + +  DF+   
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   FYRYTGQENFTGSITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGT 120
            +Y Y GQ+ FTG        LIYYS GT+++L  L D+     +  I+PFG DSFILSGT
Sbjct: 61   YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTV---VRRIVPFGSDSFILSGT 117

Query: 121  GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS 180
            G L     LE QL+YNLS+LE T I  QS+ +VNDIL D ++VYFGG+F Y+ GN +GHS
Sbjct: 118  GKLQD-QRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHS 176

Query: 181  VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS 240
             V WN+T+    LLPF GFG  S VN+IL+L    ++F G+F+ L+  +  +      S+
Sbjct: 177  AVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLAST 236

Query: 241  K----NATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWF----QEGTATGDFTV 292
            +    N T IE + L  L+++  +S G L+    ICP+ + D WF     +G A G+  +
Sbjct: 237  EKPQLNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296

Query: 293  SLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLS 352
             +L  + PSK+RIYN+  +  ++ LFRI+TSP+  IMN+TY+DP TGEL+ CDAWCPL+ 
Sbjct: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356

Query: 353  TELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSV 412
               L  ++A  +  +D    + +    IKWT  YQEFAF+N++ +E + F+ALDSYG++V
Sbjct: 357  RSNL-TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415

Query: 413  GLDGFEMYQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTG 472
            GL G E++Q  Y  + N TLNQPNC        + T++   W QG+ D+SY+ +    + 
Sbjct: 416  GLVGVELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTANI--WHQGATDASYLSANVVESN 473

Query: 473  DLPSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNN 532
              P VN  P I ++G YTLN+ TPGC  DG+C  RGIVNVT+    N T L T+ IYQNN
Sbjct: 474  --PMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNN 530

Query: 533  NDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTIN- 591
               KYD LY+G+L+  P + +++   IN+  +  IMVADRV  IIDS+D    GL  I  
Sbjct: 531  YRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLD----GLDDIRH 586

Query: 592  ---ETLNGLFQYQISNFTTISNDSLKIG-NTTINRYSIENVPSNSELFAGYYNNTLLVDG 647
               ++LNGLFQY      T +  SL  G    IN+    ++P    L    Y+  L++  
Sbjct: 587  PREKSLNGLFQY------TPAGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGV 640

Query: 648  AFNG-IAVLQLND-DLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNG 705
               G IAV+     D N +   R    G   GI+ YS GL+F G FNLSS   S L Y+G
Sbjct: 641  KSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDG 700

Query: 706  TFSSFGNLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSK 765
             F SF +L +  +   N+TID SELL+FNN++I+N S+++ +  +S F LS  SA +NS 
Sbjct: 701  NFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQLSALSAAANSN 759

Query: 766  EDGILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSK 825
             D +  G+++  ++   +GAV ++   +I T G PS  G RV+   Y+ND++TAYAY S 
Sbjct: 760  NDLLFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSV 819

Query: 826  ND----STHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFN 881
            +     +T  V+I     + +L  + +  V  MIY K  + L + TN  +    +L L++
Sbjct: 820  SPNSSVATGGVVIETPGNNFNLSNNIA-TVREMIYVKKTNFLVISTNEVEGTPGALILYD 878

Query: 882  ISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSN 941
            +   + +  E L     +N+IV F ++++LLVGG F  D     C  LCLYN+    WS 
Sbjct: 879  LRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFEKD----GCHDLCLYNFVKRSWSA 934

Query: 942  FYNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSF 1001
            F +  ISG I  LQF N   L+  G++  ++   I     ++  + V + +H     ++F
Sbjct: 935  FASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRV-VEQHEQPNGRAF 993

Query: 1002 ---VTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPL--KQTSSKRD 1056
               +T   + DE + +   ++ +Y+  EWK +T          G  L+ L   ++ +KR+
Sbjct: 994  NSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRN 1053

Query: 1057 -VSNRALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRASN-----IFMNKDLS 1110
             V N  ++++G +  S YG ++AM Y+FE+W PY+   G +A    N     IF+N+D+S
Sbjct: 1054 RVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDIS 1113

Query: 1111 SLYTTQTILQGXXXXXXXXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXX 1170
               TT   L+                          K+ +G+VVLI              
Sbjct: 1114 RQTTTSLPLE------------VVVSDSPPTAEPKRKLAKGYVVLIALGLALATIALLGI 1161

Query: 1171 XXXXXXXXXXXNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211
                       +   Y+PLKPR++E +M+ TVPPEKLMKF+
Sbjct: 1162 IGVILAYAFGDHNA-YQPLKPRINEDEMLKTVPPEKLMKFI 1201

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1278 (35%), Positives = 698/1278 (54%), Gaps = 105/1278 (8%)

Query: 18   VTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALL--GDFEDLTFYRYTGQENFTGSI- 74
            V  +QL+ LK+ L I+++  PQ +L  S N  + LL    F+ L F  Y GQ+NFT  I 
Sbjct: 21   VVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPII 80

Query: 75   TETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLL 134
            + ++  LIYYSN T+I+L    D   +  I HIIP+G D+FILSGTG+L  G  L  QL+
Sbjct: 81   SSSQNHLIYYSNDTYIRL---LDIPYSTRIQHIIPYGQDAFILSGTGSL-NGFELSNQLV 136

Query: 135  YNLSSLEYTAIF-NQSISTVNDILADDE--IVYFGGEFQYTLGNS-TGHSVVLWNSTTNE 190
            YNL+ L  T IF N+ +  V  I  D +  +VYFGG F Y L +S   + +++W+S++N+
Sbjct: 137  YNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSND 196

Query: 191  IQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLK---QIRGSN------SSK 241
                 F GFG +SV+N+IL+L++++++F+G+F TLDD ++L     I   N      S +
Sbjct: 197  TISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQ 256

Query: 242  NATDIEFDQLIPLKHAGWSSQGS---LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDL 298
            N +  E +Q IPL    +S+  +   +  + LICP+ + + W  +  A G   ++L   +
Sbjct: 257  NVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKA-GSLQITLPFSI 315

Query: 299  RPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQ 358
            RPSK+RI+N+ D D +V+ FRI     N IM+L YLDP  G+L YC  +CPL +   L+ 
Sbjct: 316  RPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKL 375

Query: 359  AEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFE 418
              +N  + S  +  + NN T+IKW++ YQEFAFVN+  + +L F AL SYGS VGL G  
Sbjct: 376  FNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLS 435

Query: 419  MYQNGYPTFANDTLNQPNCDNINSY----------------SHAVTSSKQQWTQGSMDSS 462
            ++Q+    FAN++ N+P+C++  +Y                S+++  S   W     +S 
Sbjct: 436  LFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSIL-SDNDWYTPLPNSD 494

Query: 463  YILSTYDGTGDL-PSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDT 521
            Y+  TY  +  L P+V FYPN+ YAG+YT++M+TPGCT D SC SRGIVNVT+W+Q + +
Sbjct: 495  YLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSS 554

Query: 522  VLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSID 581
            +L T LIYQ N + K+D +++GYL+   KIT+ FY  + +++    +VADR+++II+S+D
Sbjct: 555  ILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLD 614

Query: 582  ----QSKIGLKTINETLNGLFQYQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAG 637
                 S   +   N TLNGLFQY    + +++N +    N+TIN+Y+  N P+N  L A 
Sbjct: 615  FVTTTSSNEIDIYNVTLNGLFQY--PEYNSVNNLNENYTNSTINQYAYSNYPANVSLIAA 672

Query: 638  YYN-NTLLVDGAFNGIAVLQLNDD-LNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSS 695
             Y+ +TLLV G+ N +   Q+  +  NI  +          GI  YS+GL+  GD   SS
Sbjct: 673  AYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSS 732

Query: 696  QQISTLSY-NGTFSSFGNLRTNITRFNNITIDDS-ELLVFNNRYIFNVSSNEYIRNTSSF 753
                 +++ N  F + GN    I  F+NI++  S E+L FNN+Y +N S+ E  +NTS+F
Sbjct: 733  GSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTF 792

Query: 754  ALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRV--YTAT 811
             LSLWSAG N++ D I  G VS+ +   L G V IN    I  + L    G  +  Y+A 
Sbjct: 793  ELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNL----GNNIYPYSAV 848

Query: 812  YINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGD 871
            ++NDSST YAY   N   + ++ + G   E +  SW + +++M +  ++SLL+VGT +  
Sbjct: 849  FLNDSSTIYAYMEPNTRLNRLIHSNG---EQISWSWKNKISSMAFFPNESLLSVGTISDK 905

Query: 872  TNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCL 931
                S S+ N++++K+I  E L   S +++++ F KNSS+LVGG+FT    D  CSGLCL
Sbjct: 906  DVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTF--SDYQCSGLCL 963

Query: 932  YNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTIL 991
            +NY    WS F NN++ G ++ L+  N + +LISG L T     I+LA LN+ +  V+IL
Sbjct: 964  FNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSIL 1023

Query: 992  RHGSTMVQSFVTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGA-QLIPLKQ 1050
               + +     +F+ T +++   + + +  Y N  W  +   +  +SL + +  +  +  
Sbjct: 1024 LQNTNL----TSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITN 1079

Query: 1051 TSSKRDVSNRAL------LVNGDLKHSTYGSVSAMLYDFEDWMPYF---IVDGENAGRAS 1101
             +S   +  RAL      +  G       G+V A+ Y  + W+PYF   + +  +   + 
Sbjct: 1080 KNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSI 1139

Query: 1102 NIFMNKDLSSLYTTQTILQG----------------------------XXXXXXXXXXXX 1133
            NIF NKD+SS   +  +L+                                         
Sbjct: 1140 NIFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSS 1199

Query: 1134 XXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXXXXXXXXXXXXXXXXXNKGQYEPLKPRV 1193
                  K ++   KI RGFVVLI                         ++G YE LKPR 
Sbjct: 1200 IIPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRT 1259

Query: 1194 DEGDMIDTVPPEKLMKFV 1211
             E +M D VPPEKLM FV
Sbjct: 1260 TEHEMFDAVPPEKLMPFV 1277

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1242 (36%), Positives = 699/1242 (56%), Gaps = 83/1242 (6%)

Query: 4    FLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYR 63
            +  ++   +    +   S L +++  LN  ++++P  D+ +  N++  +L D   ++FY 
Sbjct: 2    WCSVVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNK-NNQFQILDDINGISFYE 60

Query: 64   YTGQENFT--GSITETEKDLIYYSNGTFIKL-DSLSDENATADINHIIPFGDDSFILSGT 120
            Y GQ+NFT   ++T+ ++ LIYYSN TF+ L DS++ E   A I  IIP GDDSFILSG 
Sbjct: 61   YLGQQNFTTDANVTDVQR-LIYYSNETFMSLSDSIAAE---AQIQGIIPLGDDSFILSGQ 116

Query: 121  GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS 180
            G +    +L  QL++N++ L  T IF+  + ++  +  D  +VYF G F  T  N+TG  
Sbjct: 117  GMI-NNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNF--TFNNNTG-- 171

Query: 181  VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS 240
             ++W+S    I LLPF GFG  + +NSIL+L++DNI+FAG F+T+ +++LL Q   S  S
Sbjct: 172  AIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEES 231

Query: 241  -KNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLR 299
             +N T +  +  +PL+++ W + G L+ S LICP    D W    T TGDFT  L   + 
Sbjct: 232  VRNTTSLLLNPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVSAT-TGDFTCELPFQIT 290

Query: 300  PSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQA 359
            PSK+RIYN+ D D QVSLFR +T PA  IMNLTYLDP +G ++ CDA+CPL S  +L Q+
Sbjct: 291  PSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVL-QS 349

Query: 360  EANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEM 419
            + + T  +++VA I NN+TNI+WT  YQEFA V+ V+  SL F AL SYG+++GL GF++
Sbjct: 350  QWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQI 409

Query: 420  YQNGYPTFANDTLNQPNCDNINSYSH----AVTSSKQQWTQGSMDSSYILSTYDGTGDLP 475
            YQ  +  F N++ N PNC+N +  S+    + + S   WT         +  Y   G  P
Sbjct: 410  YQASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTS--------VGEYLTVGYTP 461

Query: 476  SVNFYPNITY------AGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIY 529
            + N  P +TY      +G+Y++N+ TPGC+ D +CS+RGIVN T++D + + +L+T LIY
Sbjct: 462  NENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIY 521

Query: 530  QNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKT 589
            QNN++ KYD LYSG L S+ +IT+ +Y  +   ++ + +VADRVD+ I S+D S    + 
Sbjct: 522  QNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSH-RTEV 580

Query: 590  INETLNGLFQYQISNFTTISNDS--LKIGNTTINRYSIENV-PSNSELFAGYYNNTLLVD 646
                LNGLFQYQISNFT   NDS  +KI NT++N++++ N  PS S       N+++L+ 
Sbjct: 581  SKLALNGLFQYQISNFT---NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLS 637

Query: 647  GAFNGIAVLQLNDDLNIISEQRMGTGGPTEGINTYSNGLLFL-GDFNLSSQQISTLSYNG 705
            G    +  + LN DL++ +  R+ +         YSNGL+ L G  N+S  + +  + N 
Sbjct: 638  GTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNT 697

Query: 706  TFSSFGNLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIR-NTSSFALSLWSAGSNS 764
            T    G+L T++    NIT++  ELLVFNN YI+NV+S +  R N+S F L++ SAG+NS
Sbjct: 698  TMD--GSLATDVA---NITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANS 752

Query: 765  KEDGILVGAVSQRQYTELNGAVYIN-DAN-SISTIGLPSFDGKRVYTATYINDSSTAYAY 822
              D I +G V Q QY   N +  +N D N  I  + LPS          ++ND ST Y Y
Sbjct: 753  INDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPS--NTVPSRGIFLNDDSTGYFY 810

Query: 823  SSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNI 882
               N S   + I   N +  L   W     T++Y+K+D+LL VG    +T  ++LSL N+
Sbjct: 811  KESNKS--KLYITNSNSTSGL--EWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNL 866

Query: 883  SNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNF 942
            ++  +I EENL   SS+++++ F KN +LLV GDF  +  + +CS LCLYNY + +W + 
Sbjct: 867  TSFDVIKEENLNVGSSISSLLYFAKNDTLLVAGDF--EPSNGNCSDLCLYNYKSGQWDSL 924

Query: 943  YNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFV 1002
             NNS+SG++  LQ +    +L+ GNL       +N+A +N+++N V  L        +  
Sbjct: 925  ANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLH 984

Query: 1003 TFDHTTDELITQSDNEISYYTNGEWKNLT--SEDFNDSLYMGAQLIPLKQTSSKRDVSNR 1060
            +   +   ++  +D  +  +    W  ++    D + +     Q I ++ T       + 
Sbjct: 985  SMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSVQFISMEGT-------DD 1037

Query: 1061 ALLVNGDLKHSTYGSVSAMLYDFEDWMPYFI-VDGENAGRASNIFMNKDLS--------- 1110
            ALL+ G+ +HS +G + +++Y+F DW+PY + VDG   G   ++FMN+D+S         
Sbjct: 1038 ALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTG-HLFMNRDISLHNIAQIPL 1096

Query: 1111 ----SLYTTQTILQGXXXXXXXXXXXXXXXXXDKNESSSDKIDRGFVVLIXXXXXXXXXX 1166
                 + T Q+                       ++     +DRGFVVLI          
Sbjct: 1097 LNSTRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVS 1156

Query: 1167 XXXXXXXXXXXXXXXNKG-QYEPLKPRVDEGDMIDTVPPEKL 1207
                           N G  Y+ L PR+DE  M++T+PPEKL
Sbjct: 1157 VMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1136 (36%), Positives = 627/1136 (55%), Gaps = 56/1136 (4%)

Query: 40   IDLSSSVNDEMALLGDFEDLTFYRYTGQENFT-GSITETEKDLIYYSNGTFIKLDSLSDE 98
            ++ SSS N+E+ LLG  E   +Y Y GQ+NFT  S ++ E +LIYYSN T ++LD++  +
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61

Query: 99   NATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILA 158
                ++ HIIPF DD FILSG GT+ G   L +Q+L NL+ L Y  IF + +  V  I  
Sbjct: 62   ---VEMRHIIPFMDDCFILSGIGTISGIE-LSRQILLNLTQLSYQPIFEKELGMVKSIFV 117

Query: 159  DDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVF 218
            D+E+VYFGG+  Y     +G SVV WNSTTN   LLPF GFG +S VNSI+RL+N+N++F
Sbjct: 118  DNEVVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLF 177

Query: 219  AGKFNTLDDNTLL-KQIRGSNSSKNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDS 277
             G+F  L++N+ + K  R  N S +  D E  Q I L+ A W++  +L+  + ICP+ D 
Sbjct: 178  TGQFAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQ 237

Query: 278  DGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQ 337
              W+ EG+  G  T +    L  SK+RIYN   +D Q+SLFR+I  P NGI+NLTYLDP 
Sbjct: 238  QAWYSEGSY-GVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPI 296

Query: 338  TGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSV 397
            + ++ +C   CPL + E L  A  NVT  SD + +I NN+TNIKW   YQEFAFVN++ +
Sbjct: 297  SHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPI 356

Query: 398  ESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQG 457
             SL F+A +SY  +VGL GF++YQ+ +P F N++ N+PNC + N  +  V  S   W   
Sbjct: 357  TSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTV 416

Query: 458  SMDSSYILSTY-DGTGDLPSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWD 516
            + D+SY+ ++Y    G  PS+ ++  I   G+Y LN+VTPGC  D +CS+RGIVNVT +D
Sbjct: 417  ANDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFD 476

Query: 517  QINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVI 576
              N  +L + LIYQNNN+ KYD +++G L ++  + +++Y  INT++ T+ +V   VDV+
Sbjct: 477  NSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVV 536

Query: 577  IDSIDQSKI-----GLKTINETLNGLFQYQISNFTTISNDSL--KIGNTTINRYSIENVP 629
              SI    I     G ++++  LNG+F+Y  SNF T  N  L  KI  T ++ + + N  
Sbjct: 537  RVSISSEFISDQIDGDRSLH--LNGIFEYSPSNF-TFDNGYLTGKIDYTILDDFGVSNFN 593

Query: 630  SNSELFAGYYNNTLLVDGAFNGIAVLQLND-DLNIISEQRMGTGGPTEGINTYSNGLLFL 688
              + +FA   N  L + G+ NG +V +LN  + + +        G   G+ +   GL+  
Sbjct: 594  KGASIFAVDQNQNLYL-GSTNG-SVYELNSLNGSSVPSTENNLSGLINGMYSVEEGLVIF 651

Query: 689  GDFNLSSQQISTLSYNGTFSSFGNLRTN-ITRFNNITIDDSELLVFNNRYIFNVSSNEYI 747
            G      ++   +  N + +    +  + I    N T+  S LLVF+N  IFN++S    
Sbjct: 652  GSIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVF 711

Query: 748  RNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRV 807
             NTS   L L +AG NS +D +LVG +  +     N ++ I+   + S   L   D   +
Sbjct: 712  ENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLS--DNDTI 769

Query: 808  YTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGT 867
              A Y+ND+   Y+ SS N +   +     +  + LP +W   V  + Y+    LL  G 
Sbjct: 770  EGAIYLNDTKALYSLSSGNVNYFQL-----SDKQRLPWTWQSTVVPVFYSNGQQLL--GA 822

Query: 868  NAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCS 927
               ++N + + L ++ +S++I +        +NAIV F  N++ LVGGDF++   + +C 
Sbjct: 823  IQENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSL--SNPACV 880

Query: 928  GLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNE 987
            GLCLYNYN S WS+F NNSI+GNI+ ++ FN TQ+L+SG L       INL  +N+ SN+
Sbjct: 881  GLCLYNYNNSNWSSFLNNSITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLTSNK 939

Query: 988  VTILRHGSTMVQSFVTFDHTTDELITQSDNEISYYTNGEWKNL------TSEDFNDSLYM 1041
              IL + +++V     F    + ++  +  +I      +W NL      T+   N     
Sbjct: 940  QDILLYNNSVVLD--DFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIENF 997

Query: 1042 GAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRAS 1101
            GA              SN AL++ G      YG+++A++YDF  W PYF VD  +     
Sbjct: 998  GAD-------------SNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATP 1044

Query: 1102 NIFMNKDLSSLYTTQTILQGX-XXXXXXXXXXXXXXXXDKNESSSDKIDRGFVVLI 1156
              F ++D SS   T+ ++                     K      KI RGFVVLI
Sbjct: 1045 LFFADRDQSSYGNTRHVVPDHIIVSSSHSSSAPSSSSSHKTNEKPYKIRRGFVVLI 1100

>NDAI0A06030 Chr1 complement(1366582..1369371) [2790 bp, 929 aa]
           {ON} Anc_3.73 YNL287W
          Length = 929

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 15/144 (10%)

Query: 598 FQYQISNFTTISNDSLKI-GNTTINRYSIENVPS--NSELFAG---YYNNTLLVDGAFNG 651
           FQ Q+  +    ++S++I     I  +++ + PS  +SE FA       + L V      
Sbjct: 265 FQNQLEQWFASRHESVQIECAKMITSFAMAH-PSYVSSEFFASTITLLQSMLTVPRPPTL 323

Query: 652 IAVLQLNDDLNIISEQRMGTGGPT-EGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSF 710
            A L++ + ++++S +++    P  E +  +SN        N+S+  I+TL   GT  + 
Sbjct: 324 FAALRILNKVSMVSPEKVVICNPELESLINHSNR-------NISTYAITTLLKTGTDKNI 376

Query: 711 GNLRTNITRFNNITIDDSELLVFN 734
            NL + IT+F +   DD ++++ N
Sbjct: 377 SNLISTITKFIHEVSDDFKIIIIN 400

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 137,599,108
Number of extensions: 6732964
Number of successful extensions: 18078
Number of sequences better than 10.0: 143
Number of HSP's gapped: 18519
Number of HSP's successfully gapped: 150
Length of query: 1211
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1090
Effective length of database: 39,606,813
Effective search space: 43171426170
Effective search space used: 43171426170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)